Metagenome Family F028438

Overview

Basic Information

• Family ID: F028438
• Family Type: Metagenome
• Number of Sequences: 191
• Average Sequence Length: 46 residues
• Representative Sequence: MLAVGRLVRIEKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGELVFV
• Number of Associated Samples: 6
• Number of Associated Scaffolds: 191

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 23.04 %
• % of genes near scaffold ends (potentially truncated): 43.98 %
• % of genes from short scaffolds (< 2000 bps): 78.01 %
• Associated GOLD sequencing projects: 4
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (50.262 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont (91.100 % of family members)
• Environment Ontology (ENVO): Unclassified (100.000 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal proximal gut (100.000 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 41.56%
  β-sheet: 0.00%
  Coil/Unstructured: 58.44%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 191 Family Scaffolds
PF00078	RVT_1	2.62
PF01582	TIR	1.05
PF08336	P4Ha_N	0.52
PF01266	DAO	0.52
PF02932	Neur_chan_memb	0.52
PF10192	GpcrRhopsn4	0.52
PF16197	KAsynt_C_assoc	0.52
PF00147	Fibrinogen_C	0.52
PF05485	THAP	0.52
PF00028	Cadherin	0.52

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
All Organisms	root	All Organisms	49.74 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
cellular organisms	root	All Organisms → cellular organisms	49.21 %
Viruses	superkingdom	All Organisms → Viruses	0.52 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	46.60 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	2.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	46.07 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	2.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	15.71 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	2.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	15.71 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	14.66 %
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	2.62 %
Cnidaria	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria	1.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	9.95 %
Deuterostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia	4.71 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	2.62 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	1.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	8.38 %
Echinodermata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata	3.14 %
Cytophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae	2.62 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	1.57 %
Spiralia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia	1.57 %
Octocorallia	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	8.38 %
Eleutherozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa	3.14 %
Candidatus Nephrothrix	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix	2.62 %
Craniata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata	1.57 %
Lophotrochozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa	1.57 %
Malacalcyonacea	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	8.38 %
Echinozoa	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa	3.14 %
unclassified Candidatus Nephrothrix	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix	2.62 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	1.57 %
Vertebrata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata	1.57 %
Plexauridae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea → Plexauridae	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	8.38 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2.62 %
Echinoidea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea	1.57 %
Holothuroidea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea	1.57 %
Gnathostomata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata	1.57 %
Polychaeta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	0.52 %
Clitellata	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata	0.52 %
Paramuricea	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea → Plexauridae → Paramuricea	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	8.38 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2.62 %
Euechinoidea	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea	1.57 %
Aspidochirotacea	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea	1.57 %
Teleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi	1.57 %
Hirudinea	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea	0.52 %
Paramuricea clavata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea → Plexauridae → Paramuricea → Paramuricea clavata	0.52 %
Polychaeta incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Crustacea	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea	8.38 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2.62 %
Echinacea	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea	1.57 %
Aspidochirotida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida	1.57 %
Euteleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi	1.57 %
Rhynchobdellida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida	0.52 %
Dinophilidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae	0.52 %
Paramuricea clavata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea → Plexauridae → Paramuricea → Paramuricea clavata	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Branchiopoda	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda	8.38 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2.62 %
Stichopodidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae	1.57 %
Actinopterygii	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii	1.57 %
Camarodonta	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Camarodonta	1.05 %
Glossiphoniidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae	0.52 %
Temnopleuroida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida	0.52 %
Dimorphilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus	0.52 %
Paramuricea clavata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea → Plexauridae → Paramuricea → Paramuricea clavata	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Phyllopoda	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda	8.38 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2.62 %
Actinopteri	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri	1.57 %
Apostichopus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus	1.57 %
Echinidea	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Camarodonta → Echinidea	1.05 %
Helobdella	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella	0.52 %
Toxopneustidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae	0.52 %
Dimorphilus gyrociliatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	0.52 %
Paramuricea clavata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea → Plexauridae → Paramuricea → Paramuricea clavata	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Diplostraca	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca	8.38 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2.62 %
Neopterygii	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii	1.57 %
Apostichopus japonicus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	1.57 %
Strongylocentrotidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Camarodonta → Echinidea → Strongylocentrotidae	1.05 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.52 %
Lytechinus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae → Lytechinus	0.52 %
Dimorphilus gyrociliatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	0.52 %
Paramuricea clavata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea → Plexauridae → Paramuricea → Paramuricea clavata	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Cladocera	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera	8.38 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2.62 %
Teleostei	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei	1.57 %
Apostichopus japonicus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	1.57 %
Strongylocentrotus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Camarodonta → Echinidea → Strongylocentrotidae → Strongylocentrotus	1.05 %
Lytechinus variegatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae → Lytechinus → Lytechinus variegatus	0.52 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.52 %
Dimorphilus gyrociliatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	0.52 %
Paramuricea clavata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea → Plexauridae → Paramuricea → Paramuricea clavata	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Anomopoda	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda	8.38 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2.62 %
Osteoglossocephalai	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai	1.57 %
Apostichopus japonicus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	1.57 %
Strongylocentrotus purpuratus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Camarodonta → Echinidea → Strongylocentrotidae → Strongylocentrotus → Strongylocentrotus purpuratus	1.05 %
Lytechinus variegatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae → Lytechinus → Lytechinus variegatus	0.52 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.52 %
Dimorphilus gyrociliatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	0.52 %
Paramuricea clavata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea → Plexauridae → Paramuricea → Paramuricea clavata	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Daphniidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae	8.38 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2.62 %
Clupeocephala	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala	1.57 %
Apostichopus japonicus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	1.57 %
Strongylocentrotus purpuratus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Camarodonta → Echinidea → Strongylocentrotidae → Strongylocentrotus → Strongylocentrotus purpuratus	1.05 %
Lytechinus variegatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae → Lytechinus → Lytechinus variegatus	0.52 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.52 %
Dimorphilus gyrociliatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	0.52 %
Paramuricea clavata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea → Plexauridae → Paramuricea → Paramuricea clavata	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	8.38 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2.62 %
Euteleosteomorpha	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha	1.57 %
Apostichopus japonicus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	1.57 %
Strongylocentrotus purpuratus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Camarodonta → Echinidea → Strongylocentrotidae → Strongylocentrotus → Strongylocentrotus purpuratus	1.05 %
Lytechinus variegatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae → Lytechinus → Lytechinus variegatus	0.52 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.52 %
Dimorphilus gyrociliatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	0.52 %
Paramuricea clavata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea → Plexauridae → Paramuricea → Paramuricea clavata	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	8.38 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2.62 %
Neoteleostei	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei	1.57 %
Apostichopus japonicus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	1.57 %
Strongylocentrotus purpuratus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Camarodonta → Echinidea → Strongylocentrotidae → Strongylocentrotus → Strongylocentrotus purpuratus	1.05 %
Lytechinus variegatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae → Lytechinus → Lytechinus variegatus	0.52 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.52 %
Dimorphilus gyrociliatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	0.52 %
Paramuricea clavata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea → Plexauridae → Paramuricea → Paramuricea clavata	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	8.38 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2.62 %
Eurypterygia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia	1.57 %
Apostichopus japonicus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	1.57 %
Strongylocentrotus purpuratus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Camarodonta → Echinidea → Strongylocentrotidae → Strongylocentrotus → Strongylocentrotus purpuratus	1.05 %
Lytechinus variegatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae → Lytechinus → Lytechinus variegatus	0.52 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.52 %
Dimorphilus gyrociliatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	0.52 %
Paramuricea clavata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea → Plexauridae → Paramuricea → Paramuricea clavata	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	8.38 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2.62 %
Ctenosquamata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata	1.57 %
Apostichopus japonicus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	1.57 %
Strongylocentrotus purpuratus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Camarodonta → Echinidea → Strongylocentrotidae → Strongylocentrotus → Strongylocentrotus purpuratus	1.05 %
Lytechinus variegatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae → Lytechinus → Lytechinus variegatus	0.52 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.52 %
Dimorphilus gyrociliatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	0.52 %
Paramuricea clavata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea → Plexauridae → Paramuricea → Paramuricea clavata	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	8.38 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2.62 %
Acanthomorphata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata	1.57 %
Apostichopus japonicus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	1.57 %
Strongylocentrotus purpuratus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Camarodonta → Echinidea → Strongylocentrotidae → Strongylocentrotus → Strongylocentrotus purpuratus	1.05 %
Lytechinus variegatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae → Lytechinus → Lytechinus variegatus	0.52 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.52 %
Dimorphilus gyrociliatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	0.52 %
Paramuricea clavata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea → Plexauridae → Paramuricea → Paramuricea clavata	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 26

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	8.38 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2.62 %
Euacanthomorphacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea	1.57 %
Apostichopus japonicus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	1.57 %
Strongylocentrotus purpuratus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Camarodonta → Echinidea → Strongylocentrotidae → Strongylocentrotus → Strongylocentrotus purpuratus	1.05 %
Lytechinus variegatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae → Lytechinus → Lytechinus variegatus	0.52 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.52 %
Dimorphilus gyrociliatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	0.52 %
Paramuricea clavata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea → Plexauridae → Paramuricea → Paramuricea clavata	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 27

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	8.38 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2.62 %
Percomorphaceae	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae	1.57 %
Apostichopus japonicus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	1.57 %
Strongylocentrotus purpuratus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Camarodonta → Echinidea → Strongylocentrotidae → Strongylocentrotus → Strongylocentrotus purpuratus	1.05 %
Lytechinus variegatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae → Lytechinus → Lytechinus variegatus	0.52 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.52 %
Dimorphilus gyrociliatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	0.52 %
Paramuricea clavata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea → Plexauridae → Paramuricea → Paramuricea clavata	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 28

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	8.38 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2.62 %
Ovalentaria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Ovalentaria	1.57 %
Apostichopus japonicus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	1.57 %
Strongylocentrotus purpuratus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Camarodonta → Echinidea → Strongylocentrotidae → Strongylocentrotus → Strongylocentrotus purpuratus	1.05 %
Lytechinus variegatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae → Lytechinus → Lytechinus variegatus	0.52 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.52 %
Dimorphilus gyrociliatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	0.52 %
Paramuricea clavata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea → Plexauridae → Paramuricea → Paramuricea clavata	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 29

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	8.38 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2.62 %
Blenniimorphae	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Ovalentaria → Blenniimorphae	1.57 %
Apostichopus japonicus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	1.57 %
Strongylocentrotus purpuratus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Camarodonta → Echinidea → Strongylocentrotidae → Strongylocentrotus → Strongylocentrotus purpuratus	1.05 %
Lytechinus variegatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae → Lytechinus → Lytechinus variegatus	0.52 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.52 %
Dimorphilus gyrociliatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	0.52 %
Paramuricea clavata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea → Plexauridae → Paramuricea → Paramuricea clavata	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 30

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	8.38 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2.62 %
Blenniiformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Ovalentaria → Blenniimorphae → Blenniiformes	1.57 %
Apostichopus japonicus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	1.57 %
Strongylocentrotus purpuratus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Camarodonta → Echinidea → Strongylocentrotidae → Strongylocentrotus → Strongylocentrotus purpuratus	1.05 %
Lytechinus variegatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae → Lytechinus → Lytechinus variegatus	0.52 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.52 %
Dimorphilus gyrociliatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	0.52 %
Paramuricea clavata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea → Plexauridae → Paramuricea → Paramuricea clavata	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 31

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	8.38 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2.62 %
Gobiesocoidei	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Ovalentaria → Blenniimorphae → Blenniiformes → Gobiesocoidei	1.57 %
Apostichopus japonicus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	1.57 %
Strongylocentrotus purpuratus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Camarodonta → Echinidea → Strongylocentrotidae → Strongylocentrotus → Strongylocentrotus purpuratus	1.05 %
Lytechinus variegatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae → Lytechinus → Lytechinus variegatus	0.52 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.52 %
Dimorphilus gyrociliatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	0.52 %
Paramuricea clavata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea → Plexauridae → Paramuricea → Paramuricea clavata	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 32

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	8.38 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2.62 %
Gobiesocidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Ovalentaria → Blenniimorphae → Blenniiformes → Gobiesocoidei → Gobiesocidae	1.57 %
Apostichopus japonicus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	1.57 %
Strongylocentrotus purpuratus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Camarodonta → Echinidea → Strongylocentrotidae → Strongylocentrotus → Strongylocentrotus purpuratus	1.05 %
Lytechinus variegatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae → Lytechinus → Lytechinus variegatus	0.52 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.52 %
Dimorphilus gyrociliatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	0.52 %
Paramuricea clavata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea → Plexauridae → Paramuricea → Paramuricea clavata	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 33

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	8.38 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2.62 %
Gobiesocinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Ovalentaria → Blenniimorphae → Blenniiformes → Gobiesocoidei → Gobiesocidae → Gobiesocinae	1.57 %
Apostichopus japonicus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	1.57 %
Strongylocentrotus purpuratus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Camarodonta → Echinidea → Strongylocentrotidae → Strongylocentrotus → Strongylocentrotus purpuratus	1.05 %
Lytechinus variegatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae → Lytechinus → Lytechinus variegatus	0.52 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.52 %
Dimorphilus gyrociliatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	0.52 %
Paramuricea clavata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea → Plexauridae → Paramuricea → Paramuricea clavata	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 34

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	8.38 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2.62 %
Gouania	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Ovalentaria → Blenniimorphae → Blenniiformes → Gobiesocoidei → Gobiesocidae → Gobiesocinae → Gouania	1.57 %
Apostichopus japonicus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	1.57 %
Strongylocentrotus purpuratus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Camarodonta → Echinidea → Strongylocentrotidae → Strongylocentrotus → Strongylocentrotus purpuratus	1.05 %
Lytechinus variegatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae → Lytechinus → Lytechinus variegatus	0.52 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.52 %
Dimorphilus gyrociliatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	0.52 %
Paramuricea clavata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea → Plexauridae → Paramuricea → Paramuricea clavata	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Level 35

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.26 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	8.38 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2.62 %
Gouania willdenowi	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Ovalentaria → Blenniimorphae → Blenniiformes → Gobiesocoidei → Gobiesocidae → Gobiesocinae → Gouania → Gouania willdenowi	1.57 %
Apostichopus japonicus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	1.57 %
Strongylocentrotus purpuratus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Camarodonta → Echinidea → Strongylocentrotidae → Strongylocentrotus → Strongylocentrotus purpuratus	1.05 %
Lytechinus variegatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae → Lytechinus → Lytechinus variegatus	0.52 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.52 %
Dimorphilus gyrociliatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	0.52 %
Paramuricea clavata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea → Plexauridae → Paramuricea → Paramuricea clavata	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300004626|Ga0066188_1002828	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2973
3300004626|Ga0066188_1006845	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2382
3300004626|Ga0066188_1021980	All Organisms → cellular organisms → Eukaryota	1754
3300004626|Ga0066188_1033659	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	1537
3300004626|Ga0066188_1034993	Not Available	1518
3300004626|Ga0066188_1042076	Not Available	1427
3300004626|Ga0066188_1068374	Not Available	1195
3300004626|Ga0066188_1117586	Not Available	945
3300004626|Ga0066188_1124889	All Organisms → cellular organisms → Eukaryota → Opisthokonta	918
3300004626|Ga0066188_1126569	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	912
3300004626|Ga0066188_1130249	Not Available	899
3300004626|Ga0066188_1188218	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	736
3300004626|Ga0066188_1215582	All Organisms → cellular organisms → Eukaryota → Opisthokonta	677
3300004626|Ga0066188_1240844	Not Available	630
3300004626|Ga0066188_1267242	Not Available	587
3300004626|Ga0066188_1304370	Not Available	534
3300004626|Ga0066188_1319085	All Organisms → cellular organisms → Eukaryota → Opisthokonta	515
3300005968|Ga0056130_1019549	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	2820
3300005968|Ga0056130_1034713	Not Available	2296
3300005968|Ga0056130_1035511	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2277
3300005968|Ga0056130_1042253	Not Available	2119
3300005968|Ga0056130_1047688	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2011
3300005968|Ga0056130_1047824	Not Available	2009
3300005968|Ga0056130_1050368	Not Available	1964
3300005968|Ga0056130_1052256	Not Available	1931
3300005968|Ga0056130_1081307	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1559
3300005968|Ga0056130_1099133	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	1396
3300005968|Ga0056130_1105812	Not Available	1343
3300005968|Ga0056130_1131671	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1169
3300005968|Ga0056130_1134744	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1151
3300005968|Ga0056130_1135669	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Camarodonta → Echinidea → Strongylocentrotidae → Strongylocentrotus → Strongylocentrotus purpuratus	1146
3300005968|Ga0056130_1137595	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1135
3300005968|Ga0056130_1138695	Not Available	1129
3300005968|Ga0056130_1163416	Not Available	1004
3300005968|Ga0056130_1176338	Not Available	946
3300005968|Ga0056130_1176745	Not Available	944
3300005968|Ga0056130_1180050	Not Available	931
3300005968|Ga0056130_1211639	All Organisms → cellular organisms → Eukaryota → Opisthokonta	813
3300005968|Ga0056130_1214311	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	804
3300005968|Ga0056130_1221017	All Organisms → cellular organisms → Eukaryota → Opisthokonta	782
3300005968|Ga0056130_1223275	Not Available	775
3300005968|Ga0056130_1230078	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae → Lytechinus → Lytechinus variegatus	754
3300005968|Ga0056130_1236292	Not Available	736
3300005968|Ga0056130_1248998	All Organisms → cellular organisms → Eukaryota → Opisthokonta	700
3300005968|Ga0056130_1250504	Not Available	696
3300005968|Ga0056130_1282046	Not Available	618
3300005968|Ga0056130_1295929	Not Available	588
3300005968|Ga0056130_1296378	All Organisms → cellular organisms → Eukaryota → Opisthokonta	587
3300005968|Ga0056130_1299751	Not Available	580
3300005968|Ga0056130_1304104	All Organisms → cellular organisms → Eukaryota → Opisthokonta	571
3300005968|Ga0056130_1309923	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Ovalentaria → Blenniimorphae → Blenniiformes → Gobiesocoidei → Gobiesocidae → Gobiesocinae → Gouania → Gouania willdenowi	560
3300005968|Ga0056130_1314182	All Organisms → cellular organisms → Eukaryota → Opisthokonta	552
3300005968|Ga0056130_1318777	Not Available	543
3300005968|Ga0056130_1325947	All Organisms → cellular organisms → Eukaryota → Opisthokonta	530
3300005968|Ga0056130_1327412	Not Available	527
3300005968|Ga0056130_1343371	Not Available	500
3300005978|Ga0056129_1006864	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	5415
3300005978|Ga0056129_1009264	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4939
3300005978|Ga0056129_1021585	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3662
3300005978|Ga0056129_1022192	Not Available	3620
3300005978|Ga0056129_1031412	Not Available	3139
3300005978|Ga0056129_1031475	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3136
3300005978|Ga0056129_1052730	Not Available	2445
3300005978|Ga0056129_1068351	Not Available	2117
3300005978|Ga0056129_1075546	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	1993
3300005978|Ga0056129_1079897	Not Available	1923
3300005978|Ga0056129_1096441	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1698
3300005978|Ga0056129_1121704	Not Available	1428
3300005978|Ga0056129_1153093	Not Available	1177
3300005978|Ga0056129_1156691	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1153
3300005978|Ga0056129_1160186	Not Available	1130
3300005978|Ga0056129_1163673	Not Available	1107
3300005978|Ga0056129_1168376	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	1078
3300005978|Ga0056129_1178124	Not Available	1020
3300005978|Ga0056129_1182799	Not Available	994
3300005978|Ga0056129_1182833	Not Available	994
3300005978|Ga0056129_1201426	Not Available	899
3300005978|Ga0056129_1209649	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	862
3300005978|Ga0056129_1213246	Not Available	846
3300005978|Ga0056129_1218744	Not Available	823
3300005978|Ga0056129_1226175	Not Available	793
3300005978|Ga0056129_1226385	Not Available	792
3300005978|Ga0056129_1234283	Not Available	761
3300005978|Ga0056129_1253860	All Organisms → cellular organisms → Eukaryota → Opisthokonta	692
3300005978|Ga0056129_1266534	Not Available	652
3300005978|Ga0056129_1285552	All Organisms → cellular organisms → Eukaryota → Opisthokonta	599
3300005978|Ga0056129_1299693	Not Available	564
3300005978|Ga0056129_1304464	All Organisms → cellular organisms → Eukaryota → Opisthokonta	553
3300005978|Ga0056129_1310922	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	539
3300005978|Ga0056129_1313061	Not Available	534
3300005978|Ga0056129_1325558	Not Available	509
3300005978|Ga0056129_1325907	Not Available	508
3300005978|Ga0056129_1329169	All Organisms → cellular organisms → Eukaryota → Opisthokonta	502
3300006912|Ga0056114_1020729	Not Available	4730
3300006912|Ga0056114_1022687	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4545
3300006912|Ga0056114_1033183	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	3787
3300006912|Ga0056114_1041687	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3347
3300006912|Ga0056114_1043101	Not Available	3286
3300006912|Ga0056114_1051259	Not Available	2965
3300006912|Ga0056114_1062461	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2604
3300006912|Ga0056114_1064029	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2559
3300006912|Ga0056114_1068458	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2441
3300006912|Ga0056114_1084566	Not Available	2079
3300006912|Ga0056114_1089584	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	1983
3300006912|Ga0056114_1091336	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	1951
3300006912|Ga0056114_1092871	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1923
3300006912|Ga0056114_1096045	Not Available	1867
3300006912|Ga0056114_1099379	Not Available	1812
3300006912|Ga0056114_1103713	Not Available	1742
3300006912|Ga0056114_1108623	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Octocorallia → Malacalcyonacea → Plexauridae → Paramuricea → Paramuricea clavata	1667
3300006912|Ga0056114_1109239	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1659
3300006912|Ga0056114_1113555	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1599
3300006912|Ga0056114_1115389	Not Available	1575
3300006912|Ga0056114_1121468	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1496
3300006912|Ga0056114_1127919	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1418
3300006912|Ga0056114_1130069	Not Available	1394
3300006912|Ga0056114_1130193	Not Available	1392
3300006912|Ga0056114_1146814	Not Available	1220
3300006912|Ga0056114_1148507	Not Available	1204
3300006912|Ga0056114_1149957	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1191
3300006912|Ga0056114_1167255	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1044
3300006912|Ga0056114_1172142	Not Available	1007
3300006912|Ga0056114_1172375	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1005
3300006912|Ga0056114_1178105	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	965
3300006912|Ga0056114_1179302	All Organisms → cellular organisms → Eukaryota → Opisthokonta	957
3300006912|Ga0056114_1180694	Not Available	947
3300006912|Ga0056114_1183873	All Organisms → cellular organisms → Eukaryota → Opisthokonta	926
3300006912|Ga0056114_1197963	All Organisms → cellular organisms → Eukaryota → Opisthokonta	840
3300006912|Ga0056114_1210148	Not Available	775
3300006912|Ga0056114_1214343	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	755
3300006912|Ga0056114_1214592	All Organisms → cellular organisms → Eukaryota → Opisthokonta	754
3300006912|Ga0056114_1247591	All Organisms → cellular organisms → Eukaryota → Opisthokonta	620
3300006912|Ga0056114_1250425	Not Available	610
3300006912|Ga0056114_1251648	Not Available	606
3300006912|Ga0056114_1254861	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	596
3300006912|Ga0056114_1264696	Not Available	568
3300006912|Ga0056114_1268588	All Organisms → cellular organisms → Eukaryota → Opisthokonta	557
3300006912|Ga0056114_1274352	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	543
3300006912|Ga0056114_1284021	Not Available	520
3300006912|Ga0056114_1284471	All Organisms → cellular organisms → Eukaryota → Opisthokonta	519
3300006912|Ga0056114_1290136	All Organisms → cellular organisms → Eukaryota → Opisthokonta	507
3300006912|Ga0056114_1293959	Not Available	500
3300027289|Ga0209787_1004801	Not Available	3510
3300027289|Ga0209787_1007992	Not Available	3066
3300027289|Ga0209787_1013729	Not Available	2620
3300027289|Ga0209787_1025681	Not Available	2140
3300027289|Ga0209787_1028650	All Organisms → Viruses → Predicted Viral	2058
3300027289|Ga0209787_1038174	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1852
3300027289|Ga0209787_1044863	Not Available	1738
3300027289|Ga0209787_1050595	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	1652
3300027289|Ga0209787_1089502	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	1248
3300027289|Ga0209787_1093105	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Camarodonta → Echinidea → Strongylocentrotidae → Strongylocentrotus → Strongylocentrotus purpuratus	1221
3300027289|Ga0209787_1113371	Not Available	1091
3300027289|Ga0209787_1116185	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	1075
3300027289|Ga0209787_1121699	Not Available	1045
3300027289|Ga0209787_1127444	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1015
3300027289|Ga0209787_1154269	Not Available	894
3300027289|Ga0209787_1199798	Not Available	724
3300027289|Ga0209787_1267991	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Ovalentaria → Blenniimorphae → Blenniiformes → Gobiesocoidei → Gobiesocidae → Gobiesocinae → Gouania → Gouania willdenowi	542
3300027289|Ga0209787_1284252	Not Available	507
3300027289|Ga0209787_1284275	Not Available	507
3300027392|Ga0209680_1010185	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4494
3300027392|Ga0209680_1015864	Not Available	3858
3300027392|Ga0209680_1023437	Not Available	3321
3300027392|Ga0209680_1036813	Not Available	2730
3300027392|Ga0209680_1037415	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	2710
3300027392|Ga0209680_1038441	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2676
3300027392|Ga0209680_1046865	Not Available	2431
3300027392|Ga0209680_1048991	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	2378
3300027392|Ga0209680_1059402	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2151
3300027392|Ga0209680_1063679	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2067
3300027392|Ga0209680_1067246	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2003
3300027392|Ga0209680_1067947	Not Available	1992
3300027392|Ga0209680_1072179	Not Available	1923
3300027392|Ga0209680_1074459	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1888
3300027392|Ga0209680_1094433	Not Available	1619
3300027392|Ga0209680_1100178	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	1550
3300027392|Ga0209680_1113296	Not Available	1410
3300027392|Ga0209680_1145674	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1139
3300027392|Ga0209680_1158726	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1052
3300027392|Ga0209680_1164520	Not Available	1015
3300027392|Ga0209680_1174280	Not Available	958
3300027392|Ga0209680_1183043	All Organisms → cellular organisms → Eukaryota → Opisthokonta	910
3300027392|Ga0209680_1185819	Not Available	895
3300027392|Ga0209680_1219042	All Organisms → cellular organisms → Eukaryota → Opisthokonta	728
3300027392|Ga0209680_1226584	Not Available	695
3300027392|Ga0209680_1236117	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	657
3300027392|Ga0209680_1250982	Not Available	601
3300027392|Ga0209680_1251971	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Ovalentaria → Blenniimorphae → Blenniiformes → Gobiesocoidei → Gobiesocidae → Gobiesocinae → Gouania → Gouania willdenowi	597
3300027392|Ga0209680_1256378	All Organisms → cellular organisms → Eukaryota → Opisthokonta	581
3300027392|Ga0209680_1266081	Not Available	547

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Annelida	Host-Associated → Annelida	100.00%

Category

Habitat	Taxonomy	Distribution
Digestive System	Host-Associated → Annelida → Digestive System	100.00%

Type

Habitat	Taxonomy	Distribution
Digestive Tube	Host-Associated → Annelida → Digestive System → Digestive Tube	91.10%
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified	8.90%

Subtype

Habitat	Taxonomy	Distribution
Extracellular Symbionts	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts	91.10%
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified	8.90%

Habitat

Habitat	Taxonomy	Distribution
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont	91.10%
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont	8.90%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300004626	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.2	Host-Associated
3300005968	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.2	Host-Associated
3300005978	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1	Host-Associated
3300006912	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.1	Host-Associated
3300027289	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.2 (SPAdes)	Host-Associated
3300027392	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1 (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0066188_10028283	3300004626	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKSPFYNTFDYFGCEIEFGDWPVVGDLLFV*
Ga0066188_10068451	3300004626	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIRDKVISKLRFYNTFNYLGYEREVGDWPILGELSRVGF*
Ga0066188_10219802	3300004626	Marine Gutless Worms Symbiont	MLAVGRLVRIVNTTGDKVISKLRFYKSFNNFGYEREVEDWPVVG*
Ga0066188_10336593	3300004626	Marine Gutless Worms Symbiont	MLAVGRLVRIVKSIGDKAISKSRFYNTFNYLGYERGVGNWPVVGELAFV*
Ga0066188_10349931	3300004626	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWRVQTPQ*
Ga0066188_10420761	3300004626	Marine Gutless Worms Symbiont	MFAVGRLVRIEKTTGDKVMVISKSTFYNALDYSGHEREVGD*
Ga0066188_10683741	3300004626	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKSRFYNTFNYLGYKREVGD*
Ga0066188_11175861	3300004626	Marine Gutless Worms Symbiont	MPAVSRLVRIVKTIGDKVISKLRFYNTFNYLGYEREVGDWPVDGELVFV*
Ga0066188_11248892	3300004626	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKSRFNNTFNYLGYEREVGDWPVVGELVFV*
Ga0066188_11265693	3300004626	Marine Gutless Worms Symbiont	MLAVGRLVRIEKTVGDKVISKSRFYNTFNYLGYEREVGDWPVVEELVFV*
Ga0066188_11302492	3300004626	Marine Gutless Worms Symbiont	MLAVGRLVRIEKTIGDKVISKSRFYNTFDYFGYERQVGYWPVI*
Ga0066188_11882181	3300004626	Marine Gutless Worms Symbiont	EKTIGDKVISKSRFYNTFNYLGCEREVADRPVVGELVFV*
Ga0066188_12155822	3300004626	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKSRFYNTFNYLGYERQVGDWPVVGELVFV*
Ga0066188_12408442	3300004626	Marine Gutless Worms Symbiont	IVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGDADVSEI*
Ga0066188_12672421	3300004626	Marine Gutless Worms Symbiont	MLAVGRLLRIVKTIGDKVISKLRFYNRFNYLGYEREVGDWPVVGELVFV*
Ga0066188_13043701	3300004626	Marine Gutless Worms Symbiont	MRAVGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWP
Ga0066188_13190852	3300004626	Marine Gutless Worms Symbiont	MDIQQSCFSGVMFAVGRLVGIEKTIGVKVISKWRFYNTFNYFGYERQVGDWPVVGKLVFV
Ga0056130_10195494	3300005968	Marine Gutless Worms Symbiont	LAVGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGD*
Ga0056130_10347131	3300005968	Marine Gutless Worms Symbiont	IVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVVGELVFV*
Ga0056130_10355113	3300005968	Marine Gutless Worms Symbiont	MLAVGRLVRILKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGELVFV*
Ga0056130_10422536	3300005968	Marine Gutless Worms Symbiont	GDKVISKSRFYNTFNYLGYEREVGDWPVVGELVFV*
Ga0056130_10476882	3300005968	Marine Gutless Worms Symbiont	VMLAIGRLVRIEKTMGDKVISKSRSYNTFNLGYEREVEDWPVVGELVFV*
Ga0056130_10478245	3300005968	Marine Gutless Worms Symbiont	MLAVGRLIGIEKTIVNKMISKWTFYKSFNNFGYEREVGDWPVDGELVFV*
Ga0056130_10503683	3300005968	Marine Gutless Worms Symbiont	AVGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVERNYPSLL*
Ga0056130_10522563	3300005968	Marine Gutless Worms Symbiont	VRIEKTIGDKVISKLRFYNTFNYLGYDREVGDWPVVGELVFV*
Ga0056130_10813071	3300005968	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTSEDKVISKSRFYNTFNYLAYEREVGDWPVVKELIFV*
Ga0056130_10991331	3300005968	Marine Gutless Worms Symbiont	KTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGELVFV*
Ga0056130_11058122	3300005968	Marine Gutless Worms Symbiont	MLAVSRLVRIVKTIGDKVISKLRFYNTFNYLGYEREVGDRPV
Ga0056130_11316713	3300005968	Marine Gutless Worms Symbiont	MIMDIQQSCFSGVMLAVSRLVRIVKTIGDKVISKLRFYKSFNNFRYEREVEDWPVFG
Ga0056130_11347441	3300005968	Marine Gutless Worms Symbiont	IGDKVISKSRFYNTFNYLGYEREVGDWPVVGELVFV*
Ga0056130_11356693	3300005968	Marine Gutless Worms Symbiont	GRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGKLVFVYCPE*
Ga0056130_11375951	3300005968	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKLRFYKSFNNFGYEREVRDWSVVG*
Ga0056130_11386951	3300005968	Marine Gutless Worms Symbiont	GRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVVELVFV*
Ga0056130_11634162	3300005968	Marine Gutless Worms Symbiont	VMLTVGRLVRIVKTIGDKVISKLRFYNTFNYLGYEREVGDRTVVGELVFV*
Ga0056130_11763381	3300005968	Marine Gutless Worms Symbiont	MPAVGRLVRIVKTIEDKVISKSTFYNAFDYFGYERNVRNWPIVGELAFV*
Ga0056130_11767452	3300005968	Marine Gutless Worms Symbiont	VRIVKSIGDKAISKSRFYNTFNYLGYERDVGNWPVVGELAFV*
Ga0056130_11800502	3300005968	Marine Gutless Worms Symbiont	MLAVGRLVKIVKTTGDKVISKLRLYKSFNNFGYEREVEDWPVVG*
Ga0056130_12116392	3300005968	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKLRYYNMFNYLGYEREVRDWPVVVELVFV*
Ga0056130_12143112	3300005968	Marine Gutless Worms Symbiont	LSQSCEDRTLMLAVGRLLRIVKTIGDKVISKLRFYDTFNYLGYEREVGDWPEVGELVFV*
Ga0056130_12210172	3300005968	Marine Gutless Worms Symbiont	MMLAVGRLVRIVKIIGDKVISKLRFYNTFNYFGYEREVGDWPVVGELVFV*
Ga0056130_12232751	3300005968	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREFGDWPVDGELVFV*
Ga0056130_12300782	3300005968	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREIGDRPVV*
Ga0056130_12362922	3300005968	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVSSQSRFYNTFNYLGYEREVGDWPVV*
Ga0056130_12489982	3300005968	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVNSKSRFYNTLNYLGYESEVGDWPIVGELVFV*
Ga0056130_12505042	3300005968	Marine Gutless Worms Symbiont	VRIVKTIGDKVISKLRFYNTFNYLGYEREVGDRPVVGELV
Ga0056130_12820461	3300005968	Marine Gutless Worms Symbiont	MLAVGRLVRIEKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGELVFV
Ga0056130_12959291	3300005968	Marine Gutless Worms Symbiont	RLVRIVKTIGDKVISKLRFYNTFNYLGYEREVGDWPAGGELVFV*
Ga0056130_12963781	3300005968	Marine Gutless Worms Symbiont	MLAVGRLVKIVKTIGDKVISKLRFYNTFNYLGYERQVGDWPIVGKLVFV*
Ga0056130_12997511	3300005968	Marine Gutless Worms Symbiont	MPAAGRLVRIVKTNGDKVISESRFYNTFNYLGYEREVGDWPVVGELVFV*
Ga0056130_13041041	3300005968	Marine Gutless Worms Symbiont	MLAVGRLVKIVKTIGDKVISKSRFYNTLYYLGYERQVGDWPVVGELVFV*
Ga0056130_13099232	3300005968	Marine Gutless Worms Symbiont	MDIQQSCFSGVMLAVGRLVRIVKTTGNKVISKLRFYKSFNNFGYEREVRDWSVVG*
Ga0056130_13141822	3300005968	Marine Gutless Worms Symbiont	MLAVRRLVRIEKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGALVFV*
Ga0056130_13187772	3300005968	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKLRFYNTFNYLGYVREVGDWPIVGKLVFV*
Ga0056130_13259472	3300005968	Marine Gutless Worms Symbiont	VKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGELVFV*
Ga0056130_13274121	3300005968	Marine Gutless Worms Symbiont	RIVKTIGDKVISKSRFYNTFNYLGYEREVGDCPVVGELVFV*
Ga0056130_13433711	3300005968	Marine Gutless Worms Symbiont	GRLVRIVKTIGDKVISKLRFYKSFNNFGYEREVGDWPVVG*
Ga0056129_10068641	3300005978	Marine Gutless Worms Symbiont	KTIGDKVISKLRFYNTFNYLGYEREVGDRPVVGELVFV*
Ga0056129_10092646	3300005978	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGDCPVVGELVFV*
Ga0056129_10215851	3300005978	Marine Gutless Worms Symbiont	IGDKVISKSRFYNTFNYIGYEREVGDWPVVGELVFV*
Ga0056129_10221921	3300005978	Marine Gutless Worms Symbiont	VRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVDGELVFV*
Ga0056129_10314121	3300005978	Marine Gutless Worms Symbiont	VRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWLS*
Ga0056129_10314756	3300005978	Marine Gutless Worms Symbiont	GRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVG*
Ga0056129_10527304	3300005978	Marine Gutless Worms Symbiont	AVGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVVGELVFV*
Ga0056129_10683516	3300005978	Marine Gutless Worms Symbiont	IVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGELVFV*
Ga0056129_10755461	3300005978	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGNWPVVGELVFV*
Ga0056129_10798971	3300005978	Marine Gutless Worms Symbiont	LAVGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVERNYPSLL*
Ga0056129_10964411	3300005978	Marine Gutless Worms Symbiont	VRIAKTIGDKVISKSRFYNTFNYFGYEREVGDWPAVGELGLCLK*
Ga0056129_11217044	3300005978	Marine Gutless Worms Symbiont	LAVGRLVRIVKTIGDKVISKLRFYNTFNYLGYEREVGDWPIVGELVFV*
Ga0056129_11530932	3300005978	Marine Gutless Worms Symbiont	VMLAVGRLVRIVKTIGDKVISKLRFYNTFNYLGYDREVGDWPVVGELVFV*
Ga0056129_11566913	3300005978	Marine Gutless Worms Symbiont	MLAVGRLVRIVKSIGDKAISKSRFYNTFNYLGYEREVGNWPVVGELAFV*
Ga0056129_11601861	3300005978	Marine Gutless Worms Symbiont	VGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWSVEGELVFV*
Ga0056129_11636732	3300005978	Marine Gutless Worms Symbiont	MLAVGRLVRIEKTIGDKVISKSRFYNTFNYLRYEREVGNWPVVGELVFV*
Ga0056129_11683762	3300005978	Marine Gutless Worms Symbiont	MLAVGTLVRIVKTIGDKVISKLRFYNTFNYLGYEREVGDWPGVGELVFV*
Ga0056129_11781243	3300005978	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKSRFYNTFNYLGYESAVDIE*
Ga0056129_11827992	3300005978	Marine Gutless Worms Symbiont	RLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGVC*
Ga0056129_11828331	3300005978	Marine Gutless Worms Symbiont	MLAVGRLVKIDKTIGDKVISKSTFYNTFDCFGNEREVADRLVVGELVFV*
Ga0056129_12014262	3300005978	Marine Gutless Worms Symbiont	IVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGELVFAFSLSIKH*
Ga0056129_12096492	3300005978	Marine Gutless Worms Symbiont	MLAVGRLVRIEKTIGDKVISKSRFYNTFNYLGYEREAEDWPVVGQLVFV*
Ga0056129_12132462	3300005978	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKSRFYNSFNYLGYEREVGDWPVVGDADVSEI*
Ga0056129_12187443	3300005978	Marine Gutless Worms Symbiont	VGRLVGIEKTIGDKVISKSRFYNTFNYLGYEREVGDWPAGGELVFV*
Ga0056129_12261751	3300005978	Marine Gutless Worms Symbiont	VGRLVRIVKTIGDKVISKLRFYKSFNNFGYEREVGDWPVVG*
Ga0056129_12263851	3300005978	Marine Gutless Worms Symbiont	MLAVGRLVGIEKTIGDKVISKSRFYNTFNYLGYEREVGDWPAVGELVFV*
Ga0056129_12342831	3300005978	Marine Gutless Worms Symbiont	AVGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVIGELVFV*
Ga0056129_12538602	3300005978	Marine Gutless Worms Symbiont	IGDKVISKSRFYNTFSYLGYEREVGDWPVVGELVFV*
Ga0056129_12665342	3300005978	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTTEDKVISKLRFYNTFNYLGYERERLENWLVVGELVFV*
Ga0056129_12855522	3300005978	Marine Gutless Worms Symbiont	MLAVRRLLRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVG
Ga0056129_12996931	3300005978	Marine Gutless Worms Symbiont	MLAVGRLVRVVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGELVFV
Ga0056129_13044641	3300005978	Marine Gutless Worms Symbiont	MMLAVGRLVRIVKTIGDKVISKLRFYYTFNYLGYEREVGDWPVVGQLVFV*
Ga0056129_13109221	3300005978	Marine Gutless Worms Symbiont	MDIQQSCFSGVMLTVGRLVRIVKTIGDKLISKLRFYKSFNNFGYEREVGDWPIVG*
Ga0056129_13130611	3300005978	Marine Gutless Worms Symbiont	FSGVMLAVGRLVRIVKTIGDKVISKSRFYNTFDYFGCERQVGVGR*
Ga0056129_13255581	3300005978	Marine Gutless Worms Symbiont	VMLAVGRLVRIEKTIGDKVISKSRFYNTFNYLGYERQVGDWPVVGET*
Ga0056129_13259071	3300005978	Marine Gutless Worms Symbiont	MLAVGRLVMIVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGELVF
Ga0056129_13291692	3300005978	Marine Gutless Worms Symbiont	LSDVVGRLVRIVKSIGDKVMRKLRFYNTFNYLGYEREVGDWPIVGELVFV*
Ga0056114_10207299	3300006912	Marine Gutless Worms Symbiont	VMLAVGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWRVQTPQ*
Ga0056114_10226875	3300006912	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISRLRFYSTFNYIGYEREVGDWPVVGELVFV*
Ga0056114_103318311	3300006912	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGD*
Ga0056114_10416875	3300006912	Marine Gutless Worms Symbiont	VMLAVGRLVRIVKTIGDKVISKSPFYNTFDYFGCEIEFGDWPVVGDLLFV*
Ga0056114_10431017	3300006912	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWSQCAVVVS*
Ga0056114_10512591	3300006912	Marine Gutless Worms Symbiont	MLAVGRLIGIKKTIVNKMISKWTFYKSFNNFGYEREVRDWPVDGELVFV*
Ga0056114_10624611	3300006912	Marine Gutless Worms Symbiont	VRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGELVFVYCLE*
Ga0056114_10640291	3300006912	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISRLRFCNTFNYLGYERG*
Ga0056114_10684582	3300006912	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTLADKVTSKLRFYSTFNYLAYEREVKDWPVVGEMVFV*
Ga0056114_10845662	3300006912	Marine Gutless Worms Symbiont	GRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGET*
Ga0056114_10895841	3300006912	Marine Gutless Worms Symbiont	DKVISKLRFYNTFNYLGYEREVGDWPVVGELVFV*
Ga0056114_10913363	3300006912	Marine Gutless Worms Symbiont	VRIVKSIGDKAISKSRFYNTFNYLGYERGVGNWPVVGELAFV*
Ga0056114_10928712	3300006912	Marine Gutless Worms Symbiont	MLAVGRLRIVKTIADEVISKSRFYNTSNYLGYEREVGNWPVVGELVFV*
Ga0056114_10960451	3300006912	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTTGDKVINKLRFYNTFNYLGYEREVGDWPVVGELVLV*
Ga0056114_10993792	3300006912	Marine Gutless Worms Symbiont	MLAVGRLVRIEKTIGDKVISKSRFYNTFNYLGYEREVGDWTVI*
Ga0056114_11037134	3300006912	Marine Gutless Worms Symbiont	VRIVKTIGDKVISKLRFYYTFNYLGYEREVGDWPVVGQLVFV*
Ga0056114_11086231	3300006912	Marine Gutless Worms Symbiont	MLEVGRLVRIVKTIGDKVISKSRFYNTFNYFGYAREVGDWPVVGELI*
Ga0056114_11092392	3300006912	Marine Gutless Worms Symbiont	MLAVGTVVTTEKTIGDKVISKSRFYNTLNYFGYEREVGDWPIV*
Ga0056114_11135553	3300006912	Marine Gutless Worms Symbiont	VMLAVGRLVGIEKTIGDKVISKSRFYNTFNYFGYEREVGDWPVVGE
Ga0056114_11153891	3300006912	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIEDKVISKSRFYNTFNYLAYEREVGDWPAVKELIFV*
Ga0056114_11214682	3300006912	Marine Gutless Worms Symbiont	VISKSRFYNTFNYLGYEREVGDWPVVGELVFVYSRFLEK
Ga0056114_11279193	3300006912	Marine Gutless Worms Symbiont	MLAVGRLVRILKTIGDKLISKLRFYKSFNNFGYEREVGDWSVVG*
Ga0056114_11300691	3300006912	Marine Gutless Worms Symbiont	RLVRIVKTIGDKVISKLRFYNTFNYLGYEREVGDRPVVG*
Ga0056114_11301935	3300006912	Marine Gutless Worms Symbiont	CFSGVMLAVGRLVRIVKTIGDKVISISRFYKSFNNFGYEREVGDWPVVG*
Ga0056114_11468143	3300006912	Marine Gutless Worms Symbiont	MLAVGRLVMIVKTIGDKVISKLRFYNTFNYLGYEREVGDWPVIGELVFV*
Ga0056114_11485071	3300006912	Marine Gutless Worms Symbiont	VMLAVGRLVRIVKTIGDKVISKSRFYNTFNYLGYKREVGD*
Ga0056114_11499573	3300006912	Marine Gutless Worms Symbiont	LVRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGELVDVLEEKN*
Ga0056114_11672552	3300006912	Marine Gutless Worms Symbiont	VKIVKTIGDKVISKSRFYNTFNYLGYERQVGDWPVVGELVFV
Ga0056114_11721422	3300006912	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKLRFYNTFNYLGYEREVRDWPVVVELVFV*
Ga0056114_11723751	3300006912	Marine Gutless Worms Symbiont	LSDVVGRLVRIVKTTGDKVMRKLRFYNTFNYLGYEREVGDWPIVGELVFV*
Ga0056114_11781052	3300006912	Marine Gutless Worms Symbiont	MLAIGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVV
Ga0056114_11793022	3300006912	Marine Gutless Worms Symbiont	VMLAVGRLEKTIGDKMISKLTFCNTFDYFGYEREVGDWPVVGELVFV*
Ga0056114_11806942	3300006912	Marine Gutless Worms Symbiont	MLAVGRLVRIEKTIGDKVKSRFYNTFNYLGYERQVGDWPAVGELVFV*
Ga0056114_11838734	3300006912	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIADEVISKSRFYNTFNCFGYETAVGDWPVVGELVFV*
Ga0056114_11979631	3300006912	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKSRFYNTFNYIGYEREIEEWPVVAELVFV*
Ga0056114_12101482	3300006912	Marine Gutless Worms Symbiont	VRIVKTTGDKVISKLRFYNTFNYPGYEREVGDWPVVGEREERSGK*
Ga0056114_12143431	3300006912	Marine Gutless Worms Symbiont	VRIVKTIGDKVISKLRFYNTFNYLGYEREVGDWPVVGEL
Ga0056114_12145922	3300006912	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIKDKVISKLRFYNTFNYLGYERQVGDWPVVGELVFV*
Ga0056114_12475911	3300006912	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKSRLYNTFNNLGYEREVGDWPAVGELVFV*
Ga0056114_12504251	3300006912	Marine Gutless Worms Symbiont	MLAVRRLLRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWPV
Ga0056114_12516481	3300006912	Marine Gutless Worms Symbiont	MDIQQSCFSGVMLAVGRLVRTVKTTGNKVISKLRFYKSFNNFGYEREVGDWPVVG*
Ga0056114_12548611	3300006912	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKSRFYNTFNYLGYKTEVGDWPVVGELVIV*
Ga0056114_12646962	3300006912	Marine Gutless Worms Symbiont	MDIQQRCFSGVMLAVGRLVRIVKTIGDKVISKLRFYKSFNNFGYERDFGDWPVVG*
Ga0056114_12685881	3300006912	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKLRFYNTFNYLGYERKVGDWPIVGELVFV*
Ga0056114_12743522	3300006912	Marine Gutless Worms Symbiont	KTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGQLVFV*
Ga0056114_12840212	3300006912	Marine Gutless Worms Symbiont	MLAVGRLVRIVRTIRDKVISKLRFYKSFNSFGYEREVGDWPVVG*
Ga0056114_12844711	3300006912	Marine Gutless Worms Symbiont	MLAVSRLVRVVKTIGDKVISKSRFYNTFNYFGYERQVGNWPIVGELVFV*
Ga0056114_12901362	3300006912	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKLRFYNTFNYLGYEREVGDRPVVGELVFV*
Ga0056114_12939591	3300006912	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVFSKSRFYNTLNYLGYESEVGDWPIVGELVFV*
Ga0209787_10048012	3300027289	Marine Gutless Worms Symbiont	MLAVGRLVKIVKTTGDKVISKLRLYKSFNNFGYEREVEDWPVVG
Ga0209787_10079922	3300027289	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREFGDWPVDGELVFV
Ga0209787_10137293	3300027289	Marine Gutless Worms Symbiont	TIGDKVISKSRFYNTFNYLGYEREVGDWPVVGELVFV
Ga0209787_10256813	3300027289	Marine Gutless Worms Symbiont	VRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGELVFV
Ga0209787_10286502	3300027289	Marine Gutless Worms Symbiont	MLAVGRLVRMVKTIGDKVISKLRFYKSFNNFGYEREVGDWIVGLCLE
Ga0209787_10381743	3300027289	Marine Gutless Worms Symbiont	VMLAIGRLVRIEKTMGDKVISKSRSYNTFNLGYEREVEDWPVVGELVFV
Ga0209787_10448631	3300027289	Marine Gutless Worms Symbiont	IVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVVGELVFV
Ga0209787_10505951	3300027289	Marine Gutless Worms Symbiont	RLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGELDFV
Ga0209787_10895021	3300027289	Marine Gutless Worms Symbiont	MLAVGRLVRIEKTIGDKVISNSRFYNTFNYLGYEREVGDWPVVGELVFV
Ga0209787_10931052	3300027289	Marine Gutless Worms Symbiont	VGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGKLVFVYCPE
Ga0209787_11133711	3300027289	Marine Gutless Worms Symbiont	AVGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVERNYPSLL
Ga0209787_11161852	3300027289	Marine Gutless Worms Symbiont	VGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGELVFV
Ga0209787_11216991	3300027289	Marine Gutless Worms Symbiont	VRIEKTIGDKVISKLRFYNTFNYLGYDREVGDWPVVGELVFV
Ga0209787_11274441	3300027289	Marine Gutless Worms Symbiont	GDKVISKSRFYNTFNYLGYEREVGDWPVVGELVFV
Ga0209787_11542691	3300027289	Marine Gutless Worms Symbiont	VRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVVELVFV
Ga0209787_11997981	3300027289	Marine Gutless Worms Symbiont	IVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGELVFV
Ga0209787_12679912	3300027289	Marine Gutless Worms Symbiont	MDIQQSCFSGVMLAVGRLVRIVKTTGNKVISKLRFYKSFNNFGYEREVRDWSVVG
Ga0209787_12842521	3300027289	Marine Gutless Worms Symbiont	MPAVGRLVRIVKTIEDKVISKSTFYNAFDYFGYERNVRNWPIVGELAFV
Ga0209787_12842751	3300027289	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKLRYYNMFNYLGYEREVRDWPVVVELVFV
Ga0209680_10101853	3300027392	Marine Gutless Worms Symbiont	VRIEKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGELVFV
Ga0209680_10158643	3300027392	Marine Gutless Worms Symbiont	VGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGVC
Ga0209680_10234375	3300027392	Marine Gutless Worms Symbiont	MLAVGRLVRIAKTIGDKVISKSRFYNTFNYFGYEREVGDWPAVGELGLCLK
Ga0209680_10368133	3300027392	Marine Gutless Worms Symbiont	MLAVGRLVRILKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGELVFV
Ga0209680_10374151	3300027392	Marine Gutless Worms Symbiont	LVRIVKTIGDKVISKSRFYNTFNYLGYEREFGDWPVDGELVFV
Ga0209680_10384413	3300027392	Marine Gutless Worms Symbiont	RIVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGELVFV
Ga0209680_10468652	3300027392	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVVGELVFV
Ga0209680_10489912	3300027392	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVRDWPVVGELVFV
Ga0209680_10594022	3300027392	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKLRFYNTFNYLGYDREVGDWPVVGELVFV
Ga0209680_10636791	3300027392	Marine Gutless Worms Symbiont	VGRLVRIEKTIGDKVITKSRFYNTFDYLGYEREVGDWPAVGELVFV
Ga0209680_10672463	3300027392	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKLRFYKSFNNFGYEREVGDWPVVG
Ga0209680_10679471	3300027392	Marine Gutless Worms Symbiont	AVGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGDCPVVGELVFV
Ga0209680_10721792	3300027392	Marine Gutless Worms Symbiont	LAVGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVERNYPSLL
Ga0209680_10744593	3300027392	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKLRFYKSFNNFGYEREVRDWSVVG
Ga0209680_10944332	3300027392	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKMISKLRFYNTFNYLGYERRVGDWPIVGELVFV
Ga0209680_11001782	3300027392	Marine Gutless Worms Symbiont	MLAIGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGE
Ga0209680_11132963	3300027392	Marine Gutless Worms Symbiont	VMLAVGRLVRIVKTIGDKVIIKLRFYKSFNNFGYEREVGDWPVVG
Ga0209680_11456741	3300027392	Marine Gutless Worms Symbiont	MLAVGRLVRIVKSIGDKAISKSRFYNTFNYLGYEREVGNWPVVGELAFV
Ga0209680_11587261	3300027392	Marine Gutless Worms Symbiont	VKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGELVFV
Ga0209680_11645202	3300027392	Marine Gutless Worms Symbiont	VGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWPVVGDADVSEI
Ga0209680_11742801	3300027392	Marine Gutless Worms Symbiont	MDIQQSCFSGVMLTVGRLVRIVKTIGDKVISKLRFYKSFNNFGYEREIGDWPVVG
Ga0209680_11830431	3300027392	Marine Gutless Worms Symbiont	LSDVVGRLVRIVKSIGDKVMRKLRFYNTFNYLGYEREVGDWPIVGELVFV
Ga0209680_11858192	3300027392	Marine Gutless Worms Symbiont	VMLAVGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWLS
Ga0209680_12190422	3300027392	Marine Gutless Worms Symbiont	LAVGRLVRIEKTIGDKVISKSRFYNTFNYLGYEREAEDWPVVGQLVFV
Ga0209680_12265842	3300027392	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKLRFYKPFNNFGYEREVGDWPVVGWLVFVLSRFLEK
Ga0209680_12361172	3300027392	Marine Gutless Worms Symbiont	MMLAVGRLVRIVKTIGDKVISKSTFYNTFNYLGYEREVGDWPVVGELVFV
Ga0209680_12509821	3300027392	Marine Gutless Worms Symbiont	MLAVGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREIGDRPVV
Ga0209680_12519711	3300027392	Marine Gutless Worms Symbiont	DIQQSCFSGVMLAVGRLVRIVKTTGNKVISKLRFYKSFNNFGYEREVRDWSVVG
Ga0209680_12563781	3300027392	Marine Gutless Worms Symbiont	IGDKVISKSRFYNTFNYLGYEREVGDWPVVGELVFV
Ga0209680_12660812	3300027392	Marine Gutless Worms Symbiont	VGRLVRIVKTIGDKVISKSRFYNTFNYLGYEREVGDWSVEGELVFV