| Basic Information | |
|---|---|
| Family ID | F028364 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 192 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MATATITPDQNAVVAEIFIAAPPARVFQAISDPSQLPKWW |
| Number of Associated Samples | 167 |
| Number of Associated Scaffolds | 192 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.84 % |
| % of genes near scaffold ends (potentially truncated) | 94.79 % |
| % of genes from short scaffolds (< 2000 bps) | 85.42 % |
| Associated GOLD sequencing projects | 159 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.354 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.021 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.875 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.792 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.12% β-sheet: 14.71% Coil/Unstructured: 66.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 192 Family Scaffolds |
|---|---|---|
| PF08327 | AHSA1 | 66.67 |
| PF10604 | Polyketide_cyc2 | 4.69 |
| PF12840 | HTH_20 | 4.69 |
| PF01174 | SNO | 3.12 |
| PF00903 | Glyoxalase | 1.56 |
| PF00919 | UPF0004 | 0.52 |
| PF01680 | SOR_SNZ | 0.52 |
| PF13424 | TPR_12 | 0.52 |
| PF04072 | LCM | 0.52 |
| PF13738 | Pyr_redox_3 | 0.52 |
| PF01596 | Methyltransf_3 | 0.52 |
| PF00115 | COX1 | 0.52 |
| PF12681 | Glyoxalase_2 | 0.52 |
| PF06764 | DUF1223 | 0.52 |
| PF01022 | HTH_5 | 0.52 |
| PF01850 | PIN | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 192 Family Scaffolds |
|---|---|---|---|
| COG0118 | Imidazoleglycerol phosphate synthase glutamine amidotransferase subunit HisH | Amino acid transport and metabolism [E] | 3.12 |
| COG0311 | Pyridoxal 5'-phosphate synthase subunit PdxT (glutamine amidotransferase) | Coenzyme transport and metabolism [H] | 3.12 |
| COG0214 | Pyridoxal 5'-phosphate synthase subunit PdxS | Coenzyme transport and metabolism [H] | 0.52 |
| COG0621 | tRNA A37 methylthiotransferase MiaB | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
| COG3315 | O-Methyltransferase involved in polyketide biosynthesis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.52 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG5429 | Uncharacterized conserved protein, DUF1223 domain | Function unknown [S] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.35 % |
| Unclassified | root | N/A | 3.65 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps__Contig_94111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 989 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101243314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 830 | Open in IMG/M |
| 3300001356|JGI12269J14319_10347152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300005187|Ga0066675_10937677 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300005434|Ga0070709_10489125 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300005435|Ga0070714_100355948 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300005435|Ga0070714_100475217 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300005437|Ga0070710_10113408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 1631 | Open in IMG/M |
| 3300005526|Ga0073909_10015727 | All Organisms → cellular organisms → Bacteria | 2382 | Open in IMG/M |
| 3300005530|Ga0070679_100158224 | All Organisms → cellular organisms → Bacteria | 2240 | Open in IMG/M |
| 3300005532|Ga0070739_10055590 | All Organisms → cellular organisms → Bacteria | 2520 | Open in IMG/M |
| 3300005534|Ga0070735_10144850 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300005568|Ga0066703_10173473 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300005591|Ga0070761_10052954 | All Organisms → cellular organisms → Bacteria | 2286 | Open in IMG/M |
| 3300005591|Ga0070761_10707218 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300005610|Ga0070763_10287953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium loti | 900 | Open in IMG/M |
| 3300005616|Ga0068852_102578828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300005829|Ga0074479_11151448 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300005841|Ga0068863_101747765 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300005844|Ga0068862_100246458 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
| 3300005873|Ga0075287_1031077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 694 | Open in IMG/M |
| 3300005995|Ga0066790_10311528 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300006032|Ga0066696_10405746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 890 | Open in IMG/M |
| 3300006052|Ga0075029_100163075 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300006052|Ga0075029_100699604 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300006059|Ga0075017_100167722 | All Organisms → cellular organisms → Bacteria | 1573 | Open in IMG/M |
| 3300006059|Ga0075017_100356351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1090 | Open in IMG/M |
| 3300006086|Ga0075019_10677444 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300006102|Ga0075015_100086384 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300006102|Ga0075015_100281823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
| 3300006162|Ga0075030_101033858 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300006174|Ga0075014_100078690 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
| 3300006176|Ga0070765_101071871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 761 | Open in IMG/M |
| 3300006237|Ga0097621_100171093 | All Organisms → cellular organisms → Bacteria | 1872 | Open in IMG/M |
| 3300006854|Ga0075425_102313713 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300006893|Ga0073928_10209471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1520 | Open in IMG/M |
| 3300009521|Ga0116222_1367611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300009545|Ga0105237_10743835 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300009545|Ga0105237_11709028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300010043|Ga0126380_10528799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 912 | Open in IMG/M |
| 3300010046|Ga0126384_10407098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1150 | Open in IMG/M |
| 3300010048|Ga0126373_12655215 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300010361|Ga0126378_11050234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 917 | Open in IMG/M |
| 3300010361|Ga0126378_13035871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus albidus | 535 | Open in IMG/M |
| 3300010366|Ga0126379_11538121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300010366|Ga0126379_13436185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300010371|Ga0134125_12974768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300010373|Ga0134128_11976629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300010376|Ga0126381_103326180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300010379|Ga0136449_102098021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
| 3300010877|Ga0126356_10776107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300011411|Ga0153933_1036279 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1116 | Open in IMG/M |
| 3300012202|Ga0137363_11446441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300012205|Ga0137362_10673454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
| 3300012208|Ga0137376_11359611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300012359|Ga0137385_10869835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300012918|Ga0137396_10477621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
| 3300012948|Ga0126375_11174689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300012957|Ga0164303_10640771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
| 3300012960|Ga0164301_10179737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1327 | Open in IMG/M |
| 3300012960|Ga0164301_11632165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300012961|Ga0164302_11470212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300012971|Ga0126369_11598378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300012971|Ga0126369_13236386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300012977|Ga0134087_10819267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300012984|Ga0164309_10163375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1495 | Open in IMG/M |
| 3300013105|Ga0157369_10363826 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1502 | Open in IMG/M |
| 3300013307|Ga0157372_10910414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1020 | Open in IMG/M |
| 3300013308|Ga0157375_13510824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300014164|Ga0181532_10011799 | All Organisms → cellular organisms → Bacteria | 6749 | Open in IMG/M |
| 3300014164|Ga0181532_10446486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300016422|Ga0182039_10105125 | All Organisms → cellular organisms → Bacteria | 2095 | Open in IMG/M |
| 3300017823|Ga0187818_10294217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300017927|Ga0187824_10362822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300017942|Ga0187808_10382565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300017943|Ga0187819_10196776 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300017946|Ga0187879_10824256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300017955|Ga0187817_10176771 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300017955|Ga0187817_10991916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300017959|Ga0187779_10329582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 982 | Open in IMG/M |
| 3300017972|Ga0187781_10719491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300017975|Ga0187782_11053912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300017994|Ga0187822_10267151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300018009|Ga0187884_10174288 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300018037|Ga0187883_10594276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300018046|Ga0187851_10054692 | All Organisms → cellular organisms → Bacteria | 2592 | Open in IMG/M |
| 3300018047|Ga0187859_10442006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300018058|Ga0187766_10975069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300018090|Ga0187770_11505971 | Not Available | 548 | Open in IMG/M |
| 3300018431|Ga0066655_10548604 | Not Available | 772 | Open in IMG/M |
| 3300018468|Ga0066662_12964678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300020018|Ga0193721_1172717 | Not Available | 506 | Open in IMG/M |
| 3300020069|Ga0197907_10185498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300020078|Ga0206352_10065936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300020581|Ga0210399_10529168 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300020581|Ga0210399_10712924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300021170|Ga0210400_10704214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
| 3300021171|Ga0210405_11341483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300021181|Ga0210388_11400036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300021401|Ga0210393_11121950 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300021405|Ga0210387_11575164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300021407|Ga0210383_11614227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300021445|Ga0182009_10154049 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1093 | Open in IMG/M |
| 3300021474|Ga0210390_10057393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3206 | Open in IMG/M |
| 3300021477|Ga0210398_10835644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300021479|Ga0210410_11660650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300021560|Ga0126371_10098522 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2907 | Open in IMG/M |
| 3300021560|Ga0126371_10786339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1098 | Open in IMG/M |
| 3300021560|Ga0126371_12188495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300021860|Ga0213851_1080994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300022724|Ga0242665_10033784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1274 | Open in IMG/M |
| 3300024182|Ga0247669_1067972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300025446|Ga0208038_1047290 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300025464|Ga0208076_1060356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300025906|Ga0207699_11456789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300025914|Ga0207671_11374731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300025915|Ga0207693_11233042 | Not Available | 562 | Open in IMG/M |
| 3300025927|Ga0207687_10028760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3734 | Open in IMG/M |
| 3300025928|Ga0207700_10823691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
| 3300025928|Ga0207700_11591750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300025929|Ga0207664_10103973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2351 | Open in IMG/M |
| 3300025961|Ga0207712_10368588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1199 | Open in IMG/M |
| 3300026023|Ga0207677_10716036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 889 | Open in IMG/M |
| 3300026316|Ga0209155_1161680 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300026335|Ga0209804_1048510 | All Organisms → cellular organisms → Bacteria | 2081 | Open in IMG/M |
| 3300026530|Ga0209807_1230325 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300026538|Ga0209056_10304475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1094 | Open in IMG/M |
| 3300027024|Ga0207819_1047756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300027117|Ga0209732_1075144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300027583|Ga0209527_1013907 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
| 3300027737|Ga0209038_10012712 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2469 | Open in IMG/M |
| 3300027821|Ga0209811_10021543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2113 | Open in IMG/M |
| 3300027821|Ga0209811_10309774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300027826|Ga0209060_10543559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus albidus | 526 | Open in IMG/M |
| 3300027842|Ga0209580_10152102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1139 | Open in IMG/M |
| 3300027869|Ga0209579_10637328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300027879|Ga0209169_10328729 | Not Available | 804 | Open in IMG/M |
| 3300027898|Ga0209067_10457702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300027986|Ga0209168_10096809 | All Organisms → cellular organisms → Bacteria | 1525 | Open in IMG/M |
| 3300028536|Ga0137415_10070911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3346 | Open in IMG/M |
| 3300028536|Ga0137415_10627621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
| 3300028776|Ga0302303_10312041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300028795|Ga0302227_10420413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300028906|Ga0308309_10924313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300028906|Ga0308309_11020393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300029907|Ga0311329_10091187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2539 | Open in IMG/M |
| 3300029985|Ga0302280_1212791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300030011|Ga0302270_10038661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3461 | Open in IMG/M |
| 3300030524|Ga0311357_11149451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300031247|Ga0265340_10475768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300031344|Ga0265316_10055006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3115 | Open in IMG/M |
| 3300031344|Ga0265316_10992483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300031573|Ga0310915_10002126 | All Organisms → cellular organisms → Bacteria | 10451 | Open in IMG/M |
| 3300031682|Ga0318560_10721655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300031708|Ga0310686_104243970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300031715|Ga0307476_10866863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300031715|Ga0307476_11124045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300031718|Ga0307474_10722348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
| 3300031719|Ga0306917_10115736 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
| 3300031754|Ga0307475_10003227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9894 | Open in IMG/M |
| 3300031771|Ga0318546_10007156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5687 | Open in IMG/M |
| 3300031805|Ga0318497_10502883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300031831|Ga0318564_10416274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300031896|Ga0318551_10824448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300031897|Ga0318520_10144062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1376 | Open in IMG/M |
| 3300031939|Ga0308174_10568869 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300031945|Ga0310913_11306581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300031981|Ga0318531_10516835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300032039|Ga0318559_10547870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300032060|Ga0318505_10631121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300032067|Ga0318524_10051559 | All Organisms → cellular organisms → Bacteria | 1961 | Open in IMG/M |
| 3300032160|Ga0311301_10706301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1416 | Open in IMG/M |
| 3300032160|Ga0311301_12742076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300032180|Ga0307471_100037520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3835 | Open in IMG/M |
| 3300032180|Ga0307471_101834308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300032205|Ga0307472_101363690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300032770|Ga0335085_11529996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300032783|Ga0335079_10042631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5209 | Open in IMG/M |
| 3300032828|Ga0335080_10093939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3327 | Open in IMG/M |
| 3300032892|Ga0335081_10365888 | All Organisms → cellular organisms → Bacteria | 1871 | Open in IMG/M |
| 3300032892|Ga0335081_10586457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1379 | Open in IMG/M |
| 3300032892|Ga0335081_11600654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300032893|Ga0335069_10172466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2660 | Open in IMG/M |
| 3300032895|Ga0335074_10377013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1556 | Open in IMG/M |
| 3300032897|Ga0335071_10099788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2848 | Open in IMG/M |
| 3300032955|Ga0335076_10334957 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300033004|Ga0335084_11885713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300033158|Ga0335077_11202191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300033818|Ga0334804_134634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300033826|Ga0334847_042858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.02% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.29% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.25% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.21% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.69% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.17% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.65% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.60% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.60% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.60% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.56% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.56% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.56% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.04% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.04% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.04% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.04% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.04% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.04% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.04% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.04% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.04% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.52% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.52% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.52% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.52% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.52% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.52% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.52% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.52% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.52% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.52% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011411 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaG | Host-Associated | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300025446 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025464 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027024 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes) | Environmental | Open in IMG/M |
| 3300027117 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029985 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_1 | Environmental | Open in IMG/M |
| 3300030011 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033818 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-M | Environmental | Open in IMG/M |
| 3300033826 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_01630960 | 2199352024 | Soil | MVTTTVTPDQNAVIAEIFIAAPPARVFQAISDPAQLPRWWG |
| INPhiseqgaiiFebDRAFT_1012433141 | 3300000364 | Soil | MATAVITPDQDTILAEIFVAAPPERVFQAISDPAQTSQ |
| JGI12269J14319_103471521 | 3300001356 | Peatlands Soil | MATVSITPDQDTVLAEIHIAAPPERVFQAITDPRQM |
| Ga0066675_109376771 | 3300005187 | Soil | MATAQLTPDNDTILAEVFIAAPPDRVFEAIADPKQRAQWW |
| Ga0070709_104891251 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAAQVTPDHDAVHLEIFVAAPPARVFQAISDPAQSSQWWGQKGLYR |
| Ga0070714_1003559484 | 3300005435 | Agricultural Soil | MATATITPDQNAVIAEIFIAAPPARVFQAISDPAQLPKWWGQSGLYHV |
| Ga0070714_1004752173 | 3300005435 | Agricultural Soil | MAAAQVTPDHDAVHLEIFVAAPPARVFQAISDPAQSSQWWGQK |
| Ga0070710_101134084 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MATATITPDQNAVIAEIFIAAPPARVFQAISDPTQLPRWWGQDGLYRVTK |
| Ga0070699_1010204131 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MATNAVTPDQDAIALEVVIAAPADRVFQAITDPSQLLRWWGQQG |
| Ga0073909_100157275 | 3300005526 | Surface Soil | MATATITPDQNAVIAEVFIAAPPARVFQAISDPTQL |
| Ga0070679_1001582241 | 3300005530 | Corn Rhizosphere | MAIATVTPDQNAVIAEIFIAAPPARVFQAISDPAQLPKWWGQSGLYHVVKSTM |
| Ga0070739_100555905 | 3300005532 | Surface Soil | MATAVVTPDQDAVIAEIFIAAPPSRVFQAISDPNQIPRWWGQEGLY |
| Ga0070735_101448501 | 3300005534 | Surface Soil | MATATLTPDNDAILGEIFIAAPPARVFEAITDLKQ |
| Ga0066703_101734733 | 3300005568 | Soil | MATATITPDQNAVIAEIFIAAPPTRVFQAISDPAQLPKWWGQSGCITS* |
| Ga0070761_100529541 | 3300005591 | Soil | MATATITPDQNAVIVEIVIAAPPARVFQAISDPTQLPKWWGQSD |
| Ga0070761_107072182 | 3300005591 | Soil | MATVSITPDQDTVLAEIHIAAPPERVFQAITDPRQMPQ |
| Ga0070763_102879533 | 3300005610 | Soil | MATATITPDQNAVVAEIFIAAPPARVFQAISDPSQLPKWWGQDGLYH |
| Ga0068852_1025788282 | 3300005616 | Corn Rhizosphere | MATAQITPDQDAILAEIFIAAPPVRVFEAIADVNQR |
| Ga0074479_111514481 | 3300005829 | Sediment (Intertidal) | MATATITPDQDAIHAEIFVAAPPERVFEAITDPTQVPLWWGQTGMY |
| Ga0068863_1017477653 | 3300005841 | Switchgrass Rhizosphere | MATSAVTPDNDAVVAEVFIAAPPERVFQAITDPNQMPLWWGQQ |
| Ga0068862_1002464581 | 3300005844 | Switchgrass Rhizosphere | MATAAVTPDNDAVLAEVFIAAPPERVFQAITDPKQMPLWWG |
| Ga0075287_10310771 | 3300005873 | Rice Paddy Soil | MATATITPDQNAIVAEIFIAAPPARVFQAISDPAQLPRW |
| Ga0066790_103115283 | 3300005995 | Soil | MATATITPDQNTVIAEVFIAAPPARVFQAISDPQQMPQ |
| Ga0066696_104057461 | 3300006032 | Soil | MATTQITPDNNSILAEIFIAAPPDRVFQALTDPQQM |
| Ga0075029_1001630751 | 3300006052 | Watersheds | LATATLTPDQNAVIAEIFIAAPPARVFQAISDPTQLPKWWGQDGLY |
| Ga0075029_1006996042 | 3300006052 | Watersheds | MATSAVTPDNDALVVEVFIAAPPERVFQAITDPNQMPLWWGQQG |
| Ga0075017_1001677221 | 3300006059 | Watersheds | MATATVTPDQDVVRAEIFVAASPERVFEALTDPSQ |
| Ga0075017_1003563511 | 3300006059 | Watersheds | MATATLTPDQNAVITEIFIAAPPARVFQAISDPQQMPQWWGQTG |
| Ga0075019_106774441 | 3300006086 | Watersheds | MATATITPDQTAVIAEIFIAAPPARVFQAISDPAQLPKWWGQS |
| Ga0075015_1000863841 | 3300006102 | Watersheds | MATAAITPDQNAVIAEVFIAAPPARVFQAISDPAQLPRW |
| Ga0075015_1002818233 | 3300006102 | Watersheds | MATATLTPDQNAVITEIFIAAPPARVFQAISDPQQMPQWWGQTGLY |
| Ga0075030_1010338581 | 3300006162 | Watersheds | MATATITPDQNAVIAEIFIAAPPARVFQAISDPTQLPRWWGQDGLYRVT |
| Ga0075014_1000786901 | 3300006174 | Watersheds | MATATITPDQNTVIAEIFIAAPPARVFQAISDPTQLPRWWGQD |
| Ga0070765_1010718713 | 3300006176 | Soil | MATATLTPDLDTIIAEVFIAAPPTRVFQAISDPAQLPRWWGEDGQYH |
| Ga0097621_1001710931 | 3300006237 | Miscanthus Rhizosphere | MATAIVTPDNDAVLAEVFISAPPERVFQAITDPKQMPLWWGQQG |
| Ga0075425_1023137131 | 3300006854 | Populus Rhizosphere | MATAAITPDQDVVTAEIFIAAPPERVFQAITDPNQTLKWW |
| Ga0073928_102094714 | 3300006893 | Iron-Sulfur Acid Spring | MATATITPDQNTVIAEVFIAAPPARVFQAISDPQQMPQWWGQSGVY |
| Ga0116222_13676112 | 3300009521 | Peatlands Soil | VGDFKDQETTMATATITPDKNAVIAEIFIAAPPARVFQAISDPAQLPKWWGQTGLY |
| Ga0105237_107438353 | 3300009545 | Corn Rhizosphere | MATATITPDQNAVIAEVFIAAPPARVFQAISDPAQLPKWWGQSG |
| Ga0105237_117090282 | 3300009545 | Corn Rhizosphere | MATAQITPNNDAILAEIFIAAPPARVFEAITDPQQRMQW |
| Ga0126380_105287991 | 3300010043 | Tropical Forest Soil | MATSVLTPDQNAVVAEIFIAAPPARVFQAITDPRQVPSWW |
| Ga0126384_104070981 | 3300010046 | Tropical Forest Soil | MGRNLEFEGDRMATVAVTPDQNTITAEIFIAAPPARVFEAITDPRQMTKWWGQEGLYRV |
| Ga0126373_126552152 | 3300010048 | Tropical Forest Soil | MAAASITPDHDTILAEVFIAAPPARVFEAITDPKQR |
| Ga0126378_110502343 | 3300010361 | Tropical Forest Soil | MATATITPDQNTVIAEIFIAAPPGRVFQAISDPSQLPRWWG |
| Ga0126378_130358712 | 3300010361 | Tropical Forest Soil | MATSVLTPDQNAVVAEIFIAAPPARVFQAISDPAQLP |
| Ga0126379_115381213 | 3300010366 | Tropical Forest Soil | MATALITPDNDVVVAEILIQAPPARVFEAIADPKQ |
| Ga0126379_134361852 | 3300010366 | Tropical Forest Soil | MATAQITPDQDAILAEIFIAAPPARVFEAIADVNQ |
| Ga0134125_129747682 | 3300010371 | Terrestrial Soil | MATATLTPDNDAILAEIFIAAPPARVFEAIADPKQRAQWWGIKAPSGP |
| Ga0134128_119766291 | 3300010373 | Terrestrial Soil | MATAQVTPNHDSVQVEIFIAAPPARVFQAISDPAQTRQWWGDKGL |
| Ga0126381_1033261802 | 3300010376 | Tropical Forest Soil | MATALITPDNDVVVAEILIAAPPARVFEAIADPKQ |
| Ga0136449_1020980211 | 3300010379 | Peatlands Soil | MATASITPDQNAVIAEIFIAAPPARVFQAISDPAQLPKWW |
| Ga0126356_107761072 | 3300010877 | Boreal Forest Soil | MATATVTPDQNAVVAEIFIAAPPARVFQAISDPSQLPKWWGQ |
| Ga0153933_10362791 | 3300011411 | Attine Ant Fungus Gardens | MATSEITPDQNAVVAEIFIAAPPERVFQAITDPSQTQQW |
| Ga0137383_102543883 | 3300012199 | Vadose Zone Soil | MTTATTAATARITPDNDSVVAEVFMAAPPERVFQALVDP |
| Ga0137363_114464412 | 3300012202 | Vadose Zone Soil | MTTNAITPDQDAIALEVQIAAPPGRVFEAITDPTQLLRWWGQQGIY |
| Ga0137362_106734541 | 3300012205 | Vadose Zone Soil | MNRRDLMATVAITPDQDVVTAEIFIAAPPARVFEAITDPYQMPKWWGH |
| Ga0137376_113596112 | 3300012208 | Vadose Zone Soil | MATATITPDQNAVLAEIFIAAPPARVYQAISDPTQLPKWWGQDGLYHV |
| Ga0137385_108698351 | 3300012359 | Vadose Zone Soil | MATAQITPDHDAILAEIFIAAPPVRVFEAITDPKQRAQWWGQK |
| Ga0137396_104776213 | 3300012918 | Vadose Zone Soil | MATVAITPDQDVVTAEIFIAAPPARVFEAITDPYQMPKWWGQQGMYKI |
| Ga0126375_111746891 | 3300012948 | Tropical Forest Soil | MATSQIAHDHDTVQVEIFIGAPPARVFQAISDPAQTTQWWGQKGMYRLTKS |
| Ga0164303_106407711 | 3300012957 | Soil | MATAAVTPDNDAVLAEVFIAAPPERVFQAITDPQQMPLWWGQQGVYCVSEW |
| Ga0164301_101797373 | 3300012960 | Soil | MATTQITPDNNTVVAEVFIAAPPDRVFDALTDPRQ |
| Ga0164301_116321652 | 3300012960 | Soil | MATAQITPNNDAILAEIFIAAPPARVFEAITDPQQRM |
| Ga0164302_114702121 | 3300012961 | Soil | MATATITPDQDLIRAEIHIAAPPERVFAAISDPSQVGQWW |
| Ga0126369_115983782 | 3300012971 | Tropical Forest Soil | MAITPEQDTVLGEIFIAAPPARVFEAITDPKQIPHWWGQH |
| Ga0126369_132363861 | 3300012971 | Tropical Forest Soil | MATAAITPDQNAVIADIFIAAPPARVFQAISDPNQLPRWWGQAGL |
| Ga0134087_108192673 | 3300012977 | Grasslands Soil | MQGAEKMVTATVTPDQNAVVAEVFIAAPPARVFQAI |
| Ga0164309_101633754 | 3300012984 | Soil | MATAAVTPDNDAVLAEVFIAAPPERVFQAITDPKQMP* |
| Ga0157369_103638264 | 3300013105 | Corn Rhizosphere | MATAQIIQGNDTVEVEIFIAAPPTRVFQAISDPSQTAQWWGQKGLYRVTKAEAE |
| Ga0157372_109104144 | 3300013307 | Corn Rhizosphere | MATAAVTPDNDAVLAEVFIAAPPERVFQAITDPKQMP |
| Ga0157375_135108242 | 3300013308 | Miscanthus Rhizosphere | MATAQITPDQDAILAEIFIAAPPVRVFEAIADVNQRA |
| Ga0181532_100117996 | 3300014164 | Bog | MATATITPDHDTVLAEIFIAAPPERVFQAISDPNQLSQW* |
| Ga0181532_104464861 | 3300014164 | Bog | MATVAITPDQDVVSCEIFIAAPPARVFQAITDPRQLPQWW |
| Ga0182039_101051252 | 3300016422 | Soil | MATIAITPDQNVIEAEIFVAAPRERVFQALTDPTQTPLWWG |
| Ga0187818_102942171 | 3300017823 | Freshwater Sediment | MATATITPDKNTVVAEIFIAAPPARVFQAISDPTQLPKWWGQSGLYHVVK |
| Ga0187824_103628221 | 3300017927 | Freshwater Sediment | MATATITPNQNAVIAEVFIAAPPARVFQAISDPAQL |
| Ga0187808_103825651 | 3300017942 | Freshwater Sediment | MATSAISPNQDVVVAEIFIAAPPERVFQAITDPNQMPQ |
| Ga0187819_101967763 | 3300017943 | Freshwater Sediment | MATATITPDQTAVIAEIFIAAPPARVFQAISDPAQVPKWWGQTGLY |
| Ga0187879_108242561 | 3300017946 | Peatland | MATVAITPDQDVVTGEIFIAAPPARVFQALTEPNQMPQW |
| Ga0187817_101767713 | 3300017955 | Freshwater Sediment | MATMAITPDLDAVVGEIFIAAPPARVFEAITDPNQVPR |
| Ga0187817_109919162 | 3300017955 | Freshwater Sediment | MATAVLTPDQNAVIAEIFIAAPPARVFQALSDPAQLPKWWGQDG |
| Ga0187779_103295823 | 3300017959 | Tropical Peatland | MATAVLTPDQNAVIAEIFIAAPPARVFQAISDPAQLPKWWGQDGLYHVTKSTM |
| Ga0187781_107194912 | 3300017972 | Tropical Peatland | MATAVLTPDQDAVIAEIFIAAPPARVFQAISDPAQLPRWWGQDGLYHV |
| Ga0187782_110539121 | 3300017975 | Tropical Peatland | MATAVLTTDQNAVVAEIFIAAPPARVFQAISDPAQLPKWWGQD |
| Ga0187822_102671512 | 3300017994 | Freshwater Sediment | MATATITPDQNTIIAEIFIAAPPARVFQAISDPAQLPKWWG |
| Ga0187884_101742883 | 3300018009 | Peatland | MATVAITPDQDVVSCEIFIAAPPARVFQAITDPRQLPQ |
| Ga0187883_105942762 | 3300018037 | Peatland | MATNAITSDQDMVTAEIFIAAPPERVFQAMTDPAETS |
| Ga0187851_100546921 | 3300018046 | Peatland | MAMSKAIITPDQDAIIAEIDIAAPPSRVFASVNQRCSCSGS |
| Ga0187859_104420061 | 3300018047 | Peatland | MATTAITPDQDAIVGEIFIAAPPARVFQAITDPSQLPLWWGARGL |
| Ga0187766_109750691 | 3300018058 | Tropical Peatland | MATATITPDQNAVVAEIFIAAPPARVFEAITDPAQ |
| Ga0187770_115059711 | 3300018090 | Tropical Peatland | MATMATMAINAEQDAVFGEVFITAPPARVFEALTDPNQVPRWW |
| Ga0066655_105486042 | 3300018431 | Grasslands Soil | MATAQVTPDNDVVTAEIFIAAPPARVFAAITDPTQTATRRG |
| Ga0066662_129646782 | 3300018468 | Grasslands Soil | MATAHLTPDNDAGQVETFVAAPPSRVFQAISDPAQTTQWWGQKGLYRV |
| Ga0193721_11727172 | 3300020018 | Soil | MATAQITPDKDTVVAEILVAAPPARVFEAISDPKQT |
| Ga0197907_101854981 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MATATITPDNDTVIAEIFVAAPQERVFQAITDPAQS |
| Ga0206352_100659362 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | MATAQITPDQDAILAEIFIAAPPARVFEAIADVNQH |
| Ga0210399_105291681 | 3300020581 | Soil | MATATIAPDQTAVIAEIFIAAPPARVFQAISDPAQ |
| Ga0210399_107129242 | 3300020581 | Soil | MATSSITPDQNAVIAEIFIAAPPARVFQAISDPMQLPRWW |
| Ga0210400_107042141 | 3300021170 | Soil | MATIEVTPDQDVITGEIFIAAPPERVFQAISDPNQMPQW |
| Ga0210405_113414832 | 3300021171 | Soil | MATNAITSDQDVVTAEIFIAAPPERVFQAMTDPAQT |
| Ga0210388_114000361 | 3300021181 | Soil | MATATITPDHDTILAEIFIAAPPERVFQAISDPAQ |
| Ga0210393_111219501 | 3300021401 | Soil | MATATITPDQDTILAEVFIAAPPARVFEAIADPKQRAQWWGV |
| Ga0210387_115751641 | 3300021405 | Soil | MATITVTPDQDAVLAEIYIAAPRERVFQAISDPTQL |
| Ga0210383_116142271 | 3300021407 | Soil | MATATITPDQNAVVAEIFIAAPPARVFQAISDPTH |
| Ga0182009_101540491 | 3300021445 | Soil | MAIATITPDQNAVIAEIFIAAPPARVFQAISDPAQLPKWWGQSGLYRVIKSTMDV |
| Ga0210390_100573931 | 3300021474 | Soil | MATATITPDQNAVVAEIFIAAPPARVFQAISDPNQLPK |
| Ga0210398_108356442 | 3300021477 | Soil | MTTASILPEQDTVVVEIFIAAPPERVYQAITDPAQTVK |
| Ga0210410_116606502 | 3300021479 | Soil | MATATISPDQNAVVAEIFIAAPPARVFQAISDPAQLPKWWGRSDLYRITNSTAD |
| Ga0126371_100985225 | 3300021560 | Tropical Forest Soil | MASAAITPDNDAIVAEVFIAAPPARVFEAIVDRRGAPNGGA |
| Ga0126371_107863393 | 3300021560 | Tropical Forest Soil | MATSVLTPDQNAVVAEIFIAAPPARVFQAISDPAQLPKWWGQDGLYH |
| Ga0126371_121884951 | 3300021560 | Tropical Forest Soil | MATASITPDHDTILAEVFIAAPPARVFEAITDLKQRARWWGIKPSGS |
| Ga0213851_10809941 | 3300021860 | Watersheds | MATATITPDQNAVIAEIFIAAPPARVFQAISDPTQLPRWWGQDGLYRVIKSTIDL |
| Ga0242665_100337841 | 3300022724 | Soil | MATATITPDQNAVTAEIFIAAPPARVFQAISDPTQLP |
| Ga0247669_10679721 | 3300024182 | Soil | MATAQITPDTDAILAEIFIAAPPARVFEAIADVKQRAQ |
| Ga0208038_10472901 | 3300025446 | Peatland | MATISISPDQDTVLAEIHIAAPPERVFQAITDPRQM |
| Ga0208076_10603562 | 3300025464 | Arctic Peat Soil | MATATITPDQNAVIAEIFIAAPPARVFQAISDPAQLPKWWGQTGLYH |
| Ga0207699_114567891 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MATAQITPDTDAILAEIFIAAPPARVFEAIADPKQRSSWWG |
| Ga0207671_113747312 | 3300025914 | Corn Rhizosphere | MSTLAITPDQDAIFGEIFIAAPPERVYQAITDPLQLLQWW |
| Ga0207693_112330423 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MATAQITPDQDAILAEIFIAAPPARVFEAIADVNQRAQWWG |
| Ga0207687_100287608 | 3300025927 | Miscanthus Rhizosphere | MATTQITPDQDTILAEIFIAAPPTRVFEAIADVKQ |
| Ga0207700_108236913 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MATAQITPDQDAVHVEIFVAAPPARVFEAISDPAQSSQWWGQKGLYRVTKVEAD |
| Ga0207700_115917502 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MATATITPDQNAVIAEVFIAAPPARVFQAISDPAQLPKWWGQSGLYHVIKSTMD |
| Ga0207664_101039735 | 3300025929 | Agricultural Soil | MAAAQVTPDNDAVHLEIFVAAPPARVFQAISDPAQSSQWWGQK |
| Ga0207712_103685883 | 3300025961 | Switchgrass Rhizosphere | MATTQITPDQDTILAEIFIAAPPTRVFEAIADVKQRAQW |
| Ga0207677_107160363 | 3300026023 | Miscanthus Rhizosphere | MATAQITPDQDAILAEIFIAAPPVRVFEAIADVNQ |
| Ga0209155_11616801 | 3300026316 | Soil | MATATITPDQNAVIAEIFIAAPPARVFQAISDPAQ |
| Ga0209804_10485103 | 3300026335 | Soil | MANIAVTPDQDTIEAEIFIAAPPERVFQALTDPNQMPR |
| Ga0209807_12303252 | 3300026530 | Soil | MERIVDSATAQLTPDHDTILAEVFIAAPPARVFEAITDP |
| Ga0209056_103044751 | 3300026538 | Soil | MATAQITPDQDAILAEIFIAAPPARVFEAIADATQR |
| Ga0207819_10477561 | 3300027024 | Tropical Forest Soil | MATATITPDQNAVLAEIFIAAPPARVFQAISDPTQLPKWWGQSGLYHVTK |
| Ga0209732_10751441 | 3300027117 | Forest Soil | MATVAITPDQDVITGEIFIAAPPARVFQAITDPDQ |
| Ga0209527_10139074 | 3300027583 | Forest Soil | MATVAITPEQNIVTGEIFIAAPPARVFQAITDPIQMPCWWGARDMYHIKEWKADV |
| Ga0209038_100127126 | 3300027737 | Bog Forest Soil | MTTASILPDQDTVVVQIFIAAPPERVFQAITDPVQTVQWW |
| Ga0209811_100215431 | 3300027821 | Surface Soil | MATATITPDQNAVIAEVFIAAPPARVFQAISDPTQLPRWW |
| Ga0209811_103097742 | 3300027821 | Surface Soil | MATTQITPDNNTVVAEVFIAAPPDRVFDALTDPRQMT |
| Ga0209060_105435592 | 3300027826 | Surface Soil | MATATVTPDHNAVLAEIFIAAPPARVFQAISDPAQLPRWWGQDGL |
| Ga0209580_101521021 | 3300027842 | Surface Soil | MATATITPDQNAVVAEIFIAAPPARVFEAISDPNQLPKWWGQEGLYQVTKSIMDV |
| Ga0209579_106373282 | 3300027869 | Surface Soil | MATATVTPDNDAVLAEVFIAAPPERVFQAITDPKQMPLWW |
| Ga0209169_103287291 | 3300027879 | Soil | MATANVTAAVNPAQDAVLAEVFIAAPPARVFEAITDPSQVPR |
| Ga0209067_104577022 | 3300027898 | Watersheds | MATATITPDQTAVIAEIFIAAPPARVFQAISDPAQLPKWWGQSD |
| Ga0209168_100968094 | 3300027986 | Surface Soil | MATAVITPENVVIAEIFIAAPPARVFQAISDPNQLPKWWGQDGLYHI |
| Ga0137415_100709118 | 3300028536 | Vadose Zone Soil | MATSAVTPDNDAVVAEVFIAAPPERVFQAITDPKQ |
| Ga0137415_106276213 | 3300028536 | Vadose Zone Soil | MATVAITPDQDVVTAEIFIAAPPARVFEAITDPYQMPKW |
| Ga0302303_103120412 | 3300028776 | Palsa | MATATITPDQDTVLAEIFIAAPPERVFQAISLPEQ |
| Ga0302227_104204131 | 3300028795 | Palsa | MATATITPDQNTVIAEIFIAAPPARVFEAITDPEQ |
| Ga0308309_109243133 | 3300028906 | Soil | MATATITPDQNTVIAEVFIAAPPARVFQAISDPQQMPQWWGQSGVYT |
| Ga0308309_110203931 | 3300028906 | Soil | MATVAITPDQDVITGEIFIAAPPARVFQAITDPDQM |
| Ga0311329_100911876 | 3300029907 | Bog | MATASISPDQDVITGEIFIAAPPARVFQAITDPNQMPRW |
| Ga0302280_12127911 | 3300029985 | Fen | MATTSVTPDQETVVGEVFIAAPPARVFEAITDASQIPRWW |
| Ga0302270_100386611 | 3300030011 | Bog | MATTSVTPDQETVVGEVFIAAPPARVFEAITDASQIP |
| Ga0311357_111494511 | 3300030524 | Palsa | MATAVISPDHDTVVAEMFIAAPPERVFQAISDPNQL |
| Ga0265340_104757682 | 3300031247 | Rhizosphere | MATATITPDQTAVIAEIFIAAPPARVFQAISDPTQLPKWWGQTG |
| Ga0265316_100550061 | 3300031344 | Rhizosphere | MATATITPDRNAVVAEIFIAAPPARVFQAISDPTQLPKWWGQEGLYHVTKS |
| Ga0265316_109924832 | 3300031344 | Rhizosphere | MATATITPDQTAVIAEIFIAAPPARVFQAISDPAQLLKWWGQT |
| Ga0310915_100021261 | 3300031573 | Soil | MATIAITPDQNVIEAEIFVAAPRERVFQALTDPTQTPLWWGQKGMYQVTRSEADF |
| Ga0318560_107216551 | 3300031682 | Soil | MATIAITPDQNVIEAEIFVAAPRERVFQALTDPTQTPLWWGQKGM |
| Ga0310686_1042439701 | 3300031708 | Soil | MATNAISSDQDVVTAEIFIAAPPERVFQAMTDPAET |
| Ga0307476_108668631 | 3300031715 | Hardwood Forest Soil | MATATITPDQNAVTAEIFIAAPPARVFQAISDPTQ |
| Ga0307476_111240451 | 3300031715 | Hardwood Forest Soil | MATTSITPQQDTVLAEIFIAAPPERVFRAITDPQQMSNW |
| Ga0307474_107223481 | 3300031718 | Hardwood Forest Soil | VATAQVTPDNDVVVAEIFIAAPPARVFQAITDPKQASQWWGQKG |
| Ga0306917_101157364 | 3300031719 | Soil | MATIAITPDQNVIEAEIFVAAPRERVFQALTDPSQTPLWWGQ |
| Ga0307475_100032271 | 3300031754 | Hardwood Forest Soil | MATIALTPDHDIINAEIFVAAPPERVFQALTDPSQMP |
| Ga0318546_100071569 | 3300031771 | Soil | MATIAITPDQNVIEAEIFVAAPRERVFQALTDPTQTPLWWGQK |
| Ga0318497_105028832 | 3300031805 | Soil | MATIAITPDQNVIEAEIFVAAPRERVFQALTDPTQTPLW |
| Ga0318564_104162742 | 3300031831 | Soil | MATIAITPDQNVIEAEIFVAAPRERVFQALTDPTQTPLWWGQKG |
| Ga0318551_108244482 | 3300031896 | Soil | MATAAITPDQNAVIADVFIAAPPARVFQAISDPKQIPRWWGQDGLYRVTQSTADV |
| Ga0318520_101440621 | 3300031897 | Soil | MATIAITPDQNVIEAEIFVAAPRERVFQALTDPTQTPLWWGQKGMYQ |
| Ga0308174_105688693 | 3300031939 | Soil | MATAQITPDNDAVLAEVLVAAPPARVFEAITDPRQ |
| Ga0310913_113065812 | 3300031945 | Soil | MATAAITPDQDTVVAEIFISAPPERVFEAITDPKQMPLW |
| Ga0318531_105168352 | 3300031981 | Soil | MATAAITPDQDTVVAEIFISAPPERVFEAITDPKQMPLWWGQK |
| Ga0318559_105478702 | 3300032039 | Soil | MATIAITPDQNVIEAEIFVAAPRERVFQALTDPSQTPL |
| Ga0318505_106311212 | 3300032060 | Soil | MATATITPDQNAVIAEVFIAAPPARVFQAISDPAQLPR |
| Ga0318524_100515594 | 3300032067 | Soil | MATIAITPDQNVIEAEIFVAAPRERVFQALTDPTQTPLWWGQKGMYQVTR |
| Ga0311301_107063013 | 3300032160 | Peatlands Soil | MATATITPDQTAVIAEIFIAAPPARVFQAISDPAQLPKWWGQTGLYHVTKSTM |
| Ga0311301_127420761 | 3300032160 | Peatlands Soil | MATATITPDRNAVIAEIFIAAPPARVFQAISDPAQLPKWWGQTGLYHVTKS |
| Ga0307471_1000375207 | 3300032180 | Hardwood Forest Soil | MASATITPDQNAVIAEIFIAAPPARVFQAISDPTQLPRWWGQDGLYRVTKST |
| Ga0307471_1018343081 | 3300032180 | Hardwood Forest Soil | MATVTITPDQNTIFAEIFIAAPPARVFEAITDLNQMPQWWGQHGIHRITEWKADLR |
| Ga0307472_1013636901 | 3300032205 | Hardwood Forest Soil | MATLAVTPDHDTIEAEIFVAAPPERVFQALTDPAQ |
| Ga0335085_115299962 | 3300032770 | Soil | MATATITPDQTAVIAEIFIAAPPARVFQAISDPAQLPKWWGQTGLYHVTK |
| Ga0335079_100426311 | 3300032783 | Soil | MATATITPDQETVLAEIFIAAPPERVFEAISDPNQL |
| Ga0335080_100939391 | 3300032828 | Soil | MATATITPDQNAVIAEVFIAAPPARVFQAISDPAQLPKWWG |
| Ga0335081_103658885 | 3300032892 | Soil | MATATVTPDQNTVIAEVFIAAPPARVFQAISDPTQLPRWWGQSGLYHVTKS |
| Ga0335081_105864574 | 3300032892 | Soil | MATASISPDQDVIYAEVFIAAPPERVFQAITDPEQ |
| Ga0335081_116006542 | 3300032892 | Soil | MATATITPDQNAVVAEIFIAAPPARVFQAISDPQQLP |
| Ga0335069_101724665 | 3300032893 | Soil | MATATITPDQDAVVAEIFIAAPPARVFQAISDPTQLPRWWGQDGLYHVTKSIMD |
| Ga0335074_103770132 | 3300032895 | Soil | MATASLTPDQDAIEAEIFIAAPPARVFEAITDPKQRAHGGE |
| Ga0335071_100997881 | 3300032897 | Soil | MATATVTPDQNTVIAEVFIAAPPARVFQAISDPTQLPRWWGQSG |
| Ga0335076_103349574 | 3300032955 | Soil | MAALAIAVTPTQDEVVGEVFIAAPPARVFAAITDPAQVP |
| Ga0335084_118857132 | 3300033004 | Soil | MATMAVTPDQDVVSGEIFIAAPPARVFEAITDPNQVLRWW |
| Ga0335077_112021913 | 3300033158 | Soil | MATSAVSLDQDVVTAEIFIAAPPERVFQAITDPKRPPQ |
| Ga0334804_134634_3_116 | 3300033818 | Soil | MATVAITPDQNTVVGEIFIAAPPARVFEALTDPSQMPR |
| Ga0334847_042858_404_523 | 3300033826 | Soil | MATATITPDQNAVVAEIFIAAPPARVFQAISDPSQLPKWW |
| ⦗Top⦘ |