Basic Information | |
---|---|
Family ID | F028357 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 192 |
Average Sequence Length | 41 residues |
Representative Sequence | LAKGPIILEDNDSIALETSDTSGISATLSILEISREDQNG |
Number of Associated Samples | 123 |
Number of Associated Scaffolds | 192 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.20 % |
% of genes near scaffold ends (potentially truncated) | 86.46 % |
% of genes from short scaffolds (< 2000 bps) | 74.48 % |
Associated GOLD sequencing projects | 100 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (28.646 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (45.833 % of family members) |
Environment Ontology (ENVO) | Unclassified (57.812 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (73.438 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 0.00% Coil/Unstructured: 75.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 192 Family Scaffolds |
---|---|---|
PF00534 | Glycos_transf_1 | 31.25 |
PF13640 | 2OG-FeII_Oxy_3 | 1.56 |
PF02794 | HlyC | 1.56 |
PF13759 | 2OG-FeII_Oxy_5 | 1.56 |
PF02897 | Peptidase_S9_N | 0.52 |
PF04820 | Trp_halogenase | 0.52 |
COG ID | Name | Functional Category | % Frequency in 192 Family Scaffolds |
---|---|---|---|
COG2994 | ACP:hemolysin acyltransferase (hemolysin-activating protein) | Posttranslational modification, protein turnover, chaperones [O] | 1.56 |
COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 0.52 |
COG1770 | Protease II | Amino acid transport and metabolism [E] | 0.52 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 79.17 % |
Unclassified | root | N/A | 20.31 % |
unclassified Hyphomonas | no rank | unclassified Hyphomonas | 0.52 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000101|DelMOSum2010_c10106228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1149 | Open in IMG/M |
3300000116|DelMOSpr2010_c10149580 | All Organisms → Viruses | 801 | Open in IMG/M |
3300000116|DelMOSpr2010_c10156056 | All Organisms → Viruses | 775 | Open in IMG/M |
3300000116|DelMOSpr2010_c10176827 | All Organisms → Viruses | 704 | Open in IMG/M |
3300000117|DelMOWin2010_c10082772 | All Organisms → Viruses | 1243 | Open in IMG/M |
3300000117|DelMOWin2010_c10097753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1086 | Open in IMG/M |
3300000117|DelMOWin2010_c10242812 | All Organisms → Viruses | 530 | Open in IMG/M |
3300001419|JGI11705J14877_10067975 | Not Available | 1142 | Open in IMG/M |
3300004050|Ga0055491_10226038 | All Organisms → Viruses | 514 | Open in IMG/M |
3300005346|Ga0074242_11732021 | All Organisms → Viruses → Predicted Viral | 1360 | Open in IMG/M |
3300005346|Ga0074242_11906831 | All Organisms → Viruses | 648 | Open in IMG/M |
3300005346|Ga0074242_12185417 | Not Available | 709 | Open in IMG/M |
3300006025|Ga0075474_10013099 | unclassified Hyphomonas → Hyphomonas sp. | 3119 | Open in IMG/M |
3300006025|Ga0075474_10078839 | Not Available | 1081 | Open in IMG/M |
3300006026|Ga0075478_10110186 | All Organisms → Viruses | 875 | Open in IMG/M |
3300006026|Ga0075478_10233005 | All Organisms → Viruses | 556 | Open in IMG/M |
3300006026|Ga0075478_10233145 | All Organisms → Viruses | 555 | Open in IMG/M |
3300006026|Ga0075478_10267624 | All Organisms → Viruses | 509 | Open in IMG/M |
3300006027|Ga0075462_10130289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 773 | Open in IMG/M |
3300006027|Ga0075462_10177879 | All Organisms → Viruses | 644 | Open in IMG/M |
3300006027|Ga0075462_10198152 | All Organisms → Viruses | 604 | Open in IMG/M |
3300006392|Ga0075507_1515827 | All Organisms → Viruses | 503 | Open in IMG/M |
3300006637|Ga0075461_10201677 | All Organisms → Viruses | 595 | Open in IMG/M |
3300006637|Ga0075461_10202734 | All Organisms → Viruses | 593 | Open in IMG/M |
3300006637|Ga0075461_10213504 | All Organisms → Viruses | 574 | Open in IMG/M |
3300006802|Ga0070749_10140510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1409 | Open in IMG/M |
3300006802|Ga0070749_10214844 | All Organisms → Viruses | 1098 | Open in IMG/M |
3300006802|Ga0070749_10521457 | All Organisms → Viruses | 646 | Open in IMG/M |
3300006802|Ga0070749_10595315 | All Organisms → Viruses | 597 | Open in IMG/M |
3300006802|Ga0070749_10620476 | All Organisms → Viruses | 582 | Open in IMG/M |
3300006802|Ga0070749_10635513 | All Organisms → Viruses | 574 | Open in IMG/M |
3300006810|Ga0070754_10187284 | All Organisms → Viruses | 971 | Open in IMG/M |
3300006810|Ga0070754_10337553 | All Organisms → Viruses | 669 | Open in IMG/M |
3300006870|Ga0075479_10165839 | All Organisms → Viruses | 897 | Open in IMG/M |
3300006875|Ga0075473_10202736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 801 | Open in IMG/M |
3300006916|Ga0070750_10170097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 978 | Open in IMG/M |
3300006919|Ga0070746_10019589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3724 | Open in IMG/M |
3300006919|Ga0070746_10065319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1868 | Open in IMG/M |
3300006919|Ga0070746_10163846 | All Organisms → Viruses | 1076 | Open in IMG/M |
3300006919|Ga0070746_10417589 | Not Available | 599 | Open in IMG/M |
3300007229|Ga0075468_10195532 | All Organisms → Viruses | 593 | Open in IMG/M |
3300007236|Ga0075463_10047290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1396 | Open in IMG/M |
3300007276|Ga0070747_1152882 | All Organisms → Viruses | 829 | Open in IMG/M |
3300007344|Ga0070745_1014948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3566 | Open in IMG/M |
3300007345|Ga0070752_1168496 | All Organisms → Viruses | 890 | Open in IMG/M |
3300007346|Ga0070753_1333380 | All Organisms → Viruses | 537 | Open in IMG/M |
3300007540|Ga0099847_1086165 | All Organisms → Viruses | 964 | Open in IMG/M |
3300007540|Ga0099847_1152936 | All Organisms → Viruses | 686 | Open in IMG/M |
3300007542|Ga0099846_1029892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2097 | Open in IMG/M |
3300007609|Ga0102945_1074628 | All Organisms → Viruses | 631 | Open in IMG/M |
3300007623|Ga0102948_1171903 | All Organisms → Viruses | 659 | Open in IMG/M |
3300007640|Ga0070751_1025869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2749 | Open in IMG/M |
3300007640|Ga0070751_1119335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1076 | Open in IMG/M |
3300007778|Ga0102954_1245637 | All Organisms → Viruses | 535 | Open in IMG/M |
3300007960|Ga0099850_1076061 | All Organisms → Viruses | 1404 | Open in IMG/M |
3300007960|Ga0099850_1403259 | All Organisms → Viruses | 506 | Open in IMG/M |
3300008012|Ga0075480_10146818 | Not Available | 1283 | Open in IMG/M |
3300009001|Ga0102963_1030675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2245 | Open in IMG/M |
3300009001|Ga0102963_1079544 | Not Available | 1342 | Open in IMG/M |
3300009001|Ga0102963_1291456 | All Organisms → Viruses | 643 | Open in IMG/M |
3300009027|Ga0102957_1385790 | All Organisms → Viruses | 522 | Open in IMG/M |
3300009077|Ga0115552_1248820 | Not Available | 718 | Open in IMG/M |
3300009136|Ga0118735_10142059 | All Organisms → Viruses | 764 | Open in IMG/M |
3300009165|Ga0105102_10415454 | All Organisms → Viruses | 717 | Open in IMG/M |
3300009170|Ga0105096_10213497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 977 | Open in IMG/M |
3300009193|Ga0115551_1385831 | All Organisms → Viruses | 603 | Open in IMG/M |
3300009437|Ga0115556_1136662 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 912 | Open in IMG/M |
3300009437|Ga0115556_1258826 | All Organisms → Viruses | 618 | Open in IMG/M |
3300009469|Ga0127401_1019344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2002 | Open in IMG/M |
3300010296|Ga0129348_1202701 | All Organisms → Viruses | 675 | Open in IMG/M |
3300010300|Ga0129351_1233271 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 707 | Open in IMG/M |
3300010318|Ga0136656_1084677 | Not Available | 1120 | Open in IMG/M |
3300010318|Ga0136656_1180725 | All Organisms → Viruses | 712 | Open in IMG/M |
3300010368|Ga0129324_10237950 | All Organisms → Viruses | 729 | Open in IMG/M |
3300010370|Ga0129336_10732230 | All Organisms → Viruses | 523 | Open in IMG/M |
3300017963|Ga0180437_11116753 | All Organisms → Viruses | 562 | Open in IMG/M |
3300017967|Ga0181590_10349084 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1063 | Open in IMG/M |
3300017969|Ga0181585_11038163 | All Organisms → Viruses | 521 | Open in IMG/M |
3300017989|Ga0180432_10620953 | All Organisms → Viruses | 768 | Open in IMG/M |
3300018036|Ga0181600_10434918 | All Organisms → Viruses | 631 | Open in IMG/M |
3300018049|Ga0181572_10058493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2549 | Open in IMG/M |
3300018080|Ga0180433_10359229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1133 | Open in IMG/M |
3300018420|Ga0181563_10636013 | Not Available | 591 | Open in IMG/M |
3300019745|Ga0194002_1087414 | All Organisms → Viruses | 534 | Open in IMG/M |
3300019751|Ga0194029_1085539 | All Organisms → Viruses | 545 | Open in IMG/M |
3300019765|Ga0194024_1048326 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
3300019765|Ga0194024_1160711 | All Organisms → Viruses | 530 | Open in IMG/M |
3300020051|Ga0181555_1062097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1820 | Open in IMG/M |
3300020810|Ga0181598_1344434 | All Organisms → Viruses | 516 | Open in IMG/M |
3300021356|Ga0213858_10019946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3198 | Open in IMG/M |
3300021364|Ga0213859_10418839 | All Organisms → Viruses | 591 | Open in IMG/M |
3300021371|Ga0213863_10053373 | All Organisms → Viruses → Predicted Viral | 2084 | Open in IMG/M |
3300021425|Ga0213866_10560949 | All Organisms → Viruses | 537 | Open in IMG/M |
3300021958|Ga0222718_10142699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1361 | Open in IMG/M |
3300021958|Ga0222718_10214295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1043 | Open in IMG/M |
3300021958|Ga0222718_10290696 | All Organisms → Viruses | 852 | Open in IMG/M |
3300021958|Ga0222718_10426607 | All Organisms → Viruses | 656 | Open in IMG/M |
3300021958|Ga0222718_10492282 | All Organisms → Viruses | 594 | Open in IMG/M |
3300021959|Ga0222716_10533903 | All Organisms → Viruses | 653 | Open in IMG/M |
3300021960|Ga0222715_10144925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1479 | Open in IMG/M |
3300021960|Ga0222715_10461563 | All Organisms → Viruses | 681 | Open in IMG/M |
3300021960|Ga0222715_10461588 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 681 | Open in IMG/M |
3300021961|Ga0222714_10207658 | All Organisms → Viruses | 1126 | Open in IMG/M |
3300021961|Ga0222714_10216815 | Not Available | 1094 | Open in IMG/M |
3300021961|Ga0222714_10504531 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 620 | Open in IMG/M |
3300021961|Ga0222714_10544577 | All Organisms → Viruses | 588 | Open in IMG/M |
3300021964|Ga0222719_10294936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1054 | Open in IMG/M |
3300021964|Ga0222719_10367106 | All Organisms → Viruses | 907 | Open in IMG/M |
3300022065|Ga0212024_1026873 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 964 | Open in IMG/M |
3300022068|Ga0212021_1014984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1385 | Open in IMG/M |
3300022068|Ga0212021_1090111 | All Organisms → Viruses | 629 | Open in IMG/M |
3300022068|Ga0212021_1093726 | All Organisms → Viruses | 616 | Open in IMG/M |
3300022071|Ga0212028_1019397 | Not Available | 1178 | Open in IMG/M |
3300022071|Ga0212028_1072288 | All Organisms → Viruses | 645 | Open in IMG/M |
3300022071|Ga0212028_1103622 | All Organisms → Viruses | 528 | Open in IMG/M |
3300022183|Ga0196891_1043365 | All Organisms → Viruses | 828 | Open in IMG/M |
3300022187|Ga0196899_1196237 | All Organisms → Viruses | 536 | Open in IMG/M |
3300022200|Ga0196901_1229171 | All Organisms → Viruses | 584 | Open in IMG/M |
3300022200|Ga0196901_1257081 | All Organisms → Viruses | 539 | Open in IMG/M |
3300022921|Ga0255765_1388358 | All Organisms → Viruses | 517 | Open in IMG/M |
3300022926|Ga0255753_1192436 | All Organisms → Viruses | 873 | Open in IMG/M |
3300022926|Ga0255753_1254734 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 705 | Open in IMG/M |
3300022927|Ga0255769_10059133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2190 | Open in IMG/M |
3300022928|Ga0255758_10021944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Maricaulaceae → Maricaulis → unclassified Maricaulis → Maricaulis sp. | 4236 | Open in IMG/M |
3300023176|Ga0255772_10140577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1451 | Open in IMG/M |
3300023178|Ga0255759_10241831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1166 | Open in IMG/M |
3300024301|Ga0233451_10113807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1315 | Open in IMG/M |
3300025543|Ga0208303_1115990 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300025610|Ga0208149_1004737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4498 | Open in IMG/M |
3300025610|Ga0208149_1138193 | All Organisms → Viruses | 562 | Open in IMG/M |
3300025621|Ga0209504_1134105 | All Organisms → Viruses | 608 | Open in IMG/M |
3300025646|Ga0208161_1018518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2668 | Open in IMG/M |
3300025647|Ga0208160_1106156 | All Organisms → Viruses | 723 | Open in IMG/M |
3300025671|Ga0208898_1007892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5615 | Open in IMG/M |
3300025671|Ga0208898_1011713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4316 | Open in IMG/M |
3300025671|Ga0208898_1113843 | All Organisms → Viruses | 795 | Open in IMG/M |
3300025671|Ga0208898_1158595 | All Organisms → Viruses | 601 | Open in IMG/M |
3300025671|Ga0208898_1170087 | Not Available | 564 | Open in IMG/M |
3300025687|Ga0208019_1106455 | All Organisms → Viruses | 852 | Open in IMG/M |
3300025701|Ga0209771_1032467 | All Organisms → Viruses → Predicted Viral | 2066 | Open in IMG/M |
3300025759|Ga0208899_1006100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7263 | Open in IMG/M |
3300025759|Ga0208899_1016075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3903 | Open in IMG/M |
3300025759|Ga0208899_1038392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2164 | Open in IMG/M |
3300025769|Ga0208767_1124768 | All Organisms → Viruses | 982 | Open in IMG/M |
3300025769|Ga0208767_1145869 | All Organisms → Viruses | 869 | Open in IMG/M |
3300025803|Ga0208425_1082860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 764 | Open in IMG/M |
3300025810|Ga0208543_1009865 | All Organisms → cellular organisms → Bacteria | 2443 | Open in IMG/M |
3300025810|Ga0208543_1115247 | All Organisms → Viruses | 637 | Open in IMG/M |
3300025818|Ga0208542_1155646 | All Organisms → Viruses | 619 | Open in IMG/M |
3300025840|Ga0208917_1222337 | All Organisms → Viruses | 619 | Open in IMG/M |
3300025876|Ga0209223_10408454 | All Organisms → Viruses | 578 | Open in IMG/M |
3300025889|Ga0208644_1056409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2142 | Open in IMG/M |
3300025889|Ga0208644_1063879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1965 | Open in IMG/M |
3300025889|Ga0208644_1308782 | All Organisms → Viruses | 624 | Open in IMG/M |
3300026138|Ga0209951_1103583 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300026138|Ga0209951_1128297 | Not Available | 511 | Open in IMG/M |
3300026187|Ga0209929_1152186 | All Organisms → Viruses | 564 | Open in IMG/M |
3300027782|Ga0209500_10237231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 803 | Open in IMG/M |
3300027804|Ga0209358_10078962 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1871 | Open in IMG/M |
3300027917|Ga0209536_102818934 | All Organisms → Viruses | 566 | Open in IMG/M |
3300034101|Ga0335027_0578529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 688 | Open in IMG/M |
3300034374|Ga0348335_035626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2112 | Open in IMG/M |
3300034375|Ga0348336_199058 | All Organisms → Viruses | 536 | Open in IMG/M |
3300034418|Ga0348337_003653 | All Organisms → cellular organisms → Bacteria | 10724 | Open in IMG/M |
3300034418|Ga0348337_063742 | Not Available | 1383 | Open in IMG/M |
3300034418|Ga0348337_107628 | All Organisms → Viruses | 889 | Open in IMG/M |
3300034418|Ga0348337_126705 | All Organisms → Viruses | 770 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 45.83% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 8.33% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 7.81% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.69% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 4.17% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.65% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.65% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.65% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.08% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 2.08% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.56% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 1.56% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.56% |
Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 1.56% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.04% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.04% |
Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 1.04% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.52% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.52% |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.52% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.52% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.52% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.52% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.52% |
Marine Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment | 0.52% |
Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.52% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
3300004050 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 | Environmental | Open in IMG/M |
3300005346 | Saline sediment microbial community from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
3300006392 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
3300007623 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG | Environmental | Open in IMG/M |
3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
3300009136 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 82 cmbsf | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
3300009469 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017989 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaG | Environmental | Open in IMG/M |
3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019745 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_8-9_MG | Environmental | Open in IMG/M |
3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
3300020051 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT metaG (spades assembly) | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020531 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020569 | Freshwater microbial communities from Lake Mendota, WI - 22AUG2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020810 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041404US metaG (spades assembly) | Environmental | Open in IMG/M |
3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022921 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG | Environmental | Open in IMG/M |
3300022926 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG | Environmental | Open in IMG/M |
3300022927 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG | Environmental | Open in IMG/M |
3300022928 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG | Environmental | Open in IMG/M |
3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
3300023178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG | Environmental | Open in IMG/M |
3300024301 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly) | Environmental | Open in IMG/M |
3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025701 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSum2010_101062281 | 3300000101 | Marine | KGPIILEEGDSISIETSDISGVSATLSILEISREDQNG* |
DelMOSpr2010_101495803 | 3300000116 | Marine | KGPIILEENDTIRLESSDVSAISATLSILEISREDQNG* |
DelMOSpr2010_101560561 | 3300000116 | Marine | SVTGPTICNLAKGPIILEDNDSIALETSDTSGISATLSILEISREDQNG* |
DelMOSpr2010_101768273 | 3300000116 | Marine | AKGPIILEENDTIRLESSDVSAISATLSILEISREDQNG* |
DelMOWin2010_100827721 | 3300000117 | Marine | ICNLAKGPIILEENDSIAIESSTTSDISATLSILEISREDQNG* |
DelMOWin2010_100977531 | 3300000117 | Marine | LVLEENDSIALETSDTSGISATLSILEISREDQNG* |
DelMOWin2010_102428123 | 3300000117 | Marine | ICNIAKGPXXLEESDSISLESTDTSGISATLALLEISREDQNG* |
JGI11705J14877_100679753 | 3300001419 | Saline Water And Sediment | ICNVAKGPLVLEESDSIALETSDTSGISGTLSILEISREDQNG* |
Ga0055491_102260381 | 3300004050 | Natural And Restored Wetlands | AKGPIILEENDALTLESSTTSGITATISILEISREDQNG* |
Ga0074242_117320213 | 3300005346 | Saline Water And Sediment | MLTKGPLILEDNDSIALETSDTSGISAALSILEISREDQNG* |
Ga0074242_119068312 | 3300005346 | Saline Water And Sediment | AISGPTICNIAKGPIILEESDSISLESTDTSAISATLALLEISREDQNG* |
Ga0074242_121854172 | 3300005346 | Saline Water And Sediment | MLLKGPLILEDNDSIALETSDTSGISAALSILEISREDQKWLMKIY* |
Ga0075474_100130991 | 3300006025 | Aqueous | KGPLILEDNDSIALETSDTSGISATLSILEISREDQNG* |
Ga0075474_100788393 | 3300006025 | Aqueous | GPTICNLAKGPIILEESDVIAIESSDTSGISATVAILEISRDDQNG* |
Ga0075478_101101863 | 3300006026 | Aqueous | TICNLAKGPIILEDNDSIALETSDTSGISATLSILEISREDQNG* |
Ga0075478_102330051 | 3300006026 | Aqueous | PIILEESDSISLETSTTSAITASLALLEISRDDQNG* |
Ga0075478_102331451 | 3300006026 | Aqueous | GPTICNLAKGPIILEENDSIAIESSTTSAISATLSILEISREDQNG* |
Ga0075478_102676243 | 3300006026 | Aqueous | PTICNLAKGPIILEDNDSIALETSDTSGISATLSILEISREDQNG* |
Ga0075462_101302894 | 3300006027 | Aqueous | LAKGPIILEEGDSISIETSDTSGISATLSILEISREDQNG* |
Ga0075462_101778793 | 3300006027 | Aqueous | KGPLILEESDSIALESSTTSAISATLSILEISREDQNG* |
Ga0075462_101981523 | 3300006027 | Aqueous | LVLEESDSIALETSDTSGISGTLSILEISREDQNG* |
Ga0075507_15158273 | 3300006392 | Aqueous | CNVAKGPLILEDNDLIALETSDTSGISATISILEISREDQNG* |
Ga0075461_102016771 | 3300006637 | Aqueous | ICNVAKGPLILEDNDSIALETSDTSGISATLSILEISREDQNG* |
Ga0075461_102027341 | 3300006637 | Aqueous | ICNVAKGPLILEDNDSIALETSDTSGISAALSILEISREDQNG* |
Ga0075461_102135041 | 3300006637 | Aqueous | IILEESDVIAIESSDTSGISGTVAILEISRDDQNG* |
Ga0070749_100697901 | 3300006802 | Aqueous | PIILEESDAIKLESSDTSAITATLAILEISRDDQNG* |
Ga0070749_101405101 | 3300006802 | Aqueous | PIILEESDSIKLESSNTSAISATLAILEISREDQNG* |
Ga0070749_102148441 | 3300006802 | Aqueous | LAKGPIILEESDSIALESSDVSAISATISILEISREDQNG* |
Ga0070749_105214573 | 3300006802 | Aqueous | AKGPIILEDNDSIALETSDTSGISAALSILEISREDQNG* |
Ga0070749_105953151 | 3300006802 | Aqueous | KGPIILEENDSIALETSDTSGTSATLSILEISREDQNG* |
Ga0070749_106204763 | 3300006802 | Aqueous | AKGPIILEESDSISLESTDTSGISATLALLEISREDQNG* |
Ga0070749_106355131 | 3300006802 | Aqueous | KGPIILEENDSIAIESSTTSDISATLSILEISREDQNG* |
Ga0070754_101872843 | 3300006810 | Aqueous | PLVLEESDSIALETSDTSGISGTLSILEISREDQNG* |
Ga0070754_103375531 | 3300006810 | Aqueous | ICNVAKGPIILEESDSVSIESSTTSAITATLAILEISREDQNG* |
Ga0075479_101658393 | 3300006870 | Aqueous | GPIILEDNDSIALETSDTSGISATLSILEISREDQNG* |
Ga0075473_102027361 | 3300006875 | Aqueous | KGPVILEENDTIRLESSSTSGISATLAILEINRDDQNGQN* |
Ga0070750_101700975 | 3300006916 | Aqueous | GPIILEEGDSISIETSDTSGISATLSILEISREDQNG* |
Ga0070746_100195891 | 3300006919 | Aqueous | NVAKGPLILEESDSIALESSTTSAISATLSILEISREDQNG* |
Ga0070746_100653191 | 3300006919 | Aqueous | AKGPIILEENDSIALETSDTSGTSATLSILEISREDQNG* |
Ga0070746_100751201 | 3300006919 | Aqueous | NIAKGPIILEENDILLLESSDTSGISATLAILEINRDDQNG* |
Ga0070746_101638461 | 3300006919 | Aqueous | GPLILEESDSIALESSTTSAMSATLSILEISREDQNG* |
Ga0070746_104175891 | 3300006919 | Aqueous | GPIILEEGDSISIETSDISGVSATLSILEISREDQNG* |
Ga0075468_101955321 | 3300007229 | Aqueous | SVTGPTICNLAKGPIILEENDSIAIESSTTSDISATLSILEISREDQNG* |
Ga0075463_100472904 | 3300007236 | Aqueous | SVTGPTICNLAKGPIILEDNDSIALETSDTSGISGTLSILEISREDQNG* |
Ga0070747_11528821 | 3300007276 | Aqueous | GPLILEDNDLIALETSDTSGISAAVSILEISREDQNG* |
Ga0070745_10149481 | 3300007344 | Aqueous | TICNVAKGPLILEDSDSIALETSDTSGISAALSILEISREDQNG* |
Ga0070752_11684961 | 3300007345 | Aqueous | VAKGPLILEDNDLIALETSDTSGISAALSILEISREDQNG* |
Ga0070753_13333801 | 3300007346 | Aqueous | CNLAKGPIILEDNDSIALETSDTSGISATLSILEISREDQNG* |
Ga0099847_10861651 | 3300007540 | Aqueous | LILEESDSIALETSDTSGISATLSILEISREDQNG* |
Ga0099847_11529363 | 3300007540 | Aqueous | GPLILEESDSIALESSTTSAISATLSILEISREDQNG* |
Ga0099846_10298921 | 3300007542 | Aqueous | TICNVAKGPLILEESDSIALETSDTSGISAALSILEISREDQNG* |
Ga0099846_11241971 | 3300007542 | Aqueous | CNIAKGPIILEESDTIRLESSDVSGISATLAILEINRDDQNGQN* |
Ga0102945_10746283 | 3300007609 | Pond Water | PTICNIAKGPIILEESDTISLESTDTSAISATLALLEISREDQNG* |
Ga0102948_11719033 | 3300007623 | Water | CNLAKGPIILEDNDSIALETSDTSGISAALSILEISREDQNG* |
Ga0070751_10258695 | 3300007640 | Aqueous | AKGPIILEESDSISLESTDTSAISATLSLLEISREDQNG* |
Ga0070751_11193351 | 3300007640 | Aqueous | ILEENDSIAIESSTTSAISATLSILEISREDQNG* |
Ga0102954_12456373 | 3300007778 | Water | LAKGPIILEENDTIRLESSDVSDISATLSILEISREDQNG* |
Ga0099850_10760615 | 3300007960 | Aqueous | PTICNVAKGPLILEESDSIALESSTTSAISATLSILEISREDQNG* |
Ga0099850_14032591 | 3300007960 | Aqueous | GPTICNLAKGPIILEESDSIAIESSDTSAISATISILEISREDQNG* |
Ga0075480_101468183 | 3300008012 | Aqueous | AKGPIILEESDSLSLESSDTSAITATISLLEISRDDQNG* |
Ga0102963_10306751 | 3300009001 | Pond Water | VAKGPLILEDNDSIALETSDTSGISAALSILEISREDQNG* |
Ga0102963_10795441 | 3300009001 | Pond Water | TICNVAKGPLILEDNDLIALETSDTSGISATISILEISREDQNG* |
Ga0102963_12914561 | 3300009001 | Pond Water | GPIILEENDSIAIESSTTSAISATLSILEISREDQNG* |
Ga0102957_13857901 | 3300009027 | Pond Water | TGPTICNLAKGPIILEDNDSIALETSDTSGISATLSILEISREDQNG* |
Ga0115552_12488204 | 3300009077 | Pelagic Marine | TICNVAKGPIILEEGDSISMETNTTTGAVTATVSILEISREDQNG* |
Ga0118735_101420593 | 3300009136 | Marine Sediment | PIILEENDTIRLESSDVSDISATLSILEISREDQNG* |
Ga0114975_107787483 | 3300009164 | Freshwater Lake | PIVLEETDTIRLESSSVSGISATLAILEINRDDQNGQN* |
Ga0105102_104154543 | 3300009165 | Freshwater Sediment | ASISGPTVCNLANGPIILEENDVIRLESSVTSGISATLAILEINRDDQNGQ* |
Ga0105096_102134974 | 3300009170 | Freshwater Sediment | NGPIILEENDVIRLESSVTSGISATLAILEINRDDQNGQN* |
Ga0115551_13858311 | 3300009193 | Pelagic Marine | PIILEENDSIAIESSTTSDISATLSILEISREDQNG* |
Ga0115547_12265441 | 3300009426 | Pelagic Marine | IVLEETDTIRLESSDISGISATVAILEINRDDQNGQ* |
Ga0115545_13171611 | 3300009433 | Pelagic Marine | IVLEETDTIRLESSNVSGISATLAILEINRDDQNGQ* |
Ga0115556_11366624 | 3300009437 | Pelagic Marine | CNVAKGPIILEEGDSISMETNTTSGAVTATVSILEISREDQNG* |
Ga0115556_12588261 | 3300009437 | Pelagic Marine | IILEENDTIRLESSDVSAISATLSILEISREDQNG* |
Ga0127401_10193444 | 3300009469 | Meromictic Pond | VLEENDELKLETSDTSGISAAISILEINRNNENGRI* |
Ga0129348_12027011 | 3300010296 | Freshwater To Marine Saline Gradient | KGPIILEESDSISLESTDTSAISATIALLEISRDDQNG* |
Ga0129351_12332711 | 3300010300 | Freshwater To Marine Saline Gradient | KGPIILEENDSIALESSTTNNITAVLSILEISREDQNG* |
Ga0136656_10846771 | 3300010318 | Freshwater To Marine Saline Gradient | LVLEESDSIALETSDTSGISAALSILEISREDQNG* |
Ga0136656_11807253 | 3300010318 | Freshwater To Marine Saline Gradient | CNVAKGPLVLEESDSIALETSDTSGISATLSILEISREDQNG* |
Ga0129333_112385453 | 3300010354 | Freshwater To Marine Saline Gradient | TICNIAKGPIILEESDTIRLESSDVSGISATLAILEINRDDQNGQN* |
Ga0129324_102379503 | 3300010368 | Freshwater To Marine Saline Gradient | CNVAKGPLILEESDSIALETSDTSGISATLSILEISREDQNG* |
Ga0129336_107322301 | 3300010370 | Freshwater To Marine Saline Gradient | NILEESDSISLESTDTSAISATLALLEISREDQNG* |
Ga0114922_106728173 | 3300011118 | Deep Subsurface | KGPIVLEESDSVTLETSDTSAISATLAILEISREDQNG* |
Ga0181338_10679701 | 3300015050 | Freshwater Lake | AKGPIVLEETDTIRLETSNVSGISATVAILEINRDDQNGQ* |
Ga0181352_10973751 | 3300017747 | Freshwater Lake | IVLEETDTIRLESSNVSGISATLAILEINRDDQNGQ |
Ga0180437_111167533 | 3300017963 | Hypersaline Lake Sediment | IILEENDSVTIESSTTSAISATLAILEISREDQNG |
Ga0181590_103490843 | 3300017967 | Salt Marsh | VTGPTICNLAKGPIILEENDSIAIESSTTSAISATLSILEVSREDQNG |
Ga0181585_110381631 | 3300017969 | Salt Marsh | GPLILEESDSIALETSDTSGISATLSILEISREDQNG |
Ga0180432_106209531 | 3300017989 | Hypersaline Lake Sediment | VAKGPIILEENDSIALETSTTDAISAVMSILEISREDQNG |
Ga0181600_104349181 | 3300018036 | Salt Marsh | GPTICNLAKGPIILEENDSIALETSDTSGTSATLSILEISREDQNG |
Ga0181572_100584935 | 3300018049 | Salt Marsh | SVTGPTICNLAKGPIILEENDSIALETSDTSGISATLSILEISREDQNG |
Ga0180433_103592293 | 3300018080 | Hypersaline Lake Sediment | GPTICNIAKGPIILEESDSISLESTDTSAISATLALLEISREDQNG |
Ga0181563_106360131 | 3300018420 | Salt Marsh | TICNVAKGPIILEDNDYVTIETSDTSAISGTLGILEISREDQNG |
Ga0194002_10874141 | 3300019745 | Sediment | KGPLILEDNDSIALETSDTSGISATLSILEISREDQNG |
Ga0194029_10855393 | 3300019751 | Freshwater | GPTICNLAKGPIILEENDSIAIESSTTSDISATLSILEISREDQNG |
Ga0194024_10483261 | 3300019765 | Freshwater | IILEEGDSISIETSDISSISATLSILEISREDQNG |
Ga0194024_11607111 | 3300019765 | Freshwater | SITGPTICNVAKGPLILEDNDSIALETSDTSGISATLSILEISREDQNG |
Ga0181555_10620971 | 3300020051 | Salt Marsh | TGPTICNLAKGPIILEDNDSIALETSDTSGISATLSILEISREDQNG |
Ga0211734_102026321 | 3300020159 | Freshwater | PIVLEETDTIRLESSNVSGISATLAILEINRDDQNGQ |
Ga0208487_10254701 | 3300020531 | Freshwater | PIVLEETDTIRLETSNVSGISATVAILEINRDDQNGQ |
Ga0208229_10041931 | 3300020569 | Freshwater | NLAKGPIVLEETDTIRLESSNVSGISATLAILEINRDDQNGQ |
Ga0181598_13444343 | 3300020810 | Salt Marsh | NVAKGPLVLEENDSIALETSDTSGISGTLSILEISREDQNG |
Ga0213858_100199465 | 3300021356 | Seawater | ISGPTICNVAKGPLILEDNDSIALETSDTSGISATLSILEISREDQNG |
Ga0213859_104188391 | 3300021364 | Seawater | IAKGPIILEESDSISLESTDTSAISATLALLEISREDQNG |
Ga0213863_100533734 | 3300021371 | Seawater | PTICNVAKGPLILEDNDLIALETSDTSGISATLSILEISREDQNG |
Ga0213866_105609493 | 3300021425 | Seawater | GPTICNVAKGPLILEDNDSIALETSDTSGISATLSILEISREDQNG |
Ga0222718_101426994 | 3300021958 | Estuarine Water | SITGPTICNVAKGPIILEENDSIALETSTTDAISAVMSILEISREDQNG |
Ga0222718_102142951 | 3300021958 | Estuarine Water | TICNLAKGPIILEENDSIAIESSTTSAISATLSILEISREDQNG |
Ga0222718_102906961 | 3300021958 | Estuarine Water | IILEDNDSIALETSDTSGISATLSILEISREDQNG |
Ga0222718_104266071 | 3300021958 | Estuarine Water | PTICNLAKGPIILEDNDSIALETSDTSGISATLSILEISREDQNG |
Ga0222718_104922823 | 3300021958 | Estuarine Water | PTICNVAKGPLILEESDSIALESSTTSAISATLSILEISREDQNG |
Ga0222716_105339033 | 3300021959 | Estuarine Water | VAKGPLILEESDSIALESSTTSAISATLSILEISREDQNG |
Ga0222715_100905231 | 3300021960 | Estuarine Water | KGPIILEESDVLAIESSDTSGISATVAILEISRDDQNG |
Ga0222715_101449254 | 3300021960 | Estuarine Water | TGPNICNIAKGPIILEESDSISLESTDTSGISATLALLEISREDQNG |
Ga0222715_104615633 | 3300021960 | Estuarine Water | ITGPTICNVAKGPLILEDNDLIALETSDTSGISATISILEISREDQNG |
Ga0222715_104615884 | 3300021960 | Estuarine Water | SGPTICNVAKGPIILEENDSIALETSTTDAITAVMSILEISREDQNG |
Ga0222714_102076583 | 3300021961 | Estuarine Water | GPTICNLAKGPIILEESDSIALESSDVSGISATISILEISREDQNG |
Ga0222714_102168153 | 3300021961 | Estuarine Water | SGPTICNVAKGPLVLEENDSIALETSDVSGISATLSILEISREDQNG |
Ga0222714_105045313 | 3300021961 | Estuarine Water | AKGPIILEENDSLSLETNNTSNVTAIVSILEISREDQNG |
Ga0222714_105445771 | 3300021961 | Estuarine Water | KGPIILEESDAIKVETSDTSAISATLAILEISRDDQNG |
Ga0222719_102949363 | 3300021964 | Estuarine Water | ICNLAKGPIILEENDSIAIESSTTSAISATLSILEISREDQNG |
Ga0222719_103671061 | 3300021964 | Estuarine Water | GPLILEDNDLIALETSDTSGISATISILEISREDQNG |
Ga0212024_10268731 | 3300022065 | Aqueous | ITGPTICNVAKGPLILEDNDSIALETSDTSGISAALSILEISREDQNG |
Ga0212021_10149844 | 3300022068 | Aqueous | IKGPIILEENDSIALETSTTDAITAVISILEISREDQNG |
Ga0212021_10901113 | 3300022068 | Aqueous | KGPLVLEENDSIALETSDTSGISGTLSILEISREDQNG |
Ga0212021_10937263 | 3300022068 | Aqueous | GPLVLEESDSIALETSDTSGISGTLSILEISREDQNG |
Ga0212028_10193971 | 3300022071 | Aqueous | TGPTICNVAKGPLILEDNDLIALETSDTSGISATISILEISREDQNG |
Ga0212028_10722883 | 3300022071 | Aqueous | IILEESDVIAIESSDTSGISGTVAILEISRDDQNG |
Ga0212028_11036223 | 3300022071 | Aqueous | TKGPIILEDNDSIALETSDTSGISATLSILEISREDQNG |
Ga0196891_10363801 | 3300022183 | Aqueous | PTICNIAKGPIILEENDILLLESSDTSGISATLAILEINRDDQNG |
Ga0196891_10433651 | 3300022183 | Aqueous | TGPTICNIAKGPIILEESDSISLESSTTSAITASLALLEISREDQNG |
Ga0196899_11962373 | 3300022187 | Aqueous | ICNLAKGPIILEDNDSIALETSDTSGISATLSILEISREDQNG |
Ga0196901_12291713 | 3300022200 | Aqueous | GPTICNLAKGPIILEESDSIALETSDTSAISATISILEISREDQNG |
Ga0196901_12570813 | 3300022200 | Aqueous | GPLILEESDSIALESSTTSAISATLSILEISREDQNG |
Ga0255765_13883583 | 3300022921 | Salt Marsh | KGPIILEESDSISLETSTTSAITASLALLEISRDDQNG |
Ga0255753_11924363 | 3300022926 | Salt Marsh | IILEENDSIAIESSTTSAISATLSILEVSREDQNG |
Ga0255753_12547341 | 3300022926 | Salt Marsh | CNLAKGPIILEEGDSISIETSDTSGISATLSILEISREDQNG |
Ga0255769_100591334 | 3300022927 | Salt Marsh | NLAKGPIILEDNDSIALETSDTSGISATLSILEISREDQNG |
Ga0255758_100219447 | 3300022928 | Salt Marsh | TICNLAKGPIILEENDSIALETSDTSGISATLSILEISREDQNG |
Ga0255772_101405771 | 3300023176 | Salt Marsh | PLILEESDSIALESSTTSAISATLSILEISREDQNG |
Ga0255759_102418311 | 3300023178 | Salt Marsh | NLAKGPIILEENDSIALETSDTSGTSATLSILEISREDQNG |
Ga0233451_101138073 | 3300024301 | Salt Marsh | LAKGPIILEDNDSIALETSDTSGISATLSILEISREDQNG |
Ga0208303_11159903 | 3300025543 | Aqueous | GPTICNLAKGPIILEEGDSISIETSDISGVSATLSILEISREDQNG |
Ga0208149_10047371 | 3300025610 | Aqueous | NVAKGPLILEDNDSIALETSDTSGISATLSILEISREDQNG |
Ga0208149_11381933 | 3300025610 | Aqueous | NIAKGPIILEESDSISLETSTTSAITASLALLEISRDDQNG |
Ga0209504_11341053 | 3300025621 | Pelagic Marine | IILEENDTIRLESSDVSDISATLSILEISREDQNG |
Ga0208161_10185181 | 3300025646 | Aqueous | PLILEESDSIALETSDTSGISAALSILEISREDQNG |
Ga0208160_11061563 | 3300025647 | Aqueous | GPIVLEENDTISLESSDVSGISATLAILEINREDTNG |
Ga0208898_10078928 | 3300025671 | Aqueous | IILEESDSISLESTDTSAISATLALLEISREDQNG |
Ga0208898_10117131 | 3300025671 | Aqueous | GPTICNLAKGPIILEESDVIAIESSDTSGISGTISILEISRDDQNG |
Ga0208898_11138433 | 3300025671 | Aqueous | IILEENDSIAIESSTTSDISATLSILEISREDQNG |
Ga0208898_11585953 | 3300025671 | Aqueous | ICNLAKGPIILEENDSIALETSDTSGTSATLSILEISREDQNG |
Ga0208898_11700871 | 3300025671 | Aqueous | ISGPTICNIAKGPIILEENDILLLESSDTSGISATLAILEISRDDQNG |
Ga0208019_11064551 | 3300025687 | Aqueous | ASITGPTICNVAKGPLVLEENDSIALETSDTSGISGTLSILEISREDQNG |
Ga0209771_10324671 | 3300025701 | Marine | TGPTICNLAKGPIILEENDSIAIESSTTSDISATLSILEISREDQNG |
Ga0208899_10061008 | 3300025759 | Aqueous | IAKGPLILEDNDSIALETSDTSGISATLSILEISREDQNG |
Ga0208899_10160756 | 3300025759 | Aqueous | TGPTICNVAKGPLILEDNDSIALETSDTSGISAALSILEISREDQNG |
Ga0208899_10383924 | 3300025759 | Aqueous | ICNVAKGPLILEDNDSIALETSDTSGISAALSILEISREDQNG |
Ga0208767_11247684 | 3300025769 | Aqueous | NLAKGPIILEESDSIALESSDVSAISATISILEISREDQNG |
Ga0208767_11458691 | 3300025769 | Aqueous | PIILEDNDSIALETSDTSGISATLSILEISREDQNG |
Ga0208425_10828601 | 3300025803 | Aqueous | LAKGPIILEEGDSISIETSDTSGISATLSILEISREDQNG |
Ga0208425_10892561 | 3300025803 | Aqueous | AKGPIILEESDSISLESTDTSGISATLALLEISREDQNG |
Ga0208543_10098656 | 3300025810 | Aqueous | PIILEEGDSISIETSDISGVSATLSILEISREDQNG |
Ga0208543_11152473 | 3300025810 | Aqueous | LILEDNDSIALETSDTSGISATLSVLEISREDQNG |
Ga0208542_11556463 | 3300025818 | Aqueous | PTICNLAKGPIILEESDVIAIESSDTSGISGTISILEISRDDQNG |
Ga0208917_12223371 | 3300025840 | Aqueous | GPLILEDNDSIALETSDTSGISAALSILEISREDQNG |
Ga0209223_104084541 | 3300025876 | Pelagic Marine | TICNLAKGPIILEENDSIAIESSTTSDISATLSILEISREDQNG |
Ga0208644_10564094 | 3300025889 | Aqueous | PIILEESDSIKLESSNTSAISATLAILEISREDQNG |
Ga0208644_10638791 | 3300025889 | Aqueous | ASVSGPTICNLAKGPIILEESDVIAIESSDTSGISATVAILEISRDDQNG |
Ga0208644_13087823 | 3300025889 | Aqueous | SITGPTICNVAKGPLVLEENDSIALETSDTSGISGTLSILEISREDQNG |
Ga0209951_11035834 | 3300026138 | Pond Water | NVAKGPIILEEGDSILMETNDTTAVTAIISILEISRDDQNG |
Ga0209951_11282971 | 3300026138 | Pond Water | ICNLAKGPIILEEGDSISIETSDISGISATLSILEISREDQNG |
Ga0209929_11521863 | 3300026187 | Pond Water | VAKGPLILEDNDLIALETSDTSGISATISILEISREDQNG |
Ga0209704_10235145 | 3300027693 | Freshwater Sediment | IILEENDVIRLESSVTSGISATLAILEINRDDQNGQN |
Ga0209500_102372311 | 3300027782 | Freshwater Lake | CNIAKGPIVLEETDTIRLESSVTSGISATLAILEINRDDQNGQN |
Ga0209358_100789621 | 3300027804 | Freshwater Lake | NIASGPIILEESDSILLQTSDTTAISAVLSILEMNRNDQNG |
Ga0209536_1028189343 | 3300027917 | Marine Sediment | ICNVAKAPLILEESDSIALETSDTSGISAALSILEISREDQNG |
Ga0334987_0703510_437_577 | 3300034061 | Freshwater | PTICNLAKGPIVLEETDTIRLESSVTSGISATLAILEINRDDQTGQ |
Ga0334995_0304150_931_1041 | 3300034062 | Freshwater | ILEENDVIRLESSVTSGISATLAILEINRDDQNGQN |
Ga0335000_0423950_2_121 | 3300034063 | Freshwater | KGPIVLEETDTIRLESSNVSGISATLAILEINRDDQNGQ |
Ga0335027_0222484_1_114 | 3300034101 | Freshwater | IVLEESDTIRLESSSTSGISATLAILEINRDDQNGNI |
Ga0335027_0578529_556_687 | 3300034101 | Freshwater | NLANGPIILEENDVIRLESSVTSGISATLAILEINRDDQNGQN |
Ga0335036_0602596_1_111 | 3300034106 | Freshwater | IVLEETDTIRLESSNVSGISATVAILEINRDDQNGQ |
Ga0335068_0126331_2_127 | 3300034116 | Freshwater | IAKGPVILEENDTIRLETSNVSGISATVAILEINRDDQNGQ |
Ga0335049_0437353_706_846 | 3300034272 | Freshwater | PTICNIAKGPVILEENDTIRLETSNVSGISATVAILEINRDDQNGQ |
Ga0335052_0154928_3_122 | 3300034279 | Freshwater | KGPIVLEETDTIRLESSNVSGISATVAILEINRDDQNGQ |
Ga0348335_035626_2002_2112 | 3300034374 | Aqueous | PLILEDNDSIALESSDTSGISAALSILEISREDQNG |
Ga0348336_199058_3_146 | 3300034375 | Aqueous | SGPTICNLAKGPIILEESDVIAIESSDTSGISATVAILEISRDDQNG |
Ga0348337_003653_2_157 | 3300034418 | Aqueous | TGPTICNVAKGPLILEDNDSIALETSDTSGISAALSILEISREDQNGNGTR |
Ga0348337_063742_1_114 | 3300034418 | Aqueous | GPIILEESDVIAIESSDTSGISATVAILEISRDDQNG |
Ga0348337_107628_771_887 | 3300034418 | Aqueous | KGPLILEDNDSIALESSDTSGISATLSILEISREDQNG |
Ga0348337_126705_2_148 | 3300034418 | Aqueous | VTGPTICNLAKGPIILEDNDSIALETSDTSGISATLSILEISREDQNG |
⦗Top⦘ |