| Basic Information | |
|---|---|
| Family ID | F028332 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 192 |
| Average Sequence Length | 47 residues |
| Representative Sequence | GGDLPHLKARKDLSDEFKRKMLYDNPVRFYRFSEGDIAAARKAKAN |
| Number of Associated Samples | 162 |
| Number of Associated Scaffolds | 192 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.21 % |
| % of genes near scaffold ends (potentially truncated) | 85.42 % |
| % of genes from short scaffolds (< 2000 bps) | 84.38 % |
| Associated GOLD sequencing projects | 156 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.542 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (10.417 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.729 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (36.979 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.49% β-sheet: 0.00% Coil/Unstructured: 63.51% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 192 Family Scaffolds |
|---|---|---|
| PF07883 | Cupin_2 | 8.85 |
| PF09084 | NMT1 | 7.29 |
| PF02604 | PhdYeFM_antitox | 6.77 |
| PF04909 | Amidohydro_2 | 5.73 |
| PF05016 | ParE_toxin | 4.17 |
| PF04321 | RmlD_sub_bind | 2.60 |
| PF14137 | DUF4304 | 2.08 |
| PF03241 | HpaB | 2.08 |
| PF03796 | DnaB_C | 1.56 |
| PF00903 | Glyoxalase | 1.04 |
| PF13343 | SBP_bac_6 | 1.04 |
| PF02776 | TPP_enzyme_N | 1.04 |
| PF02775 | TPP_enzyme_C | 1.04 |
| PF13485 | Peptidase_MA_2 | 1.04 |
| PF01527 | HTH_Tnp_1 | 0.52 |
| PF00483 | NTP_transferase | 0.52 |
| PF00361 | Proton_antipo_M | 0.52 |
| PF13676 | TIR_2 | 0.52 |
| PF08241 | Methyltransf_11 | 0.52 |
| PF13683 | rve_3 | 0.52 |
| PF01381 | HTH_3 | 0.52 |
| PF00355 | Rieske | 0.52 |
| PF12706 | Lactamase_B_2 | 0.52 |
| PF14355 | Abi_C | 0.52 |
| PF08479 | POTRA_2 | 0.52 |
| PF13488 | Gly-zipper_Omp | 0.52 |
| PF01979 | Amidohydro_1 | 0.52 |
| PF14267 | DUF4357 | 0.52 |
| PF13432 | TPR_16 | 0.52 |
| PF13847 | Methyltransf_31 | 0.52 |
| PF04471 | Mrr_cat | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 192 Family Scaffolds |
|---|---|---|---|
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 7.29 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 7.29 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 6.77 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 6.77 |
| COG0451 | Nucleoside-diphosphate-sugar epimerase | Cell wall/membrane/envelope biogenesis [M] | 5.21 |
| COG0702 | Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains | General function prediction only [R] | 5.21 |
| COG1086 | NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC | Cell wall/membrane/envelope biogenesis [M] | 5.21 |
| COG1087 | UDP-glucose 4-epimerase | Cell wall/membrane/envelope biogenesis [M] | 2.60 |
| COG1088 | dTDP-D-glucose 4,6-dehydratase | Cell wall/membrane/envelope biogenesis [M] | 2.60 |
| COG1089 | GDP-D-mannose dehydratase | Cell wall/membrane/envelope biogenesis [M] | 2.60 |
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 2.60 |
| COG1091 | dTDP-4-dehydrorhamnose reductase | Cell wall/membrane/envelope biogenesis [M] | 2.60 |
| COG2368 | Aromatic ring hydroxylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.08 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 1.56 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 1.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.06 % |
| Unclassified | root | N/A | 10.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664021|ICCgaii200_c0547605 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101388748 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1482 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101575228 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300000559|F14TC_102495365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1236 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10135554 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300000787|JGI11643J11755_11126843 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300000787|JGI11643J11755_11509117 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300000953|JGI11615J12901_11649930 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 581 | Open in IMG/M |
| 3300000956|JGI10216J12902_108424730 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300000956|JGI10216J12902_113615204 | All Organisms → cellular organisms → Bacteria | 2172 | Open in IMG/M |
| 3300000956|JGI10216J12902_120930321 | Not Available | 564 | Open in IMG/M |
| 3300000956|JGI10216J12902_124812827 | Not Available | 630 | Open in IMG/M |
| 3300001372|YBBDRAFT_1076462 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
| 3300002155|JGI24033J26618_1049753 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300003324|soilH2_10115290 | All Organisms → cellular organisms → Bacteria | 2538 | Open in IMG/M |
| 3300004050|Ga0055491_10174674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300004070|Ga0055488_10192155 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300004114|Ga0062593_100212829 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300004463|Ga0063356_100887699 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300004480|Ga0062592_102453588 | Not Available | 524 | Open in IMG/M |
| 3300004779|Ga0062380_10121894 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300005166|Ga0066674_10147667 | Not Available | 1108 | Open in IMG/M |
| 3300005289|Ga0065704_10617963 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300005294|Ga0065705_10157890 | All Organisms → cellular organisms → Bacteria | 1831 | Open in IMG/M |
| 3300005332|Ga0066388_107021651 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005340|Ga0070689_101902608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300005458|Ga0070681_10146030 | All Organisms → cellular organisms → Bacteria | 2294 | Open in IMG/M |
| 3300005471|Ga0070698_101296040 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300005546|Ga0070696_100485717 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 980 | Open in IMG/M |
| 3300005546|Ga0070696_100901842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 733 | Open in IMG/M |
| 3300005549|Ga0070704_102194719 | Not Available | 513 | Open in IMG/M |
| 3300005575|Ga0066702_10880284 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005617|Ga0068859_101247246 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 819 | Open in IMG/M |
| 3300005617|Ga0068859_102209114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300005713|Ga0066905_100582416 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300005719|Ga0068861_100618599 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300005764|Ga0066903_107674850 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005836|Ga0074470_10421504 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3314 | Open in IMG/M |
| 3300006163|Ga0070715_10611437 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300006844|Ga0075428_100791005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1008 | Open in IMG/M |
| 3300006845|Ga0075421_100709089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1168 | Open in IMG/M |
| 3300006847|Ga0075431_100903489 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300006854|Ga0075425_101480484 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae | 767 | Open in IMG/M |
| 3300006865|Ga0073934_10155285 | All Organisms → cellular organisms → Bacteria | 1623 | Open in IMG/M |
| 3300006871|Ga0075434_100950639 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300006876|Ga0079217_10057896 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
| 3300006876|Ga0079217_10248265 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae | 948 | Open in IMG/M |
| 3300006876|Ga0079217_10326376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 865 | Open in IMG/M |
| 3300006880|Ga0075429_100664102 | Not Available | 913 | Open in IMG/M |
| 3300006904|Ga0075424_100501452 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300006954|Ga0079219_10431131 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300006969|Ga0075419_10352713 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300006969|Ga0075419_10679398 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300007004|Ga0079218_10214206 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
| 3300007255|Ga0099791_10415029 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300009094|Ga0111539_11581838 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300009100|Ga0075418_10020653 | All Organisms → cellular organisms → Bacteria | 7258 | Open in IMG/M |
| 3300009100|Ga0075418_12463251 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300009147|Ga0114129_10979747 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300009147|Ga0114129_12180533 | Not Available | 667 | Open in IMG/M |
| 3300009156|Ga0111538_13145490 | Not Available | 575 | Open in IMG/M |
| 3300009162|Ga0075423_10780814 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300009162|Ga0075423_12441278 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300009171|Ga0105101_10612915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300009176|Ga0105242_12000058 | Not Available | 622 | Open in IMG/M |
| 3300009597|Ga0105259_1171223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300009678|Ga0105252_10202820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 850 | Open in IMG/M |
| 3300009811|Ga0105084_1093270 | Not Available | 563 | Open in IMG/M |
| 3300009817|Ga0105062_1031005 | Not Available | 934 | Open in IMG/M |
| 3300010042|Ga0126314_10685240 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300010046|Ga0126384_12265272 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300010047|Ga0126382_11204530 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300010166|Ga0126306_10672342 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300010376|Ga0126381_102860988 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300010391|Ga0136847_10254818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2648 | Open in IMG/M |
| 3300010400|Ga0134122_10180790 | Not Available | 1736 | Open in IMG/M |
| 3300010400|Ga0134122_10696052 | Not Available | 954 | Open in IMG/M |
| 3300010401|Ga0134121_11048068 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300010401|Ga0134121_12120533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300010403|Ga0134123_13534298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300011436|Ga0137458_1157155 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300011437|Ga0137429_1212283 | Not Available | 603 | Open in IMG/M |
| 3300012040|Ga0137461_1000090 | All Organisms → cellular organisms → Bacteria | 18894 | Open in IMG/M |
| 3300012040|Ga0137461_1109125 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae | 796 | Open in IMG/M |
| 3300012040|Ga0137461_1154117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 675 | Open in IMG/M |
| 3300012041|Ga0137430_1076211 | Not Available | 930 | Open in IMG/M |
| 3300012175|Ga0137321_1113324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300012202|Ga0137363_11576401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatibacillum → Desulfatibacillum aliphaticivorans | 548 | Open in IMG/M |
| 3300012232|Ga0137435_1042229 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300012349|Ga0137387_10923107 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300012349|Ga0137387_11085877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatibacillum → Desulfatibacillum aliphaticivorans | 571 | Open in IMG/M |
| 3300012353|Ga0137367_10144821 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
| 3300012354|Ga0137366_10039498 | All Organisms → cellular organisms → Bacteria | 3655 | Open in IMG/M |
| 3300012355|Ga0137369_10332232 | Not Available | 1116 | Open in IMG/M |
| 3300012479|Ga0157348_1024357 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300012499|Ga0157350_1018134 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300012501|Ga0157351_1014241 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300012910|Ga0157308_10138302 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300012915|Ga0157302_10034045 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300012925|Ga0137419_11676239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium RBG_16_51_14 | 542 | Open in IMG/M |
| 3300012927|Ga0137416_10737815 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300012929|Ga0137404_10886351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 813 | Open in IMG/M |
| 3300012929|Ga0137404_11431887 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300012931|Ga0153915_11450465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 802 | Open in IMG/M |
| 3300012944|Ga0137410_10816609 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300012960|Ga0164301_10000639 | All Organisms → cellular organisms → Bacteria | 10417 | Open in IMG/M |
| 3300012961|Ga0164302_10002407 | All Organisms → cellular organisms → Bacteria | 6190 | Open in IMG/M |
| 3300012972|Ga0134077_10025208 | Not Available | 2077 | Open in IMG/M |
| 3300012989|Ga0164305_11220224 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300013297|Ga0157378_10127895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 2349 | Open in IMG/M |
| 3300013308|Ga0157375_11072944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium PBB5 | 942 | Open in IMG/M |
| 3300014268|Ga0075309_1037082 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium | 1087 | Open in IMG/M |
| 3300014300|Ga0075321_1073830 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300014311|Ga0075322_1099046 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300014864|Ga0180068_1061644 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera → Ephemera danica | 624 | Open in IMG/M |
| 3300014873|Ga0180066_1002588 | All Organisms → cellular organisms → Bacteria | 2567 | Open in IMG/M |
| 3300014873|Ga0180066_1015839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1342 | Open in IMG/M |
| 3300015255|Ga0180077_1012956 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
| 3300015264|Ga0137403_11135675 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300015371|Ga0132258_10633192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2688 | Open in IMG/M |
| 3300015372|Ga0132256_100202917 | All Organisms → cellular organisms → Bacteria | 2030 | Open in IMG/M |
| 3300015373|Ga0132257_100161842 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2630 | Open in IMG/M |
| 3300015373|Ga0132257_100384842 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
| 3300015373|Ga0132257_100409372 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
| 3300017654|Ga0134069_1359760 | Not Available | 524 | Open in IMG/M |
| 3300017936|Ga0187821_10089192 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300018028|Ga0184608_10188096 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300018031|Ga0184634_10382204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 645 | Open in IMG/M |
| 3300018052|Ga0184638_1051079 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium | 1505 | Open in IMG/M |
| 3300018053|Ga0184626_10017301 | All Organisms → cellular organisms → Bacteria | 2898 | Open in IMG/M |
| 3300018063|Ga0184637_10183504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1286 | Open in IMG/M |
| 3300018063|Ga0184637_10702430 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300018075|Ga0184632_10017851 | All Organisms → cellular organisms → Bacteria | 2989 | Open in IMG/M |
| 3300018077|Ga0184633_10465212 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300018078|Ga0184612_10033031 | All Organisms → cellular organisms → Bacteria | 2678 | Open in IMG/M |
| 3300018079|Ga0184627_10073545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1789 | Open in IMG/M |
| 3300018081|Ga0184625_10189127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1079 | Open in IMG/M |
| 3300018082|Ga0184639_10070902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1820 | Open in IMG/M |
| 3300018082|Ga0184639_10555103 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300018082|Ga0184639_10599722 | Not Available | 540 | Open in IMG/M |
| 3300018083|Ga0184628_10624791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300018084|Ga0184629_10103988 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300018084|Ga0184629_10192299 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 1052 | Open in IMG/M |
| 3300018089|Ga0187774_10702899 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300018422|Ga0190265_10328326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1610 | Open in IMG/M |
| 3300018422|Ga0190265_12428987 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300018429|Ga0190272_11522825 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300018432|Ga0190275_12955385 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300018465|Ga0190269_11854701 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300018468|Ga0066662_11324715 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 740 | Open in IMG/M |
| 3300018469|Ga0190270_11823038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 664 | Open in IMG/M |
| 3300018476|Ga0190274_12188451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300019356|Ga0173481_10251440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. ITM-2016-00317 | 796 | Open in IMG/M |
| 3300020186|Ga0163153_10029140 | All Organisms → cellular organisms → Bacteria | 4208 | Open in IMG/M |
| 3300021081|Ga0210379_10057007 | All Organisms → cellular organisms → Bacteria | 1568 | Open in IMG/M |
| 3300021082|Ga0210380_10120323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1168 | Open in IMG/M |
| 3300021082|Ga0210380_10272898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 768 | Open in IMG/M |
| 3300021332|Ga0210339_1725775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Deinococcales → Deinococcaceae → Deinococcus → Deinococcus yavapaiensis → Deinococcus yavapaiensis KR-236 | 813 | Open in IMG/M |
| 3300022756|Ga0222622_10636130 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300025537|Ga0210061_1074722 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300025567|Ga0210076_1003159 | All Organisms → cellular organisms → Bacteria | 3945 | Open in IMG/M |
| 3300025792|Ga0210143_1034704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 883 | Open in IMG/M |
| 3300025920|Ga0207649_11186125 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300025927|Ga0207687_10985055 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300025930|Ga0207701_10752210 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300025945|Ga0207679_10311784 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300026041|Ga0207639_11138380 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300026078|Ga0207702_10057940 | All Organisms → cellular organisms → Bacteria | 3295 | Open in IMG/M |
| 3300026333|Ga0209158_1325601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300027006|Ga0209896_1046316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300027379|Ga0209842_1002102 | All Organisms → cellular organisms → Bacteria | 3970 | Open in IMG/M |
| 3300027577|Ga0209874_1048368 | Not Available | 1109 | Open in IMG/M |
| 3300027715|Ga0208665_10172129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 680 | Open in IMG/M |
| 3300027815|Ga0209726_10153857 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 1279 | Open in IMG/M |
| 3300027886|Ga0209486_10016519 | All Organisms → cellular organisms → Bacteria | 3392 | Open in IMG/M |
| 3300027907|Ga0207428_10086174 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2445 | Open in IMG/M |
| 3300027909|Ga0209382_10234160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 2092 | Open in IMG/M |
| 3300027909|Ga0209382_11048986 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300030619|Ga0268386_10767904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 620 | Open in IMG/M |
| 3300031548|Ga0307408_101007680 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300031820|Ga0307473_10809804 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300031890|Ga0306925_12265399 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300031949|Ga0214473_10119009 | All Organisms → cellular organisms → Bacteria | 3084 | Open in IMG/M |
| 3300032005|Ga0307411_10687113 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300033004|Ga0335084_10112408 | All Organisms → cellular organisms → Bacteria | 2832 | Open in IMG/M |
| 3300033407|Ga0214472_10176748 | All Organisms → cellular organisms → Bacteria | 2078 | Open in IMG/M |
| 3300033407|Ga0214472_11084569 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300033414|Ga0316619_12214749 | Not Available | 503 | Open in IMG/M |
| 3300033486|Ga0316624_10336469 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300033551|Ga0247830_10084656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2192 | Open in IMG/M |
| 3300034150|Ga0364933_104248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium PBB5 | 719 | Open in IMG/M |
| 3300034178|Ga0364934_0119313 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.42% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 8.85% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 7.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.29% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.12% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.60% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.60% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.08% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.56% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.56% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.56% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.04% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.04% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.04% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.04% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.04% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.04% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.04% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.04% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.52% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.52% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.52% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.52% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.52% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.52% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.52% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.52% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 0.52% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.52% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.52% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.52% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.52% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.52% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.52% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.52% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001372 | YB-Back-sed | Environmental | Open in IMG/M |
| 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Host-Associated | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004050 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 | Environmental | Open in IMG/M |
| 3300004070 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009597 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
| 3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
| 3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
| 3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
| 3300012175 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT399_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012479 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.yng.030610 | Environmental | Open in IMG/M |
| 3300012499 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610 | Environmental | Open in IMG/M |
| 3300012501 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014268 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014300 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014864 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231A'_16_10D | Environmental | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300015255 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT466_16_10D | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300020186 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021332 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.384 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025537 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025792 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300027006 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027715 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICCgaii200_05476051 | 2228664021 | Soil | HLXARKDLSDEFKNKMLFDNPVRFYRLSEGDIAAARKAKGN |
| INPhiseqgaiiFebDRAFT_1013887481 | 3300000364 | Soil | FPHERERDQFGGDLPHLMARNDLSDEIKQKMLFDNPVRFYRFSEGDIAAVRKAKGN* |
| INPhiseqgaiiFebDRAFT_1015752282 | 3300000364 | Soil | ERDQFGGDLPHLMARKDLSDEIKQKMLFDNPVRFYRFSEVDIAAVKKAKGT* |
| F14TC_1024953651 | 3300000559 | Soil | LKARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAARKAKGN* |
| AF_2010_repII_A1DRAFT_101355542 | 3300000597 | Forest Soil | GDLPHLMARKDLSDEIKQKMLYDNPVRFYRFTEGDIAAVKKAKGN* |
| JGI11643J11755_111268431 | 3300000787 | Soil | QFGGDLPHLKARKDLTDDFKRKMLYDNPVRFYRFSEGDIAAARKAKSN* |
| JGI11643J11755_115091172 | 3300000787 | Soil | FGGDLPTLKARKDLTDDFRKKMLCDNPVRFYRLSEGDIAAARKAKGN* |
| JGI11615J12901_116499302 | 3300000953 | Soil | DQFGGDLPTLKARKDLTDDFRKKMLCDNPVRFYRLSEGDIAAGRKAKGN* |
| JGI10216J12902_1084247303 | 3300000956 | Soil | DFPHERERDQFGGDLPALKARKDLTDEFKRKMLYDNPVRFYRFSEGDIAAARKANGS* |
| JGI10216J12902_1136152043 | 3300000956 | Soil | QFGGDLPHLKARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAARKTKGN* |
| JGI10216J12902_1209303212 | 3300000956 | Soil | KARKDLTDEFKKKMLCDNPVRFYRLSEGDIAAARKAKGS* |
| JGI10216J12902_1248128272 | 3300000956 | Soil | KARKDLTDEFKKKMLCDNPVRFYRLEGDIAAARKAK* |
| YBBDRAFT_10764624 | 3300001372 | Marine Estuarine | VLRDFLAERERDQFGGDLPTLKARKDLTDEFRKKMLCDNPVRFYRLSEGEIAAARKARGN |
| JGI24033J26618_10497533 | 3300002155 | Corn, Switchgrass And Miscanthus Rhizosphere | RERDQFGGDLPHLYARKDVSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN* |
| soilH2_101152903 | 3300003324 | Sugarcane Root And Bulk Soil | PHLYARKDLSDDFKRKMLYDNPVRFYRFTEGDIAAARKAKGN* |
| Ga0055491_101746742 | 3300004050 | Natural And Restored Wetlands | PTLKARKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARKAKGK* |
| Ga0055488_101921552 | 3300004070 | Natural And Restored Wetlands | HLMARKDLSDEIKQKLLFDNPVRFYRFSEGDIAAVRKAKGK* |
| Ga0062593_1002128293 | 3300004114 | Soil | QFGGDLPHLYARKDVSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN* |
| Ga0063356_1008876992 | 3300004463 | Arabidopsis Thaliana Rhizosphere | PTLKARKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARKAKES* |
| Ga0062592_1024535881 | 3300004480 | Soil | HLKARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAARKAKTS* |
| Ga0062380_101218941 | 3300004779 | Wetland Sediment | DLPTLKARKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARNARGN* |
| Ga0066674_101476672 | 3300005166 | Soil | HERERDQFGGDLPHLKARNDLSDGFKRKMLYDNPVRFYRFSEGDIAAARKAKGN* |
| Ga0065704_106179632 | 3300005289 | Switchgrass Rhizosphere | DQFGGDLPHLYARKDVSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN* |
| Ga0065705_101578901 | 3300005294 | Switchgrass Rhizosphere | RERDQFGGDLPHLYARKDLSEEFKRKMLYDNPVRFYRFSEGDVAAVRKAKGN* |
| Ga0066388_1070216511 | 3300005332 | Tropical Forest Soil | HLMARKDLSDEIKQKMLYDNPVRFYRFTEGDIAAVKKAKGN* |
| Ga0070689_1019026081 | 3300005340 | Switchgrass Rhizosphere | MNAAFGSDLPHLKARKDLSDDFKRKMLYDNAVGSIVFSEGDIAAAGKAKKAGFNI* |
| Ga0070681_101460304 | 3300005458 | Corn Rhizosphere | DLPHLYARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAARQAKGT* |
| Ga0070698_1012960401 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | FGGDLPHLKARKDLSDEFKRKMLYDNPVRFYRFSEGDIAAVKKARGN* |
| Ga0070696_1004857173 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | LPPRDQFGGYLPTLKARKDLTDEFKKKILYDNPVRFYRFSESDIDAVRKAKGS* |
| Ga0070696_1009018421 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAAFGSDLPHLKARKDLSDDFKRKMLYDNAVGSIVFSEGDIAAAGKAKESWLNI* |
| Ga0070704_1021947192 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LPPRDQFGGYLPTLKARKDLTDEFKKKILYDNPVRFYRFSESD |
| Ga0066702_108802841 | 3300005575 | Soil | ERERDQFGGDLPHFVGRKDLSEETKQKILFDNPTRFYRLSEADIAAVKKSRGN* |
| Ga0068859_1012472461 | 3300005617 | Switchgrass Rhizosphere | TLKARKDLTDDFRKKMLCDNPVRFYRLSEGDIAAARKAKG* |
| Ga0068859_1022091142 | 3300005617 | Switchgrass Rhizosphere | MNAAIGSDLPHLKARKDLSDDFKRKMLYDNAVGSIVFSEGDIAAAGKAKEAGFNI* |
| Ga0066905_1005824161 | 3300005713 | Tropical Forest Soil | ERDQFGGDLPHLMARKDLSDEIKQKMLYDNPVRFYRFSEGDIAAVKKAKGN* |
| Ga0068861_1006185993 | 3300005719 | Switchgrass Rhizosphere | YARKDLSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN* |
| Ga0066903_1076748501 | 3300005764 | Tropical Forest Soil | ARKDLSDEIKQKMLYDNPVRFYRFTEGDIAAVKKAKGN* |
| Ga0074470_104215044 | 3300005836 | Sediment (Intertidal) | VLRDFLAERERDQFGGDLPTLKARKDLTDEFRKKMLCDNPVRFYRLSEGEIAAARKAGGN |
| Ga0070715_106114372 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | PHERERDQFGGDLPHLMARKDLSDEIKQKMLFDNPVRFYRFSEGDIAAVKKAKGT* |
| Ga0075428_1007910051 | 3300006844 | Populus Rhizosphere | KDLSDDFKRKMLYDNPVRFYRFSEGDIAAARKAKPN* |
| Ga0075421_1007090891 | 3300006845 | Populus Rhizosphere | PHERERDQFGGDLPHLYARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAARKAKPN* |
| Ga0075431_1009034894 | 3300006847 | Populus Rhizosphere | PTLKARKDLTDEFKRKMLYDNPVRFYRFSEGDIAAARKMKGN* |
| Ga0075425_1014804841 | 3300006854 | Populus Rhizosphere | QFGGDLPHLYARKDLTDDFKRKMLYDNPVRFYRFSEGDIAAVRKAKGN* |
| Ga0073934_101552853 | 3300006865 | Hot Spring Sediment | FGGDLPHLRARKDLSDDFRRKILYDNPVRFYRFSEGDIGAARKAK* |
| Ga0075434_1009506391 | 3300006871 | Populus Rhizosphere | PHLMARKDLSDEFKQKMLYDNPVRFYRFSEGDIAAVRKAKGN* |
| Ga0079217_100578961 | 3300006876 | Agricultural Soil | QFGGDLPHLKARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAVRKEKGS* |
| Ga0079217_102482653 | 3300006876 | Agricultural Soil | QFGGDLPHLKARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAAKKAKGN* |
| Ga0079217_103263761 | 3300006876 | Agricultural Soil | VAVCQPRDQVSVDLPHLKARKDLSDDFKRKMLSDNPVRFYRFSEGDIAAARKAKGA* |
| Ga0075429_1006641021 | 3300006880 | Populus Rhizosphere | DLPHLYARKDLSDDFKRKMLYDNPVRFYRFGEGDIAAARKAKGN* |
| Ga0075424_1005014522 | 3300006904 | Populus Rhizosphere | FGGDLPHLMARKDLSDEFKQKMLYDNPVRFYRFSEGDIAAVRKAKGN* |
| Ga0079219_104311311 | 3300006954 | Agricultural Soil | HERERDQFGGDLPHLYARKDLSEEFKRKMLYDNPVRFYRFSEGDVAAARKARTH* |
| Ga0075419_103527132 | 3300006969 | Populus Rhizosphere | DLSEEFKQKMLYDNPVRFYRFSEGDIAAVRRAKGN* |
| Ga0075419_106793981 | 3300006969 | Populus Rhizosphere | GGDLPHLRARKDLSDEFKNKMLFDNPVRFYRLSEGDIAAARKAKGN* |
| Ga0079218_102142062 | 3300007004 | Agricultural Soil | VCQPRDQVSVDLPHLKARKDLSDDFKRKMLSDNPVRFYRFSEGDIAAARKAKGA* |
| Ga0099791_104150292 | 3300007255 | Vadose Zone Soil | KDLSEEFKQKMLYDNPVRFYRFSDDDIAAVRRAKGN* |
| Ga0111539_115818382 | 3300009094 | Populus Rhizosphere | ASDFPHERERDQFGGDLPDLRACKDLSDEFKNKMLFDNPVRFYHLNEGDIAAARKAKGN* |
| Ga0075418_1002065311 | 3300009100 | Populus Rhizosphere | GDLPHLYARKDLSDDFKRKMLYDNPVRFYRFGEGDIAAARKAKGN* |
| Ga0075418_124632511 | 3300009100 | Populus Rhizosphere | LSEEFKRKMLYDNPVRFYRFSEGDIAAARKARTN* |
| Ga0114129_109797471 | 3300009147 | Populus Rhizosphere | GGDLPHLRARKDLSEEFKSKMLFDNPVRFYHLSEGDIAAARKAKGN* |
| Ga0114129_121805332 | 3300009147 | Populus Rhizosphere | DQFGGDLPHLYARKDLSDDFKRKMLYDNPVRFYRFGEGDIAAARKAKGN* |
| Ga0111538_131454901 | 3300009156 | Populus Rhizosphere | QFKGDLPHLYARKDLSDDFKRKMLYDNPVRFYRFGEGDIAAARKAKGN* |
| Ga0075423_107808141 | 3300009162 | Populus Rhizosphere | HERERDQFGGDLPHLKARKDLSDEFKRKMLYDNPVRFYRFSEGDIAAARKAKAN* |
| Ga0075423_124412781 | 3300009162 | Populus Rhizosphere | LPHLYARKDLSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN* |
| Ga0105101_106129151 | 3300009171 | Freshwater Sediment | RDQFGGDLPTLKARKDLTDEFRKKMLCDNPVRFYRLSEGDIAAAKRAKGN* |
| Ga0105242_120000582 | 3300009176 | Miscanthus Rhizosphere | DLSDEFKDKMLCGNPVRFYRFSEGDIAAARKAKGN* |
| Ga0105259_11712231 | 3300009597 | Soil | LNARKDLTDEFKRKMLYDNPVRFYRFNEGDIAAARKAKGS* |
| Ga0105252_102028202 | 3300009678 | Soil | SDFPHERERDQFGGDLPHLMARKDLSEEIKQKMLFDNPVRFYRFSEGDIAAVKKARGN* |
| Ga0105084_10932701 | 3300009811 | Groundwater Sand | HERERDQFGGDLPHLMERRDLSEEIKQKMLFDNPVRFYRFSEGDIAAVKKARGK* |
| Ga0105062_10310052 | 3300009817 | Groundwater Sand | PHLMARKDLSEEIKQKMLFDNPVRFYRFSEGDIAAVKKARGK* |
| Ga0126314_106852401 | 3300010042 | Serpentine Soil | FGGDLPHLKARKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARTAKAD* |
| Ga0126384_122652721 | 3300010046 | Tropical Forest Soil | LSDEIKQKMLYDNPVRFYRFTEGDIAAVKKAKGN* |
| Ga0126382_112045301 | 3300010047 | Tropical Forest Soil | RERDQFGGDLPHLMARKDLSDEIKQKMLYDNPVRFYRFSEGDIAAVKKAKRN* |
| Ga0126306_106723421 | 3300010166 | Serpentine Soil | GGDLPHLKARQDLSDEFKDKMLFDNPVRFYRLSEGDIAAAKKAKGN* |
| Ga0126381_1028609881 | 3300010376 | Tropical Forest Soil | KDLSDEIEQKMLYDNPVRFYRFTEGDIAAVKKAKGN* |
| Ga0136847_102548184 | 3300010391 | Freshwater Sediment | DQFGGDLLHLMARKDLSDEIKQKIVYDNPVRFYRFSEGDIAAVKRSRRN* |
| Ga0134122_101807901 | 3300010400 | Terrestrial Soil | HERERDQFGGDLPTLKARKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARKANGK* |
| Ga0134122_106960521 | 3300010400 | Terrestrial Soil | MSANYQYERERDQFGGDLPTLKARKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARKAKGN |
| Ga0134121_110480681 | 3300010401 | Terrestrial Soil | KDVSEEFKRKMLYDNPVRFYRFSEGDIAAARNARAN* |
| Ga0134121_121205332 | 3300010401 | Terrestrial Soil | QFGGDLPHLKARKDLTDEFKNKMLHDNPVRFYRLSEGDVAAARKAKGN* |
| Ga0134123_135342981 | 3300010403 | Terrestrial Soil | DQFGGDLPHLKARKDLPDDFKRKMLYDNPVRFYRFSEGDIAAARKAKGN* |
| Ga0137458_11571552 | 3300011436 | Soil | VSADYPYECERDQRGGDLPTLKARKDRTDEFRKKMRCDNPVRFYRLSEGDIAAA |
| Ga0137429_12122832 | 3300011437 | Soil | VRKDLTDEFKRKMLCDNTVRFYRFNEGDIAAARKAKGA* |
| Ga0137461_100009014 | 3300012040 | Soil | LKARKDLTDEFKSKMLCDNPVRLYRLGEGDIAAGRKANVS* |
| Ga0137461_11091251 | 3300012040 | Soil | DFPHERERDQFGGDLPHLKARKDLTDEFKRKMLYDNPVRFYRLGEGDIAAASKAKGN* |
| Ga0137461_11541172 | 3300012040 | Soil | REPDQFGGDLRTLKALKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARKVKGN* |
| Ga0137430_10762113 | 3300012041 | Soil | VRKDLTDEFKRKMLCDNTVRFYRFNEGDIAAARKAKNS* |
| Ga0137321_11133241 | 3300012175 | Soil | LIILWASYFLDERDQFGGDLPHLNARKDLTDEFKRKMLYDNPVRFYRFNEGDIAAARKAKGS* |
| Ga0137363_115764011 | 3300012202 | Vadose Zone Soil | KDLSDEFKQKMLYDNPVRFYRFSEGDIAAVKKAKEN* |
| Ga0137435_10422291 | 3300012232 | Soil | VPARRPRNQFRSDLPHLKARIDLSDEFKRKMLYDNPVRFYRFSEGDIAAARKALGN* |
| Ga0137387_109231072 | 3300012349 | Vadose Zone Soil | GGDLPHLKARKDLSDEFKRKMLYDNPVRFYRFSEGDIAAARKAKAN* |
| Ga0137387_110858771 | 3300012349 | Vadose Zone Soil | RERDQFGGDLPHLMGRKDLSDETKQKILFDNPVRFYRFSEGDIAAVKQAQQNSNR* |
| Ga0137367_101448213 | 3300012353 | Vadose Zone Soil | RKDLSEEFKQKMLYDNPVRFYRFSEGDIAAVRRAKGN* |
| Ga0137366_100394981 | 3300012354 | Vadose Zone Soil | DFPHERERDQFGGDLPHLKARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAARKAKGN* |
| Ga0137369_103322321 | 3300012355 | Vadose Zone Soil | PHLKARKDLSDEFKRKMLYDNPVRFYRFTEGDIAAAKKAKSS* |
| Ga0157348_10243572 | 3300012479 | Unplanted Soil | LTLAITGERDQFGGDLPHLYARKDLTDDFKRKMLYDNPVRFYRFSEGDIAAVRKAKGN* |
| Ga0157350_10181341 | 3300012499 | Unplanted Soil | DLSEEFKRKMLYDNPVRFYRFREGDVAAARKPRTH* |
| Ga0157351_10142411 | 3300012501 | Unplanted Soil | ERDQFGGDLPHLYARKDVSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN* |
| Ga0157308_101383021 | 3300012910 | Soil | HLYARKDVSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN* |
| Ga0157302_100340453 | 3300012915 | Soil | YARKDVSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN* |
| Ga0137419_116762391 | 3300012925 | Vadose Zone Soil | LKARKDLSDEFKRKMLYDNPVRFYRFSEGDIAAARKTKGN* |
| Ga0137416_107378152 | 3300012927 | Vadose Zone Soil | DFPHERERDQFGGDLPHLKARKDLSDEFKRKMLYDNPVRFYRFSEGDIAAARKAKAN* |
| Ga0137404_108863513 | 3300012929 | Vadose Zone Soil | PHERERDQFGGDLPHLYARKDLSDDFKRKMLYDNPVRFYRFGEGDIVAAKKAKGN* |
| Ga0137404_114318872 | 3300012929 | Vadose Zone Soil | SDFPHERERDQFGGDLPHLKARKDLSDEFKRKMLYDNPVRFYRFSEGDIAVARKAKAN* |
| Ga0153915_114504652 | 3300012931 | Freshwater Wetlands | VSLWASDFPHERERDQFGDDLAHFMARKDLSEDVRRKILFDNPVRFDRFNKGDMAAVRKTKGK* |
| Ga0137410_108166092 | 3300012944 | Vadose Zone Soil | MARRDLSEEIKQKMLSDNPVRFYRFSEGDIAALKKAKGN* |
| Ga0164301_100006391 | 3300012960 | Soil | FGGDLPHLYARKDVSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN* |
| Ga0164302_100024071 | 3300012961 | Soil | RDQFGGDLPHLYARKDVSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN* |
| Ga0134077_100252081 | 3300012972 | Grasslands Soil | RERDQFGGDLPHLKARNDLSDGFKRKMLYDNPVRFYRFSEGDIAAARKAKGN* |
| Ga0164305_112202241 | 3300012989 | Soil | LSEEFKQKMLYDNPVRFYRFSEDDIAAVRRAKGN* |
| Ga0157378_101278953 | 3300013297 | Miscanthus Rhizosphere | GERDQFGGDLPHLYARKDLSDDFERKMLYDNPVRFYRFSEGDIAAARKAKPN* |
| Ga0157375_110729442 | 3300013308 | Miscanthus Rhizosphere | RERDQFGGDLPHLYARKDLSDEFKRKMLYDNPVRFYRFSEGDIAAVKKAKGN* |
| Ga0075309_10370821 | 3300014268 | Natural And Restored Wetlands | LYARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAARKAKGN* |
| Ga0075321_10738301 | 3300014300 | Natural And Restored Wetlands | PHLYARKDLPDDFKRKMLYDNPVRFYRLSEGDIAAVRKAKNN* |
| Ga0075322_10990461 | 3300014311 | Natural And Restored Wetlands | HERERDQFGGDLPHLYERKDLSDDFKRKMLYDNPVRFYRLSEGDIAAAKKAK* |
| Ga0180068_10616441 | 3300014864 | Soil | RKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARKAKGN* |
| Ga0180066_10025881 | 3300014873 | Soil | DFPHERERDQFGGDLPHLMARQDLSDEIKQKIVYDNPVRFYRLGEGDIAAVKRAKGN* |
| Ga0180066_10158393 | 3300014873 | Soil | VPRLLVTYLANGELDQFGGDLPYLKARKDLTDEFKRRMLYDNPVRFYRFNEGDIAAVRKAKGS* |
| Ga0180077_10129563 | 3300015255 | Soil | RERDQFGGDLPHLMARKDLSEEIKQKMLFDNPVRFYRFSEGDIAAVKKARGN* |
| Ga0137403_111356751 | 3300015264 | Vadose Zone Soil | WASDFLYERERDQFGGDLLHLVGRKDLLEETKQKILFDNPTRFYRLSEADIAAVKKSRGN |
| Ga0132258_106331921 | 3300015371 | Arabidopsis Rhizosphere | LRARKDLSDEFKDKMLCGNPVRFYRFSEGDIAAAHKAKGN* |
| Ga0132256_1002029174 | 3300015372 | Arabidopsis Rhizosphere | DLSDDFKRKMLYDNPVRFYRFSEGDIAAAKKAKGN* |
| Ga0132257_1001618424 | 3300015373 | Arabidopsis Rhizosphere | RDQFGGDLPHLYARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAARKAKPN* |
| Ga0132257_1003848424 | 3300015373 | Arabidopsis Rhizosphere | GDLPHLYARKDLSDDFKRKMLYDNPVRFYRFNEGDIAAARKAKSR* |
| Ga0132257_1004093725 | 3300015373 | Arabidopsis Rhizosphere | ERDQFGGDLPHLYARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAARKAKGN* |
| Ga0134069_13597601 | 3300017654 | Grasslands Soil | PHLKARKDLSDEFKRKMLYDNPVRFYRFTEGDIAAARKAKGN |
| Ga0187821_100891924 | 3300017936 | Freshwater Sediment | ASDFPHERERDQFGGDLPHLYARKDLTDDFKRKMLYDNPMRFYRLSEGDIAAVQKAKHIS |
| Ga0184608_101880961 | 3300018028 | Groundwater Sediment | KARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAVKKARGN |
| Ga0184634_103822042 | 3300018031 | Groundwater Sediment | RDQFGGDLPHLKARKDLTDEFKRKMLYDNPVRFYRLGEGDIAAARKAKGI |
| Ga0184638_10510792 | 3300018052 | Groundwater Sediment | MIPGIIKPGRALPKPGQFGGDLPHLKARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAARNAKGN |
| Ga0184626_100173012 | 3300018053 | Groundwater Sediment | LKARKDLSDEFKRKMLYYNPVRFYRLSEGDIAAARKAKGN |
| Ga0184637_101835041 | 3300018063 | Groundwater Sediment | KDLSDEFKRKMLCDNPVRFYRFSEGDIAAVRSSRRN |
| Ga0184637_107024301 | 3300018063 | Groundwater Sediment | KDLSDEFKRKMLCDNPVRFYRFSEGDIAAVRRAKGK |
| Ga0184632_100178516 | 3300018075 | Groundwater Sediment | SDFPHERERDQFGGDLPHLMARKDLSEEMKQKMLFDNPVRFYRFSEGDIAAVKNARGN |
| Ga0184633_104652121 | 3300018077 | Groundwater Sediment | PHLKARKDLSDEFKRKMLYDNPVRFYRFTEGDIAAVKKAKGN |
| Ga0184612_100330311 | 3300018078 | Groundwater Sediment | KDLSDEFKRKMLYDNPVRFYRFSEGDIAAVRKAKGN |
| Ga0184627_100735451 | 3300018079 | Groundwater Sediment | QFGGDLPHLMARKDLSDEFKRKMLCDNPVRFYRFSEGDIAAVKKSKRN |
| Ga0184625_101891274 | 3300018081 | Groundwater Sediment | PHERERDQFGGDLPHLYARKDLSDEFKRKMLYDNPVRFYRFSEGDIAAARKAKGN |
| Ga0184639_100709021 | 3300018082 | Groundwater Sediment | SDFPHERERDQFGGDLPHLMARKDLSDEFKRKMLCDNPVRFYRFSEGDIAAVKKSKRN |
| Ga0184639_105551032 | 3300018082 | Groundwater Sediment | RERDQFGGDLPHLKARKDLSDEFKRKMLYDNPVRFYRFTEGDIAAVKKAKGN |
| Ga0184639_105997221 | 3300018082 | Groundwater Sediment | SDFPHERERDQFGGDLPHLMARKDLSDEFKRKMLCDNPVRFYRFSEGDIAAVRRAKGK |
| Ga0184628_106247912 | 3300018083 | Groundwater Sediment | FPHERERDQFGGDLPTLKGRKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARKAKGS |
| Ga0184629_101039883 | 3300018084 | Groundwater Sediment | DLPHLMARQDLSDEFKRKMLYDNPVRFYRFGEGDIAAVKKVKGN |
| Ga0184629_101922991 | 3300018084 | Groundwater Sediment | VPARRPRNQFRGDLPHLKARKDLSEKFKRNMLCDNPVRFYRFNEGDIAAARKAKGV |
| Ga0187774_107028991 | 3300018089 | Tropical Peatland | RDLSDEFKRKMLFDNPVRFYRFSEGDIAAVKKATGN |
| Ga0190265_103283263 | 3300018422 | Soil | MSAFPHERERDQFGGDLPHLKARKDLSDDFKQKMLYDNPVRFYRFSEGDIAAAKTAKSS |
| Ga0190265_124289871 | 3300018422 | Soil | LPHLMARKDLSDEFKRKMLYDNPVQFYRFSEGDIAAVRKAKGN |
| Ga0190272_115228253 | 3300018429 | Soil | KDLTDEFRKKMLCDNPVRFYRLSEGDIAAARRAKGN |
| Ga0190275_129553851 | 3300018432 | Soil | DFPHERERDQFGGDLPHLKARKDLSNEFKNKMLFDNPVRFYHLSEGDIAAAKKAKGN |
| Ga0190269_118547012 | 3300018465 | Soil | GGDLPHLMARRDLSEEIKQKMLFDNPVRFYRFSEGDIAAVKKAKGN |
| Ga0066662_113247153 | 3300018468 | Grasslands Soil | MARKDLSEEFKQKMLFDNPVRFYRFNEADIAAVRKAR |
| Ga0190270_118230381 | 3300018469 | Soil | FPHERERDQFGGDLPTLKGRKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARKARKT |
| Ga0190274_121884511 | 3300018476 | Soil | RDQFGGDLPHLKARKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARKARGS |
| Ga0173481_102514402 | 3300019356 | Soil | LRARKDLSDEFKNKMLFDNPVRFYHLNEGDIAAARKAKVN |
| Ga0163153_100291407 | 3300020186 | Freshwater Microbial Mat | MLKARKRLTDEFRKNILHNNPVRLYRRSESDIAAARKAKGS |
| Ga0210379_100570072 | 3300021081 | Groundwater Sediment | MARQDLSDEFKRKMLYDNPVRFYRFGEGDIAAVKKVKGN |
| Ga0210380_101203231 | 3300021082 | Groundwater Sediment | VSADYPYERERDQRGGDLPTLRARNDLTDEFGKIILCDNPVRFYRLSESDIATARKAKGN |
| Ga0210380_102728982 | 3300021082 | Groundwater Sediment | DFPHERERDQFGGDLPTLKGRKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARKARKT |
| Ga0210339_17257751 | 3300021332 | Estuarine | RDQFGGDLRTLKARKDFTDEIRNRMLCDNPVRFYRLSEGNIAAARKAKGN |
| Ga0222622_106361301 | 3300022756 | Groundwater Sediment | FGGDLPHLMARKDLSDEIKQKMLYDNPVRFYRFNEGDIAAVRRAKGK |
| Ga0210061_10747222 | 3300025537 | Natural And Restored Wetlands | MNPQRFKRKMLYDNPVWFYRFSEGDIAAARQTKGT |
| Ga0210076_10031591 | 3300025567 | Natural And Restored Wetlands | RKDLTEDFKRKMLYDNPVRFYRFSEGDIAAARQAKSN |
| Ga0210143_10347042 | 3300025792 | Natural And Restored Wetlands | PHERERDQFGGDLPHLYARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAAQKAKGN |
| Ga0207649_111861251 | 3300025920 | Corn Rhizosphere | QFGGDLPHLYARKDVSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN |
| Ga0207687_109850552 | 3300025927 | Miscanthus Rhizosphere | RDQFGGDLPHLYARKDVSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN |
| Ga0207701_107522103 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | GDLPHLYARKDLSDDFKRKMLYDNPVRFYRFGEGDIAAAKKAKGN |
| Ga0207679_103117841 | 3300025945 | Corn Rhizosphere | GGDLPHLYARKDLTDDFKRKMLYDNPVRFYRFSEGDIAAARKARAN |
| Ga0207639_111383801 | 3300026041 | Corn Rhizosphere | PHLYARKDVSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN |
| Ga0207702_100579405 | 3300026078 | Corn Rhizosphere | LYARKDVSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN |
| Ga0209158_13256011 | 3300026333 | Soil | ERDQFGGDLPHLKARKDLSDEFKRKMLYDNPVRFYRFSEGDIAAATKAKSS |
| Ga0209896_10463161 | 3300027006 | Groundwater Sand | RRRGGGRLRRRDQFGGDLPHLMARKDLSEEIKQKMLFDNPVRFYRFSEGDIAAVKKRG |
| Ga0209842_10021021 | 3300027379 | Groundwater Sand | QFGGDLPHLMARKDLSEEIKQKMLFDNPVRFYRFSEGDIAAVKKPGRTRKSLFRL |
| Ga0209874_10483682 | 3300027577 | Groundwater Sand | KDLSEEIKQKMLFDNPVRFYRFSEGDIAAVKKARGK |
| Ga0208665_101721291 | 3300027715 | Deep Subsurface | DFPRERERDQFGGDLPTLKARKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARKAKGN |
| Ga0209726_101538571 | 3300027815 | Groundwater | LKARKDLSDEFKRKMLCDNPVRFYRLSEGDIAAARKAKGN |
| Ga0209486_100165195 | 3300027886 | Agricultural Soil | VCQPRDQVSVDLPHLKARKDLSDDFKRKMLSDNPVRFYRFSEGDIAAARKAKGA |
| Ga0207428_100861741 | 3300027907 | Populus Rhizosphere | GGDLPHLYARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAARKAKPN |
| Ga0209382_102341601 | 3300027909 | Populus Rhizosphere | PHERERDQFGGDLPHLYARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAARKAKPN |
| Ga0209382_110489863 | 3300027909 | Populus Rhizosphere | LPTLKARKDLTDEFKRKMLYDNPVRFYRFSEGDIAAARKMKGN |
| Ga0268386_107679041 | 3300030619 | Soil | LPHLYARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAAQKAKGS |
| Ga0307408_1010076801 | 3300031548 | Rhizosphere | GDLPHLRARKDLSEEFKNKMLFDNPVRFYHLSEGDIAAARKAKGN |
| Ga0307473_108098041 | 3300031820 | Hardwood Forest Soil | ERERDQFGGDLPHLMARKDLSEEFKQKMLYDNPVRFYRFSEGDIAAVRGAKGN |
| Ga0306925_122653992 | 3300031890 | Soil | DFPHERERDQFGGDLPHLIARKDLSDEFKQKMLFDNPVRFYRFSEGDIAALKKAKGI |
| Ga0214473_101190095 | 3300031949 | Soil | MARKDLSDEFKRKMLYDNPVRFYRFSERDIAAVKKAKGN |
| Ga0307411_106871131 | 3300032005 | Rhizosphere | LPHLRARKDLSDEFKNKMLFDNPVRFYHLNEGDIAAARKAKGN |
| Ga0335084_101124081 | 3300033004 | Soil | VALHSALERDQFGGDLPHLMARKDLTDDFKNKMLCDNPVRFYRLSEGDIAAARKAKGK |
| Ga0214472_101767481 | 3300033407 | Soil | MAREDLSDEFKRKMLYDNPVRFYRFSEGDIAAVKKAKGN |
| Ga0214472_110845692 | 3300033407 | Soil | MARKDLSDEFKRKMLYDNPVRFYRFSEGDIAAVKKAKGN |
| Ga0316619_122147492 | 3300033414 | Soil | DLTDEFRKKMLCDNPVRFYRLSEGDIAAARKAKGN |
| Ga0316624_103364693 | 3300033486 | Soil | DLPHLYARKDLTDDFKRKMLYDNPMRFYRLSEGDIAAAKKAKGN |
| Ga0247830_100846563 | 3300033551 | Soil | GGDLPHLRARKDLSEEFKSKMLFDNPVRFYHLSEGDIAAARKTKVN |
| Ga0364933_104248_599_718 | 3300034150 | Sediment | YARKDLSDEFKRKMLYDNPVRFYRFSEGDIAAVKKAKGN |
| Ga0364934_0119313_880_993 | 3300034178 | Sediment | RPDLSDEIKQKIVYDNPARFYRLGEGDIAAVKRAKGS |
| ⦗Top⦘ |