NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F028332

Metagenome / Metatranscriptome Family F028332

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F028332
Family Type Metagenome / Metatranscriptome
Number of Sequences 192
Average Sequence Length 47 residues
Representative Sequence GGDLPHLKARKDLSDEFKRKMLYDNPVRFYRFSEGDIAAARKAKAN
Number of Associated Samples 162
Number of Associated Scaffolds 192

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 5.21 %
% of genes near scaffold ends (potentially truncated) 85.42 %
% of genes from short scaffolds (< 2000 bps) 84.38 %
Associated GOLD sequencing projects 156
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.542 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(10.417 % of family members)
Environment Ontology (ENVO) Unclassified
(30.729 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(36.979 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.49%    β-sheet: 0.00%    Coil/Unstructured: 63.51%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 192 Family Scaffolds
PF07883Cupin_2 8.85
PF09084NMT1 7.29
PF02604PhdYeFM_antitox 6.77
PF04909Amidohydro_2 5.73
PF05016ParE_toxin 4.17
PF04321RmlD_sub_bind 2.60
PF14137DUF4304 2.08
PF03241HpaB 2.08
PF03796DnaB_C 1.56
PF00903Glyoxalase 1.04
PF13343SBP_bac_6 1.04
PF02776TPP_enzyme_N 1.04
PF02775TPP_enzyme_C 1.04
PF13485Peptidase_MA_2 1.04
PF01527HTH_Tnp_1 0.52
PF00483NTP_transferase 0.52
PF00361Proton_antipo_M 0.52
PF13676TIR_2 0.52
PF08241Methyltransf_11 0.52
PF13683rve_3 0.52
PF01381HTH_3 0.52
PF00355Rieske 0.52
PF12706Lactamase_B_2 0.52
PF14355Abi_C 0.52
PF08479POTRA_2 0.52
PF13488Gly-zipper_Omp 0.52
PF01979Amidohydro_1 0.52
PF14267DUF4357 0.52
PF13432TPR_16 0.52
PF13847Methyltransf_31 0.52
PF04471Mrr_cat 0.52

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 192 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 7.29
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 7.29
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 6.77
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 6.77
COG0451Nucleoside-diphosphate-sugar epimeraseCell wall/membrane/envelope biogenesis [M] 5.21
COG0702Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domainsGeneral function prediction only [R] 5.21
COG1086NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsCCell wall/membrane/envelope biogenesis [M] 5.21
COG1087UDP-glucose 4-epimeraseCell wall/membrane/envelope biogenesis [M] 2.60
COG1088dTDP-D-glucose 4,6-dehydrataseCell wall/membrane/envelope biogenesis [M] 2.60
COG1089GDP-D-mannose dehydrataseCell wall/membrane/envelope biogenesis [M] 2.60
COG1090NAD dependent epimerase/dehydratase family enzymeGeneral function prediction only [R] 2.60
COG1091dTDP-4-dehydrorhamnose reductaseCell wall/membrane/envelope biogenesis [M] 2.60
COG2368Aromatic ring hydroxylaseSecondary metabolites biosynthesis, transport and catabolism [Q] 2.08
COG0305Replicative DNA helicaseReplication, recombination and repair [L] 1.56
COG1066DNA repair protein RadA/Sms, contains AAA+ ATPase domainReplication, recombination and repair [L] 1.56


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.06 %
UnclassifiedrootN/A10.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664021|ICCgaii200_c0547605All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101388748All Organisms → cellular organisms → Bacteria → Proteobacteria1482Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101575228All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300000559|F14TC_102495365All Organisms → cellular organisms → Bacteria → Proteobacteria1236Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10135554All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300000787|JGI11643J11755_11126843All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300000787|JGI11643J11755_11509117All Organisms → cellular organisms → Bacteria → Proteobacteria561Open in IMG/M
3300000953|JGI11615J12901_11649930All Organisms → cellular organisms → Bacteria → Proteobacteria581Open in IMG/M
3300000956|JGI10216J12902_108424730All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300000956|JGI10216J12902_113615204All Organisms → cellular organisms → Bacteria2172Open in IMG/M
3300000956|JGI10216J12902_120930321Not Available564Open in IMG/M
3300000956|JGI10216J12902_124812827Not Available630Open in IMG/M
3300001372|YBBDRAFT_1076462All Organisms → cellular organisms → Bacteria1441Open in IMG/M
3300002155|JGI24033J26618_1049753All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300003324|soilH2_10115290All Organisms → cellular organisms → Bacteria2538Open in IMG/M
3300004050|Ga0055491_10174674All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium573Open in IMG/M
3300004070|Ga0055488_10192155All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300004114|Ga0062593_100212829All Organisms → cellular organisms → Bacteria1554Open in IMG/M
3300004463|Ga0063356_100887699All Organisms → cellular organisms → Bacteria1257Open in IMG/M
3300004480|Ga0062592_102453588Not Available524Open in IMG/M
3300004779|Ga0062380_10121894All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300005166|Ga0066674_10147667Not Available1108Open in IMG/M
3300005289|Ga0065704_10617963All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300005294|Ga0065705_10157890All Organisms → cellular organisms → Bacteria1831Open in IMG/M
3300005332|Ga0066388_107021651All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300005340|Ga0070689_101902608All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium543Open in IMG/M
3300005458|Ga0070681_10146030All Organisms → cellular organisms → Bacteria2294Open in IMG/M
3300005471|Ga0070698_101296040All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300005546|Ga0070696_100485717All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira980Open in IMG/M
3300005546|Ga0070696_100901842All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium733Open in IMG/M
3300005549|Ga0070704_102194719Not Available513Open in IMG/M
3300005575|Ga0066702_10880284All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300005617|Ga0068859_101247246All Organisms → cellular organisms → Bacteria → Proteobacteria819Open in IMG/M
3300005617|Ga0068859_102209114All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium607Open in IMG/M
3300005713|Ga0066905_100582416All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300005719|Ga0068861_100618599All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300005764|Ga0066903_107674850All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300005836|Ga0074470_10421504All Organisms → cellular organisms → Bacteria → Proteobacteria3314Open in IMG/M
3300006163|Ga0070715_10611437All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300006844|Ga0075428_100791005All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1008Open in IMG/M
3300006845|Ga0075421_100709089All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1168Open in IMG/M
3300006847|Ga0075431_100903489All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300006854|Ga0075425_101480484All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae767Open in IMG/M
3300006865|Ga0073934_10155285All Organisms → cellular organisms → Bacteria1623Open in IMG/M
3300006871|Ga0075434_100950639All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300006876|Ga0079217_10057896All Organisms → cellular organisms → Bacteria1586Open in IMG/M
3300006876|Ga0079217_10248265All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae948Open in IMG/M
3300006876|Ga0079217_10326376All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium865Open in IMG/M
3300006880|Ga0075429_100664102Not Available913Open in IMG/M
3300006904|Ga0075424_100501452All Organisms → cellular organisms → Bacteria1296Open in IMG/M
3300006954|Ga0079219_10431131All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300006969|Ga0075419_10352713All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300006969|Ga0075419_10679398All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300007004|Ga0079218_10214206All Organisms → cellular organisms → Bacteria1484Open in IMG/M
3300007255|Ga0099791_10415029All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300009094|Ga0111539_11581838All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300009100|Ga0075418_10020653All Organisms → cellular organisms → Bacteria7258Open in IMG/M
3300009100|Ga0075418_12463251All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300009147|Ga0114129_10979747All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300009147|Ga0114129_12180533Not Available667Open in IMG/M
3300009156|Ga0111538_13145490Not Available575Open in IMG/M
3300009162|Ga0075423_10780814All Organisms → cellular organisms → Bacteria1010Open in IMG/M
3300009162|Ga0075423_12441278All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300009171|Ga0105101_10612915All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium541Open in IMG/M
3300009176|Ga0105242_12000058Not Available622Open in IMG/M
3300009597|Ga0105259_1171223All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium529Open in IMG/M
3300009678|Ga0105252_10202820All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium850Open in IMG/M
3300009811|Ga0105084_1093270Not Available563Open in IMG/M
3300009817|Ga0105062_1031005Not Available934Open in IMG/M
3300010042|Ga0126314_10685240All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300010046|Ga0126384_12265272All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300010047|Ga0126382_11204530All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300010166|Ga0126306_10672342All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300010376|Ga0126381_102860988All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300010391|Ga0136847_10254818All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2648Open in IMG/M
3300010400|Ga0134122_10180790Not Available1736Open in IMG/M
3300010400|Ga0134122_10696052Not Available954Open in IMG/M
3300010401|Ga0134121_11048068All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300010401|Ga0134121_12120533All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium597Open in IMG/M
3300010403|Ga0134123_13534298All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium506Open in IMG/M
3300011436|Ga0137458_1157155All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300011437|Ga0137429_1212283Not Available603Open in IMG/M
3300012040|Ga0137461_1000090All Organisms → cellular organisms → Bacteria18894Open in IMG/M
3300012040|Ga0137461_1109125All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae796Open in IMG/M
3300012040|Ga0137461_1154117All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium675Open in IMG/M
3300012041|Ga0137430_1076211Not Available930Open in IMG/M
3300012175|Ga0137321_1113324All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium610Open in IMG/M
3300012202|Ga0137363_11576401All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatibacillum → Desulfatibacillum aliphaticivorans548Open in IMG/M
3300012232|Ga0137435_1042229All Organisms → cellular organisms → Bacteria1332Open in IMG/M
3300012349|Ga0137387_10923107All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300012349|Ga0137387_11085877All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatibacillum → Desulfatibacillum aliphaticivorans571Open in IMG/M
3300012353|Ga0137367_10144821All Organisms → cellular organisms → Bacteria1736Open in IMG/M
3300012354|Ga0137366_10039498All Organisms → cellular organisms → Bacteria3655Open in IMG/M
3300012355|Ga0137369_10332232Not Available1116Open in IMG/M
3300012479|Ga0157348_1024357All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300012499|Ga0157350_1018134All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300012501|Ga0157351_1014241All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300012910|Ga0157308_10138302All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300012915|Ga0157302_10034045All Organisms → cellular organisms → Bacteria1362Open in IMG/M
3300012925|Ga0137419_11676239All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium RBG_16_51_14542Open in IMG/M
3300012927|Ga0137416_10737815All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300012929|Ga0137404_10886351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria813Open in IMG/M
3300012929|Ga0137404_11431887All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300012931|Ga0153915_11450465All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium802Open in IMG/M
3300012944|Ga0137410_10816609All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300012960|Ga0164301_10000639All Organisms → cellular organisms → Bacteria10417Open in IMG/M
3300012961|Ga0164302_10002407All Organisms → cellular organisms → Bacteria6190Open in IMG/M
3300012972|Ga0134077_10025208Not Available2077Open in IMG/M
3300012989|Ga0164305_11220224All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300013297|Ga0157378_10127895All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae2349Open in IMG/M
3300013308|Ga0157375_11072944All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium PBB5942Open in IMG/M
3300014268|Ga0075309_1037082All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium1087Open in IMG/M
3300014300|Ga0075321_1073830All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300014311|Ga0075322_1099046All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300014864|Ga0180068_1061644All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera → Ephemera danica624Open in IMG/M
3300014873|Ga0180066_1002588All Organisms → cellular organisms → Bacteria2567Open in IMG/M
3300014873|Ga0180066_1015839All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1342Open in IMG/M
3300015255|Ga0180077_1012956All Organisms → cellular organisms → Bacteria1419Open in IMG/M
3300015264|Ga0137403_11135675All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300015371|Ga0132258_10633192All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2688Open in IMG/M
3300015372|Ga0132256_100202917All Organisms → cellular organisms → Bacteria2030Open in IMG/M
3300015373|Ga0132257_100161842All Organisms → cellular organisms → Bacteria → Proteobacteria2630Open in IMG/M
3300015373|Ga0132257_100384842All Organisms → cellular organisms → Bacteria1702Open in IMG/M
3300015373|Ga0132257_100409372All Organisms → cellular organisms → Bacteria1650Open in IMG/M
3300017654|Ga0134069_1359760Not Available524Open in IMG/M
3300017936|Ga0187821_10089192All Organisms → cellular organisms → Bacteria1129Open in IMG/M
3300018028|Ga0184608_10188096All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300018031|Ga0184634_10382204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria645Open in IMG/M
3300018052|Ga0184638_1051079All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium1505Open in IMG/M
3300018053|Ga0184626_10017301All Organisms → cellular organisms → Bacteria2898Open in IMG/M
3300018063|Ga0184637_10183504All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1286Open in IMG/M
3300018063|Ga0184637_10702430All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300018075|Ga0184632_10017851All Organisms → cellular organisms → Bacteria2989Open in IMG/M
3300018077|Ga0184633_10465212All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300018078|Ga0184612_10033031All Organisms → cellular organisms → Bacteria2678Open in IMG/M
3300018079|Ga0184627_10073545All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1789Open in IMG/M
3300018081|Ga0184625_10189127All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1079Open in IMG/M
3300018082|Ga0184639_10070902All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1820Open in IMG/M
3300018082|Ga0184639_10555103All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300018082|Ga0184639_10599722Not Available540Open in IMG/M
3300018083|Ga0184628_10624791All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium543Open in IMG/M
3300018084|Ga0184629_10103988All Organisms → cellular organisms → Bacteria1393Open in IMG/M
3300018084|Ga0184629_10192299All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii1052Open in IMG/M
3300018089|Ga0187774_10702899All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300018422|Ga0190265_10328326All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1610Open in IMG/M
3300018422|Ga0190265_12428987All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300018429|Ga0190272_11522825All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300018432|Ga0190275_12955385All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300018465|Ga0190269_11854701All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300018468|Ga0066662_11324715All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii740Open in IMG/M
3300018469|Ga0190270_11823038All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium664Open in IMG/M
3300018476|Ga0190274_12188451All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium650Open in IMG/M
3300019356|Ga0173481_10251440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. ITM-2016-00317796Open in IMG/M
3300020186|Ga0163153_10029140All Organisms → cellular organisms → Bacteria4208Open in IMG/M
3300021081|Ga0210379_10057007All Organisms → cellular organisms → Bacteria1568Open in IMG/M
3300021082|Ga0210380_10120323All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1168Open in IMG/M
3300021082|Ga0210380_10272898All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium768Open in IMG/M
3300021332|Ga0210339_1725775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Deinococcales → Deinococcaceae → Deinococcus → Deinococcus yavapaiensis → Deinococcus yavapaiensis KR-236813Open in IMG/M
3300022756|Ga0222622_10636130All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300025537|Ga0210061_1074722All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300025567|Ga0210076_1003159All Organisms → cellular organisms → Bacteria3945Open in IMG/M
3300025792|Ga0210143_1034704All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium883Open in IMG/M
3300025920|Ga0207649_11186125All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300025927|Ga0207687_10985055All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300025930|Ga0207701_10752210All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300025945|Ga0207679_10311784All Organisms → cellular organisms → Bacteria1360Open in IMG/M
3300026041|Ga0207639_11138380All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300026078|Ga0207702_10057940All Organisms → cellular organisms → Bacteria3295Open in IMG/M
3300026333|Ga0209158_1325601All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium531Open in IMG/M
3300027006|Ga0209896_1046316All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium502Open in IMG/M
3300027379|Ga0209842_1002102All Organisms → cellular organisms → Bacteria3970Open in IMG/M
3300027577|Ga0209874_1048368Not Available1109Open in IMG/M
3300027715|Ga0208665_10172129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria680Open in IMG/M
3300027815|Ga0209726_10153857All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii1279Open in IMG/M
3300027886|Ga0209486_10016519All Organisms → cellular organisms → Bacteria3392Open in IMG/M
3300027907|Ga0207428_10086174All Organisms → cellular organisms → Bacteria → Proteobacteria2445Open in IMG/M
3300027909|Ga0209382_10234160All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium2092Open in IMG/M
3300027909|Ga0209382_11048986All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300030619|Ga0268386_10767904All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium620Open in IMG/M
3300031548|Ga0307408_101007680All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300031820|Ga0307473_10809804All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300031890|Ga0306925_12265399All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300031949|Ga0214473_10119009All Organisms → cellular organisms → Bacteria3084Open in IMG/M
3300032005|Ga0307411_10687113All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300033004|Ga0335084_10112408All Organisms → cellular organisms → Bacteria2832Open in IMG/M
3300033407|Ga0214472_10176748All Organisms → cellular organisms → Bacteria2078Open in IMG/M
3300033407|Ga0214472_11084569All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300033414|Ga0316619_12214749Not Available503Open in IMG/M
3300033486|Ga0316624_10336469All Organisms → cellular organisms → Bacteria1238Open in IMG/M
3300033551|Ga0247830_10084656All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2192Open in IMG/M
3300034150|Ga0364933_104248All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium PBB5719Open in IMG/M
3300034178|Ga0364934_0119313All Organisms → cellular organisms → Bacteria995Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.42%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment8.85%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil7.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.29%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.77%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.12%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.60%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.60%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.60%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand2.60%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.08%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.56%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.56%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.56%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.56%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.56%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.04%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.04%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.04%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.04%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.04%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.04%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.04%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.04%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.04%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.52%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.52%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.52%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.52%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.52%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.52%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.52%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.52%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine0.52%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.52%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.52%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.52%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.52%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.52%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.52%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.52%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.52%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.52%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.52%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.52%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.52%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.52%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.52%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.52%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.52%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.52%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001372YB-Back-sedEnvironmentalOpen in IMG/M
3300002155Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7Host-AssociatedOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004050Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2EnvironmentalOpen in IMG/M
3300004070Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004779Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3FreshEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009171Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009597Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299EnvironmentalOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300009811Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30EnvironmentalOpen in IMG/M
3300009817Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011436Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2EnvironmentalOpen in IMG/M
3300011437Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2EnvironmentalOpen in IMG/M
3300012040Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2EnvironmentalOpen in IMG/M
3300012041Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2EnvironmentalOpen in IMG/M
3300012175Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT399_2EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012232Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2EnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012479Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.yng.030610EnvironmentalOpen in IMG/M
3300012499Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610EnvironmentalOpen in IMG/M
3300012501Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014268Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1EnvironmentalOpen in IMG/M
3300014300Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1EnvironmentalOpen in IMG/M
3300014311Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1EnvironmentalOpen in IMG/M
3300014864Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231A'_16_10DEnvironmentalOpen in IMG/M
3300014873Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10DEnvironmentalOpen in IMG/M
3300015255Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT466_16_10DEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300020186Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021332Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.384 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025537Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025567Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025792Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300027006Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027379Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027577Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027715Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes)EnvironmentalOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICCgaii200_054760512228664021SoilHLXARKDLSDEFKNKMLFDNPVRFYRLSEGDIAAARKAKGN
INPhiseqgaiiFebDRAFT_10138874813300000364SoilFPHERERDQFGGDLPHLMARNDLSDEIKQKMLFDNPVRFYRFSEGDIAAVRKAKGN*
INPhiseqgaiiFebDRAFT_10157522823300000364SoilERDQFGGDLPHLMARKDLSDEIKQKMLFDNPVRFYRFSEVDIAAVKKAKGT*
F14TC_10249536513300000559SoilLKARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAARKAKGN*
AF_2010_repII_A1DRAFT_1013555423300000597Forest SoilGDLPHLMARKDLSDEIKQKMLYDNPVRFYRFTEGDIAAVKKAKGN*
JGI11643J11755_1112684313300000787SoilQFGGDLPHLKARKDLTDDFKRKMLYDNPVRFYRFSEGDIAAARKAKSN*
JGI11643J11755_1150911723300000787SoilFGGDLPTLKARKDLTDDFRKKMLCDNPVRFYRLSEGDIAAARKAKGN*
JGI11615J12901_1164993023300000953SoilDQFGGDLPTLKARKDLTDDFRKKMLCDNPVRFYRLSEGDIAAGRKAKGN*
JGI10216J12902_10842473033300000956SoilDFPHERERDQFGGDLPALKARKDLTDEFKRKMLYDNPVRFYRFSEGDIAAARKANGS*
JGI10216J12902_11361520433300000956SoilQFGGDLPHLKARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAARKTKGN*
JGI10216J12902_12093032123300000956SoilKARKDLTDEFKKKMLCDNPVRFYRLSEGDIAAARKAKGS*
JGI10216J12902_12481282723300000956SoilKARKDLTDEFKKKMLCDNPVRFYRLEGDIAAARKAK*
YBBDRAFT_107646243300001372Marine EstuarineVLRDFLAERERDQFGGDLPTLKARKDLTDEFRKKMLCDNPVRFYRLSEGEIAAARKARGN
JGI24033J26618_104975333300002155Corn, Switchgrass And Miscanthus RhizosphereRERDQFGGDLPHLYARKDVSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN*
soilH2_1011529033300003324Sugarcane Root And Bulk SoilPHLYARKDLSDDFKRKMLYDNPVRFYRFTEGDIAAARKAKGN*
Ga0055491_1017467423300004050Natural And Restored WetlandsPTLKARKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARKAKGK*
Ga0055488_1019215523300004070Natural And Restored WetlandsHLMARKDLSDEIKQKLLFDNPVRFYRFSEGDIAAVRKAKGK*
Ga0062593_10021282933300004114SoilQFGGDLPHLYARKDVSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN*
Ga0063356_10088769923300004463Arabidopsis Thaliana RhizospherePTLKARKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARKAKES*
Ga0062592_10245358813300004480SoilHLKARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAARKAKTS*
Ga0062380_1012189413300004779Wetland SedimentDLPTLKARKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARNARGN*
Ga0066674_1014766723300005166SoilHERERDQFGGDLPHLKARNDLSDGFKRKMLYDNPVRFYRFSEGDIAAARKAKGN*
Ga0065704_1061796323300005289Switchgrass RhizosphereDQFGGDLPHLYARKDVSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN*
Ga0065705_1015789013300005294Switchgrass RhizosphereRERDQFGGDLPHLYARKDLSEEFKRKMLYDNPVRFYRFSEGDVAAVRKAKGN*
Ga0066388_10702165113300005332Tropical Forest SoilHLMARKDLSDEIKQKMLYDNPVRFYRFTEGDIAAVKKAKGN*
Ga0070689_10190260813300005340Switchgrass RhizosphereMNAAFGSDLPHLKARKDLSDDFKRKMLYDNAVGSIVFSEGDIAAAGKAKKAGFNI*
Ga0070681_1014603043300005458Corn RhizosphereDLPHLYARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAARQAKGT*
Ga0070698_10129604013300005471Corn, Switchgrass And Miscanthus RhizosphereFGGDLPHLKARKDLSDEFKRKMLYDNPVRFYRFSEGDIAAVKKARGN*
Ga0070696_10048571733300005546Corn, Switchgrass And Miscanthus RhizosphereLPPRDQFGGYLPTLKARKDLTDEFKKKILYDNPVRFYRFSESDIDAVRKAKGS*
Ga0070696_10090184213300005546Corn, Switchgrass And Miscanthus RhizosphereMNAAFGSDLPHLKARKDLSDDFKRKMLYDNAVGSIVFSEGDIAAAGKAKESWLNI*
Ga0070704_10219471923300005549Corn, Switchgrass And Miscanthus RhizosphereLPPRDQFGGYLPTLKARKDLTDEFKKKILYDNPVRFYRFSESD
Ga0066702_1088028413300005575SoilERERDQFGGDLPHFVGRKDLSEETKQKILFDNPTRFYRLSEADIAAVKKSRGN*
Ga0068859_10124724613300005617Switchgrass RhizosphereTLKARKDLTDDFRKKMLCDNPVRFYRLSEGDIAAARKAKG*
Ga0068859_10220911423300005617Switchgrass RhizosphereMNAAIGSDLPHLKARKDLSDDFKRKMLYDNAVGSIVFSEGDIAAAGKAKEAGFNI*
Ga0066905_10058241613300005713Tropical Forest SoilERDQFGGDLPHLMARKDLSDEIKQKMLYDNPVRFYRFSEGDIAAVKKAKGN*
Ga0068861_10061859933300005719Switchgrass RhizosphereYARKDLSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN*
Ga0066903_10767485013300005764Tropical Forest SoilARKDLSDEIKQKMLYDNPVRFYRFTEGDIAAVKKAKGN*
Ga0074470_1042150443300005836Sediment (Intertidal)VLRDFLAERERDQFGGDLPTLKARKDLTDEFRKKMLCDNPVRFYRLSEGEIAAARKAGGN
Ga0070715_1061143723300006163Corn, Switchgrass And Miscanthus RhizospherePHERERDQFGGDLPHLMARKDLSDEIKQKMLFDNPVRFYRFSEGDIAAVKKAKGT*
Ga0075428_10079100513300006844Populus RhizosphereKDLSDDFKRKMLYDNPVRFYRFSEGDIAAARKAKPN*
Ga0075421_10070908913300006845Populus RhizospherePHERERDQFGGDLPHLYARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAARKAKPN*
Ga0075431_10090348943300006847Populus RhizospherePTLKARKDLTDEFKRKMLYDNPVRFYRFSEGDIAAARKMKGN*
Ga0075425_10148048413300006854Populus RhizosphereQFGGDLPHLYARKDLTDDFKRKMLYDNPVRFYRFSEGDIAAVRKAKGN*
Ga0073934_1015528533300006865Hot Spring SedimentFGGDLPHLRARKDLSDDFRRKILYDNPVRFYRFSEGDIGAARKAK*
Ga0075434_10095063913300006871Populus RhizospherePHLMARKDLSDEFKQKMLYDNPVRFYRFSEGDIAAVRKAKGN*
Ga0079217_1005789613300006876Agricultural SoilQFGGDLPHLKARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAVRKEKGS*
Ga0079217_1024826533300006876Agricultural SoilQFGGDLPHLKARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAAKKAKGN*
Ga0079217_1032637613300006876Agricultural SoilVAVCQPRDQVSVDLPHLKARKDLSDDFKRKMLSDNPVRFYRFSEGDIAAARKAKGA*
Ga0075429_10066410213300006880Populus RhizosphereDLPHLYARKDLSDDFKRKMLYDNPVRFYRFGEGDIAAARKAKGN*
Ga0075424_10050145223300006904Populus RhizosphereFGGDLPHLMARKDLSDEFKQKMLYDNPVRFYRFSEGDIAAVRKAKGN*
Ga0079219_1043113113300006954Agricultural SoilHERERDQFGGDLPHLYARKDLSEEFKRKMLYDNPVRFYRFSEGDVAAARKARTH*
Ga0075419_1035271323300006969Populus RhizosphereDLSEEFKQKMLYDNPVRFYRFSEGDIAAVRRAKGN*
Ga0075419_1067939813300006969Populus RhizosphereGGDLPHLRARKDLSDEFKNKMLFDNPVRFYRLSEGDIAAARKAKGN*
Ga0079218_1021420623300007004Agricultural SoilVCQPRDQVSVDLPHLKARKDLSDDFKRKMLSDNPVRFYRFSEGDIAAARKAKGA*
Ga0099791_1041502923300007255Vadose Zone SoilKDLSEEFKQKMLYDNPVRFYRFSDDDIAAVRRAKGN*
Ga0111539_1158183823300009094Populus RhizosphereASDFPHERERDQFGGDLPDLRACKDLSDEFKNKMLFDNPVRFYHLNEGDIAAARKAKGN*
Ga0075418_10020653113300009100Populus RhizosphereGDLPHLYARKDLSDDFKRKMLYDNPVRFYRFGEGDIAAARKAKGN*
Ga0075418_1246325113300009100Populus RhizosphereLSEEFKRKMLYDNPVRFYRFSEGDIAAARKARTN*
Ga0114129_1097974713300009147Populus RhizosphereGGDLPHLRARKDLSEEFKSKMLFDNPVRFYHLSEGDIAAARKAKGN*
Ga0114129_1218053323300009147Populus RhizosphereDQFGGDLPHLYARKDLSDDFKRKMLYDNPVRFYRFGEGDIAAARKAKGN*
Ga0111538_1314549013300009156Populus RhizosphereQFKGDLPHLYARKDLSDDFKRKMLYDNPVRFYRFGEGDIAAARKAKGN*
Ga0075423_1078081413300009162Populus RhizosphereHERERDQFGGDLPHLKARKDLSDEFKRKMLYDNPVRFYRFSEGDIAAARKAKAN*
Ga0075423_1244127813300009162Populus RhizosphereLPHLYARKDLSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN*
Ga0105101_1061291513300009171Freshwater SedimentRDQFGGDLPTLKARKDLTDEFRKKMLCDNPVRFYRLSEGDIAAAKRAKGN*
Ga0105242_1200005823300009176Miscanthus RhizosphereDLSDEFKDKMLCGNPVRFYRFSEGDIAAARKAKGN*
Ga0105259_117122313300009597SoilLNARKDLTDEFKRKMLYDNPVRFYRFNEGDIAAARKAKGS*
Ga0105252_1020282023300009678SoilSDFPHERERDQFGGDLPHLMARKDLSEEIKQKMLFDNPVRFYRFSEGDIAAVKKARGN*
Ga0105084_109327013300009811Groundwater SandHERERDQFGGDLPHLMERRDLSEEIKQKMLFDNPVRFYRFSEGDIAAVKKARGK*
Ga0105062_103100523300009817Groundwater SandPHLMARKDLSEEIKQKMLFDNPVRFYRFSEGDIAAVKKARGK*
Ga0126314_1068524013300010042Serpentine SoilFGGDLPHLKARKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARTAKAD*
Ga0126384_1226527213300010046Tropical Forest SoilLSDEIKQKMLYDNPVRFYRFTEGDIAAVKKAKGN*
Ga0126382_1120453013300010047Tropical Forest SoilRERDQFGGDLPHLMARKDLSDEIKQKMLYDNPVRFYRFSEGDIAAVKKAKRN*
Ga0126306_1067234213300010166Serpentine SoilGGDLPHLKARQDLSDEFKDKMLFDNPVRFYRLSEGDIAAAKKAKGN*
Ga0126381_10286098813300010376Tropical Forest SoilKDLSDEIEQKMLYDNPVRFYRFTEGDIAAVKKAKGN*
Ga0136847_1025481843300010391Freshwater SedimentDQFGGDLLHLMARKDLSDEIKQKIVYDNPVRFYRFSEGDIAAVKRSRRN*
Ga0134122_1018079013300010400Terrestrial SoilHERERDQFGGDLPTLKARKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARKANGK*
Ga0134122_1069605213300010400Terrestrial SoilMSANYQYERERDQFGGDLPTLKARKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARKAKGN
Ga0134121_1104806813300010401Terrestrial SoilKDVSEEFKRKMLYDNPVRFYRFSEGDIAAARNARAN*
Ga0134121_1212053323300010401Terrestrial SoilQFGGDLPHLKARKDLTDEFKNKMLHDNPVRFYRLSEGDVAAARKAKGN*
Ga0134123_1353429813300010403Terrestrial SoilDQFGGDLPHLKARKDLPDDFKRKMLYDNPVRFYRFSEGDIAAARKAKGN*
Ga0137458_115715523300011436SoilVSADYPYECERDQRGGDLPTLKARKDRTDEFRKKMRCDNPVRFYRLSEGDIAAA
Ga0137429_121228323300011437SoilVRKDLTDEFKRKMLCDNTVRFYRFNEGDIAAARKAKGA*
Ga0137461_1000090143300012040SoilLKARKDLTDEFKSKMLCDNPVRLYRLGEGDIAAGRKANVS*
Ga0137461_110912513300012040SoilDFPHERERDQFGGDLPHLKARKDLTDEFKRKMLYDNPVRFYRLGEGDIAAASKAKGN*
Ga0137461_115411723300012040SoilREPDQFGGDLRTLKALKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARKVKGN*
Ga0137430_107621133300012041SoilVRKDLTDEFKRKMLCDNTVRFYRFNEGDIAAARKAKNS*
Ga0137321_111332413300012175SoilLIILWASYFLDERDQFGGDLPHLNARKDLTDEFKRKMLYDNPVRFYRFNEGDIAAARKAKGS*
Ga0137363_1157640113300012202Vadose Zone SoilKDLSDEFKQKMLYDNPVRFYRFSEGDIAAVKKAKEN*
Ga0137435_104222913300012232SoilVPARRPRNQFRSDLPHLKARIDLSDEFKRKMLYDNPVRFYRFSEGDIAAARKALGN*
Ga0137387_1092310723300012349Vadose Zone SoilGGDLPHLKARKDLSDEFKRKMLYDNPVRFYRFSEGDIAAARKAKAN*
Ga0137387_1108587713300012349Vadose Zone SoilRERDQFGGDLPHLMGRKDLSDETKQKILFDNPVRFYRFSEGDIAAVKQAQQNSNR*
Ga0137367_1014482133300012353Vadose Zone SoilRKDLSEEFKQKMLYDNPVRFYRFSEGDIAAVRRAKGN*
Ga0137366_1003949813300012354Vadose Zone SoilDFPHERERDQFGGDLPHLKARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAARKAKGN*
Ga0137369_1033223213300012355Vadose Zone SoilPHLKARKDLSDEFKRKMLYDNPVRFYRFTEGDIAAAKKAKSS*
Ga0157348_102435723300012479Unplanted SoilLTLAITGERDQFGGDLPHLYARKDLTDDFKRKMLYDNPVRFYRFSEGDIAAVRKAKGN*
Ga0157350_101813413300012499Unplanted SoilDLSEEFKRKMLYDNPVRFYRFREGDVAAARKPRTH*
Ga0157351_101424113300012501Unplanted SoilERDQFGGDLPHLYARKDVSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN*
Ga0157308_1013830213300012910SoilHLYARKDVSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN*
Ga0157302_1003404533300012915SoilYARKDVSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN*
Ga0137419_1167623913300012925Vadose Zone SoilLKARKDLSDEFKRKMLYDNPVRFYRFSEGDIAAARKTKGN*
Ga0137416_1073781523300012927Vadose Zone SoilDFPHERERDQFGGDLPHLKARKDLSDEFKRKMLYDNPVRFYRFSEGDIAAARKAKAN*
Ga0137404_1088635133300012929Vadose Zone SoilPHERERDQFGGDLPHLYARKDLSDDFKRKMLYDNPVRFYRFGEGDIVAAKKAKGN*
Ga0137404_1143188723300012929Vadose Zone SoilSDFPHERERDQFGGDLPHLKARKDLSDEFKRKMLYDNPVRFYRFSEGDIAVARKAKAN*
Ga0153915_1145046523300012931Freshwater WetlandsVSLWASDFPHERERDQFGDDLAHFMARKDLSEDVRRKILFDNPVRFDRFNKGDMAAVRKTKGK*
Ga0137410_1081660923300012944Vadose Zone SoilMARRDLSEEIKQKMLSDNPVRFYRFSEGDIAALKKAKGN*
Ga0164301_1000063913300012960SoilFGGDLPHLYARKDVSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN*
Ga0164302_1000240713300012961SoilRDQFGGDLPHLYARKDVSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN*
Ga0134077_1002520813300012972Grasslands SoilRERDQFGGDLPHLKARNDLSDGFKRKMLYDNPVRFYRFSEGDIAAARKAKGN*
Ga0164305_1122022413300012989SoilLSEEFKQKMLYDNPVRFYRFSEDDIAAVRRAKGN*
Ga0157378_1012789533300013297Miscanthus RhizosphereGERDQFGGDLPHLYARKDLSDDFERKMLYDNPVRFYRFSEGDIAAARKAKPN*
Ga0157375_1107294423300013308Miscanthus RhizosphereRERDQFGGDLPHLYARKDLSDEFKRKMLYDNPVRFYRFSEGDIAAVKKAKGN*
Ga0075309_103708213300014268Natural And Restored WetlandsLYARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAARKAKGN*
Ga0075321_107383013300014300Natural And Restored WetlandsPHLYARKDLPDDFKRKMLYDNPVRFYRLSEGDIAAVRKAKNN*
Ga0075322_109904613300014311Natural And Restored WetlandsHERERDQFGGDLPHLYERKDLSDDFKRKMLYDNPVRFYRLSEGDIAAAKKAK*
Ga0180068_106164413300014864SoilRKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARKAKGN*
Ga0180066_100258813300014873SoilDFPHERERDQFGGDLPHLMARQDLSDEIKQKIVYDNPVRFYRLGEGDIAAVKRAKGN*
Ga0180066_101583933300014873SoilVPRLLVTYLANGELDQFGGDLPYLKARKDLTDEFKRRMLYDNPVRFYRFNEGDIAAVRKAKGS*
Ga0180077_101295633300015255SoilRERDQFGGDLPHLMARKDLSEEIKQKMLFDNPVRFYRFSEGDIAAVKKARGN*
Ga0137403_1113567513300015264Vadose Zone SoilWASDFLYERERDQFGGDLLHLVGRKDLLEETKQKILFDNPTRFYRLSEADIAAVKKSRGN
Ga0132258_1063319213300015371Arabidopsis RhizosphereLRARKDLSDEFKDKMLCGNPVRFYRFSEGDIAAAHKAKGN*
Ga0132256_10020291743300015372Arabidopsis RhizosphereDLSDDFKRKMLYDNPVRFYRFSEGDIAAAKKAKGN*
Ga0132257_10016184243300015373Arabidopsis RhizosphereRDQFGGDLPHLYARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAARKAKPN*
Ga0132257_10038484243300015373Arabidopsis RhizosphereGDLPHLYARKDLSDDFKRKMLYDNPVRFYRFNEGDIAAARKAKSR*
Ga0132257_10040937253300015373Arabidopsis RhizosphereERDQFGGDLPHLYARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAARKAKGN*
Ga0134069_135976013300017654Grasslands SoilPHLKARKDLSDEFKRKMLYDNPVRFYRFTEGDIAAARKAKGN
Ga0187821_1008919243300017936Freshwater SedimentASDFPHERERDQFGGDLPHLYARKDLTDDFKRKMLYDNPMRFYRLSEGDIAAVQKAKHIS
Ga0184608_1018809613300018028Groundwater SedimentKARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAVKKARGN
Ga0184634_1038220423300018031Groundwater SedimentRDQFGGDLPHLKARKDLTDEFKRKMLYDNPVRFYRLGEGDIAAARKAKGI
Ga0184638_105107923300018052Groundwater SedimentMIPGIIKPGRALPKPGQFGGDLPHLKARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAARNAKGN
Ga0184626_1001730123300018053Groundwater SedimentLKARKDLSDEFKRKMLYYNPVRFYRLSEGDIAAARKAKGN
Ga0184637_1018350413300018063Groundwater SedimentKDLSDEFKRKMLCDNPVRFYRFSEGDIAAVRSSRRN
Ga0184637_1070243013300018063Groundwater SedimentKDLSDEFKRKMLCDNPVRFYRFSEGDIAAVRRAKGK
Ga0184632_1001785163300018075Groundwater SedimentSDFPHERERDQFGGDLPHLMARKDLSEEMKQKMLFDNPVRFYRFSEGDIAAVKNARGN
Ga0184633_1046521213300018077Groundwater SedimentPHLKARKDLSDEFKRKMLYDNPVRFYRFTEGDIAAVKKAKGN
Ga0184612_1003303113300018078Groundwater SedimentKDLSDEFKRKMLYDNPVRFYRFSEGDIAAVRKAKGN
Ga0184627_1007354513300018079Groundwater SedimentQFGGDLPHLMARKDLSDEFKRKMLCDNPVRFYRFSEGDIAAVKKSKRN
Ga0184625_1018912743300018081Groundwater SedimentPHERERDQFGGDLPHLYARKDLSDEFKRKMLYDNPVRFYRFSEGDIAAARKAKGN
Ga0184639_1007090213300018082Groundwater SedimentSDFPHERERDQFGGDLPHLMARKDLSDEFKRKMLCDNPVRFYRFSEGDIAAVKKSKRN
Ga0184639_1055510323300018082Groundwater SedimentRERDQFGGDLPHLKARKDLSDEFKRKMLYDNPVRFYRFTEGDIAAVKKAKGN
Ga0184639_1059972213300018082Groundwater SedimentSDFPHERERDQFGGDLPHLMARKDLSDEFKRKMLCDNPVRFYRFSEGDIAAVRRAKGK
Ga0184628_1062479123300018083Groundwater SedimentFPHERERDQFGGDLPTLKGRKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARKAKGS
Ga0184629_1010398833300018084Groundwater SedimentDLPHLMARQDLSDEFKRKMLYDNPVRFYRFGEGDIAAVKKVKGN
Ga0184629_1019229913300018084Groundwater SedimentVPARRPRNQFRGDLPHLKARKDLSEKFKRNMLCDNPVRFYRFNEGDIAAARKAKGV
Ga0187774_1070289913300018089Tropical PeatlandRDLSDEFKRKMLFDNPVRFYRFSEGDIAAVKKATGN
Ga0190265_1032832633300018422SoilMSAFPHERERDQFGGDLPHLKARKDLSDDFKQKMLYDNPVRFYRFSEGDIAAAKTAKSS
Ga0190265_1242898713300018422SoilLPHLMARKDLSDEFKRKMLYDNPVQFYRFSEGDIAAVRKAKGN
Ga0190272_1152282533300018429SoilKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARRAKGN
Ga0190275_1295538513300018432SoilDFPHERERDQFGGDLPHLKARKDLSNEFKNKMLFDNPVRFYHLSEGDIAAAKKAKGN
Ga0190269_1185470123300018465SoilGGDLPHLMARRDLSEEIKQKMLFDNPVRFYRFSEGDIAAVKKAKGN
Ga0066662_1132471533300018468Grasslands SoilMARKDLSEEFKQKMLFDNPVRFYRFNEADIAAVRKAR
Ga0190270_1182303813300018469SoilFPHERERDQFGGDLPTLKGRKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARKARKT
Ga0190274_1218845113300018476SoilRDQFGGDLPHLKARKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARKARGS
Ga0173481_1025144023300019356SoilLRARKDLSDEFKNKMLFDNPVRFYHLNEGDIAAARKAKVN
Ga0163153_1002914073300020186Freshwater Microbial MatMLKARKRLTDEFRKNILHNNPVRLYRRSESDIAAARKAKGS
Ga0210379_1005700723300021081Groundwater SedimentMARQDLSDEFKRKMLYDNPVRFYRFGEGDIAAVKKVKGN
Ga0210380_1012032313300021082Groundwater SedimentVSADYPYERERDQRGGDLPTLRARNDLTDEFGKIILCDNPVRFYRLSESDIATARKAKGN
Ga0210380_1027289823300021082Groundwater SedimentDFPHERERDQFGGDLPTLKGRKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARKARKT
Ga0210339_172577513300021332EstuarineRDQFGGDLRTLKARKDFTDEIRNRMLCDNPVRFYRLSEGNIAAARKAKGN
Ga0222622_1063613013300022756Groundwater SedimentFGGDLPHLMARKDLSDEIKQKMLYDNPVRFYRFNEGDIAAVRRAKGK
Ga0210061_107472223300025537Natural And Restored WetlandsMNPQRFKRKMLYDNPVWFYRFSEGDIAAARQTKGT
Ga0210076_100315913300025567Natural And Restored WetlandsRKDLTEDFKRKMLYDNPVRFYRFSEGDIAAARQAKSN
Ga0210143_103470423300025792Natural And Restored WetlandsPHERERDQFGGDLPHLYARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAAQKAKGN
Ga0207649_1118612513300025920Corn RhizosphereQFGGDLPHLYARKDVSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN
Ga0207687_1098505523300025927Miscanthus RhizosphereRDQFGGDLPHLYARKDVSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN
Ga0207701_1075221033300025930Corn, Switchgrass And Miscanthus RhizosphereGDLPHLYARKDLSDDFKRKMLYDNPVRFYRFGEGDIAAAKKAKGN
Ga0207679_1031178413300025945Corn RhizosphereGGDLPHLYARKDLTDDFKRKMLYDNPVRFYRFSEGDIAAARKARAN
Ga0207639_1113838013300026041Corn RhizospherePHLYARKDVSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN
Ga0207702_1005794053300026078Corn RhizosphereLYARKDVSEEFKRKMLYDNPVRFYRFSEGDIAAARKARAN
Ga0209158_132560113300026333SoilERDQFGGDLPHLKARKDLSDEFKRKMLYDNPVRFYRFSEGDIAAATKAKSS
Ga0209896_104631613300027006Groundwater SandRRRGGGRLRRRDQFGGDLPHLMARKDLSEEIKQKMLFDNPVRFYRFSEGDIAAVKKRG
Ga0209842_100210213300027379Groundwater SandQFGGDLPHLMARKDLSEEIKQKMLFDNPVRFYRFSEGDIAAVKKPGRTRKSLFRL
Ga0209874_104836823300027577Groundwater SandKDLSEEIKQKMLFDNPVRFYRFSEGDIAAVKKARGK
Ga0208665_1017212913300027715Deep SubsurfaceDFPRERERDQFGGDLPTLKARKDLTDEFRKKMLCDNPVRFYRLSEGDIAAARKAKGN
Ga0209726_1015385713300027815GroundwaterLKARKDLSDEFKRKMLCDNPVRFYRLSEGDIAAARKAKGN
Ga0209486_1001651953300027886Agricultural SoilVCQPRDQVSVDLPHLKARKDLSDDFKRKMLSDNPVRFYRFSEGDIAAARKAKGA
Ga0207428_1008617413300027907Populus RhizosphereGGDLPHLYARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAARKAKPN
Ga0209382_1023416013300027909Populus RhizospherePHERERDQFGGDLPHLYARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAARKAKPN
Ga0209382_1104898633300027909Populus RhizosphereLPTLKARKDLTDEFKRKMLYDNPVRFYRFSEGDIAAARKMKGN
Ga0268386_1076790413300030619SoilLPHLYARKDLSDDFKRKMLYDNPVRFYRFSEGDIAAAQKAKGS
Ga0307408_10100768013300031548RhizosphereGDLPHLRARKDLSEEFKNKMLFDNPVRFYHLSEGDIAAARKAKGN
Ga0307473_1080980413300031820Hardwood Forest SoilERERDQFGGDLPHLMARKDLSEEFKQKMLYDNPVRFYRFSEGDIAAVRGAKGN
Ga0306925_1226539923300031890SoilDFPHERERDQFGGDLPHLIARKDLSDEFKQKMLFDNPVRFYRFSEGDIAALKKAKGI
Ga0214473_1011900953300031949SoilMARKDLSDEFKRKMLYDNPVRFYRFSERDIAAVKKAKGN
Ga0307411_1068711313300032005RhizosphereLPHLRARKDLSDEFKNKMLFDNPVRFYHLNEGDIAAARKAKGN
Ga0335084_1011240813300033004SoilVALHSALERDQFGGDLPHLMARKDLTDDFKNKMLCDNPVRFYRLSEGDIAAARKAKGK
Ga0214472_1017674813300033407SoilMAREDLSDEFKRKMLYDNPVRFYRFSEGDIAAVKKAKGN
Ga0214472_1108456923300033407SoilMARKDLSDEFKRKMLYDNPVRFYRFSEGDIAAVKKAKGN
Ga0316619_1221474923300033414SoilDLTDEFRKKMLCDNPVRFYRLSEGDIAAARKAKGN
Ga0316624_1033646933300033486SoilDLPHLYARKDLTDDFKRKMLYDNPMRFYRLSEGDIAAAKKAKGN
Ga0247830_1008465633300033551SoilGGDLPHLRARKDLSEEFKSKMLFDNPVRFYHLSEGDIAAARKTKVN
Ga0364933_104248_599_7183300034150SedimentYARKDLSDEFKRKMLYDNPVRFYRFSEGDIAAVKKAKGN
Ga0364934_0119313_880_9933300034178SedimentRPDLSDEIKQKIVYDNPARFYRLGEGDIAAVKRAKGS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.