Basic Information | |
---|---|
Family ID | F028288 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 192 |
Average Sequence Length | 42 residues |
Representative Sequence | MRIRRTFPIVLAVVAIAAAVTLAVQLRKHAPPEPARLLP |
Number of Associated Samples | 172 |
Number of Associated Scaffolds | 192 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 13.02 % |
% of genes near scaffold ends (potentially truncated) | 99.48 % |
% of genes from short scaffolds (< 2000 bps) | 94.27 % |
Associated GOLD sequencing projects | 163 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.54 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (79.167 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.938 % of family members) |
Environment Ontology (ENVO) | Unclassified (19.792 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.042 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 41.79% β-sheet: 0.00% Coil/Unstructured: 58.21% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 192 Family Scaffolds |
---|---|---|
PF02687 | FtsX | 3.12 |
PF03869 | Arc | 2.60 |
PF12704 | MacB_PCD | 2.60 |
PF07883 | Cupin_2 | 2.60 |
PF00009 | GTP_EFTU | 2.60 |
PF00072 | Response_reg | 2.08 |
PF12681 | Glyoxalase_2 | 1.04 |
PF16694 | Cytochrome_P460 | 1.04 |
PF13442 | Cytochrome_CBB3 | 1.04 |
PF00561 | Abhydrolase_1 | 0.52 |
PF09832 | DUF2059 | 0.52 |
PF12697 | Abhydrolase_6 | 0.52 |
PF02810 | SEC-C | 0.52 |
PF12836 | HHH_3 | 0.52 |
PF07676 | PD40 | 0.52 |
PF13181 | TPR_8 | 0.52 |
PF04238 | DUF420 | 0.52 |
PF01258 | zf-dskA_traR | 0.52 |
PF01833 | TIG | 0.52 |
PF13414 | TPR_11 | 0.52 |
PF02777 | Sod_Fe_C | 0.52 |
PF00491 | Arginase | 0.52 |
PF03551 | PadR | 0.52 |
PF13432 | TPR_16 | 0.52 |
COG ID | Name | Functional Category | % Frequency in 192 Family Scaffolds |
---|---|---|---|
COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.52 |
COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.52 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.52 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.52 |
COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 0.52 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.52 |
COG2322 | Cytochrome oxidase assembly protein CtaM/YozB, DUF420 family | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 79.69 % |
Unclassified | root | N/A | 20.31 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001356|JGI12269J14319_10046788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2630 | Open in IMG/M |
3300001356|JGI12269J14319_10081794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1704 | Open in IMG/M |
3300001471|JGI12712J15308_10094556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
3300001546|JGI12659J15293_10116035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 582 | Open in IMG/M |
3300001593|JGI12635J15846_10153486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1576 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101008005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101037938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
3300004080|Ga0062385_10271374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 957 | Open in IMG/M |
3300005172|Ga0066683_10868782 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300005174|Ga0066680_10906326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
3300005175|Ga0066673_10627831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
3300005186|Ga0066676_10190561 | Not Available | 1312 | Open in IMG/M |
3300005289|Ga0065704_10558071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
3300005331|Ga0070670_100877134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 813 | Open in IMG/M |
3300005406|Ga0070703_10154845 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
3300005434|Ga0070709_11459607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 555 | Open in IMG/M |
3300005435|Ga0070714_100306267 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
3300005456|Ga0070678_100970358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
3300005458|Ga0070681_10440691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1215 | Open in IMG/M |
3300005518|Ga0070699_100515781 | Not Available | 1086 | Open in IMG/M |
3300005541|Ga0070733_10469435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 841 | Open in IMG/M |
3300005547|Ga0070693_100070356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2059 | Open in IMG/M |
3300005552|Ga0066701_10482815 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300005554|Ga0066661_10833872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 539 | Open in IMG/M |
3300005560|Ga0066670_10644539 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300005564|Ga0070664_100513258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1106 | Open in IMG/M |
3300005568|Ga0066703_10090907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1780 | Open in IMG/M |
3300005569|Ga0066705_10225808 | All Organisms → Viruses → Predicted Viral | 1181 | Open in IMG/M |
3300005586|Ga0066691_10894238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
3300005587|Ga0066654_10406519 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300005614|Ga0068856_102418940 | Not Available | 532 | Open in IMG/M |
3300005842|Ga0068858_102401534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 521 | Open in IMG/M |
3300005890|Ga0075285_1001698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2266 | Open in IMG/M |
3300005921|Ga0070766_10980026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 581 | Open in IMG/M |
3300006028|Ga0070717_10613325 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300006032|Ga0066696_10397315 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
3300006102|Ga0075015_100080438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1604 | Open in IMG/M |
3300006172|Ga0075018_10386946 | Not Available | 708 | Open in IMG/M |
3300006237|Ga0097621_102135752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 535 | Open in IMG/M |
3300006797|Ga0066659_11225445 | Not Available | 626 | Open in IMG/M |
3300006800|Ga0066660_10397336 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
3300006903|Ga0075426_10681124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 770 | Open in IMG/M |
3300006904|Ga0075424_101075709 | Not Available | 857 | Open in IMG/M |
3300006914|Ga0075436_101026060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
3300009090|Ga0099827_10520140 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
3300009639|Ga0116122_1205184 | Not Available | 616 | Open in IMG/M |
3300010333|Ga0134080_10573451 | Not Available | 546 | Open in IMG/M |
3300010343|Ga0074044_10070696 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2363 | Open in IMG/M |
3300010343|Ga0074044_10362688 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300010358|Ga0126370_10164866 | All Organisms → cellular organisms → Bacteria | 1633 | Open in IMG/M |
3300010360|Ga0126372_13059008 | Not Available | 519 | Open in IMG/M |
3300010376|Ga0126381_103096943 | Not Available | 659 | Open in IMG/M |
3300010399|Ga0134127_10908716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 936 | Open in IMG/M |
3300012201|Ga0137365_10836872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
3300012203|Ga0137399_10803148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
3300012209|Ga0137379_11704228 | Not Available | 527 | Open in IMG/M |
3300012362|Ga0137361_11022395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
3300013306|Ga0163162_11668888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
3300013308|Ga0157375_12890044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
3300014162|Ga0181538_10088819 | Not Available | 1839 | Open in IMG/M |
3300014497|Ga0182008_10554490 | Not Available | 639 | Open in IMG/M |
3300014654|Ga0181525_10658251 | Not Available | 586 | Open in IMG/M |
3300014655|Ga0181516_10361439 | Not Available | 740 | Open in IMG/M |
3300014657|Ga0181522_10784416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 584 | Open in IMG/M |
3300015051|Ga0137414_1249241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1820 | Open in IMG/M |
3300015264|Ga0137403_11262795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
3300015357|Ga0134072_10138378 | Not Available | 789 | Open in IMG/M |
3300015357|Ga0134072_10340396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
3300015358|Ga0134089_10336741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
3300015374|Ga0132255_104252688 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 607 | Open in IMG/M |
3300016341|Ga0182035_11987532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
3300017928|Ga0187806_1226721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
3300017934|Ga0187803_10466309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Paracidobacterium → Paracidobacterium acidisoli | 515 | Open in IMG/M |
3300017935|Ga0187848_10400689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
3300017940|Ga0187853_10453116 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300017959|Ga0187779_10592576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
3300017959|Ga0187779_11059208 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300017970|Ga0187783_10518324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 864 | Open in IMG/M |
3300017973|Ga0187780_10727269 | Not Available | 716 | Open in IMG/M |
3300017973|Ga0187780_11044214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
3300017975|Ga0187782_10118265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1958 | Open in IMG/M |
3300017975|Ga0187782_10615497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 835 | Open in IMG/M |
3300017994|Ga0187822_10022120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1636 | Open in IMG/M |
3300017995|Ga0187816_10117429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1145 | Open in IMG/M |
3300017995|Ga0187816_10168429 | Not Available | 950 | Open in IMG/M |
3300018008|Ga0187888_1318688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
3300018013|Ga0187873_1247554 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300018023|Ga0187889_10308778 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300018023|Ga0187889_10526814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 502 | Open in IMG/M |
3300018033|Ga0187867_10142997 | Not Available | 1379 | Open in IMG/M |
3300018037|Ga0187883_10376162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
3300018043|Ga0187887_10860788 | Not Available | 536 | Open in IMG/M |
3300018047|Ga0187859_10109285 | Not Available | 1457 | Open in IMG/M |
3300018062|Ga0187784_10329981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1238 | Open in IMG/M |
3300018086|Ga0187769_11153833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
3300018088|Ga0187771_10304025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1337 | Open in IMG/M |
3300018431|Ga0066655_11034222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
3300018468|Ga0066662_12932117 | Not Available | 507 | Open in IMG/M |
3300019787|Ga0182031_1114697 | Not Available | 969 | Open in IMG/M |
3300020199|Ga0179592_10475132 | Not Available | 538 | Open in IMG/M |
3300020580|Ga0210403_10466809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1027 | Open in IMG/M |
3300020580|Ga0210403_11283935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
3300020582|Ga0210395_10492421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 922 | Open in IMG/M |
3300020583|Ga0210401_11077397 | Not Available | 662 | Open in IMG/M |
3300020583|Ga0210401_11101872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
3300021171|Ga0210405_11110993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 590 | Open in IMG/M |
3300021178|Ga0210408_11497729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
3300021180|Ga0210396_10224570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1673 | Open in IMG/M |
3300021181|Ga0210388_10801296 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300021401|Ga0210393_10235887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1482 | Open in IMG/M |
3300021407|Ga0210383_11521773 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300021407|Ga0210383_11556318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 545 | Open in IMG/M |
3300021420|Ga0210394_10505786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1063 | Open in IMG/M |
3300021432|Ga0210384_10178484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1908 | Open in IMG/M |
3300021479|Ga0210410_10019204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5903 | Open in IMG/M |
3300021559|Ga0210409_10396015 | Not Available | 1236 | Open in IMG/M |
3300021560|Ga0126371_10487929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1380 | Open in IMG/M |
3300022557|Ga0212123_10495773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 794 | Open in IMG/M |
3300024295|Ga0224556_1032167 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
3300025315|Ga0207697_10284286 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300025414|Ga0208935_1033690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
3300025501|Ga0208563_1060018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 791 | Open in IMG/M |
3300025913|Ga0207695_10430899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1203 | Open in IMG/M |
3300025914|Ga0207671_10536396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 933 | Open in IMG/M |
3300025929|Ga0207664_11012186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
3300025929|Ga0207664_11787024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
3300025934|Ga0207686_10101057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1925 | Open in IMG/M |
3300025939|Ga0207665_11544181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300025941|Ga0207711_10505355 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1127 | Open in IMG/M |
3300025942|Ga0207689_10484491 | Not Available | 1036 | Open in IMG/M |
3300025949|Ga0207667_11251292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
3300025992|Ga0208775_1019676 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300026015|Ga0208286_1010237 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300026035|Ga0207703_11906893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
3300026281|Ga0209863_10197505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
3300026298|Ga0209236_1068418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1691 | Open in IMG/M |
3300026327|Ga0209266_1278100 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300026328|Ga0209802_1196217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
3300026376|Ga0257167_1007646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1376 | Open in IMG/M |
3300027516|Ga0207761_1100617 | Not Available | 563 | Open in IMG/M |
3300027609|Ga0209221_1079160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 856 | Open in IMG/M |
3300027635|Ga0209625_1069380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 788 | Open in IMG/M |
3300027692|Ga0209530_1127156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
3300027698|Ga0209446_1030557 | Not Available | 1351 | Open in IMG/M |
3300027729|Ga0209248_10224862 | Not Available | 550 | Open in IMG/M |
3300027846|Ga0209180_10345638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 848 | Open in IMG/M |
3300027854|Ga0209517_10047184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3303 | Open in IMG/M |
3300027855|Ga0209693_10022211 | All Organisms → cellular organisms → Bacteria | 3062 | Open in IMG/M |
3300027857|Ga0209166_10246884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 949 | Open in IMG/M |
3300027882|Ga0209590_10156189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1418 | Open in IMG/M |
3300027884|Ga0209275_10110848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1416 | Open in IMG/M |
3300027905|Ga0209415_10106494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3042 | Open in IMG/M |
3300027905|Ga0209415_10230915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1695 | Open in IMG/M |
3300027908|Ga0209006_10694092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
3300028268|Ga0255348_1036927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
3300028565|Ga0302145_10333735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 501 | Open in IMG/M |
3300028566|Ga0302147_10289890 | Not Available | 543 | Open in IMG/M |
3300028747|Ga0302219_10046196 | Not Available | 1624 | Open in IMG/M |
3300028765|Ga0302198_10552470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
3300028769|Ga0302213_1185534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300028808|Ga0302228_10368666 | Not Available | 639 | Open in IMG/M |
3300028906|Ga0308309_10432385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1132 | Open in IMG/M |
3300028906|Ga0308309_11420600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
3300029883|Ga0311327_10312316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1018 | Open in IMG/M |
3300029944|Ga0311352_10068889 | Not Available | 3170 | Open in IMG/M |
3300030053|Ga0302177_10128647 | Not Available | 1444 | Open in IMG/M |
3300030053|Ga0302177_10723162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
3300030399|Ga0311353_11427223 | Not Available | 563 | Open in IMG/M |
3300030706|Ga0310039_10144481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia grimesii | 966 | Open in IMG/M |
3300030738|Ga0265462_11190238 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300030743|Ga0265461_13658929 | Not Available | 522 | Open in IMG/M |
3300030991|Ga0073994_10017936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 833 | Open in IMG/M |
3300030991|Ga0073994_12308866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 821 | Open in IMG/M |
3300031040|Ga0265754_1034003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Alloacidobacterium → Alloacidobacterium dinghuense | 536 | Open in IMG/M |
3300031231|Ga0170824_106165974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1118 | Open in IMG/M |
3300031231|Ga0170824_124317521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3308 | Open in IMG/M |
3300031249|Ga0265339_10119068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1359 | Open in IMG/M |
3300031344|Ga0265316_10614860 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300031715|Ga0307476_10090940 | All Organisms → cellular organisms → Bacteria | 2142 | Open in IMG/M |
3300031718|Ga0307474_11455979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
3300031753|Ga0307477_10385265 | Not Available | 961 | Open in IMG/M |
3300031754|Ga0307475_10775898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
3300031754|Ga0307475_10932135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 685 | Open in IMG/M |
3300031823|Ga0307478_10458934 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
3300031823|Ga0307478_10741472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
3300032061|Ga0315540_10327162 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300032160|Ga0311301_11120355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1021 | Open in IMG/M |
3300032770|Ga0335085_11634543 | Not Available | 666 | Open in IMG/M |
3300032828|Ga0335080_10718831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1039 | Open in IMG/M |
3300032892|Ga0335081_10902245 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
3300032897|Ga0335071_10880714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 843 | Open in IMG/M |
3300033826|Ga0334847_022419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.81% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.21% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.21% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.21% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.69% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.65% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.65% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.12% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.12% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.60% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.60% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.08% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.08% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.08% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.08% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.08% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.56% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.56% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.56% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.56% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.56% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.56% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.56% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.04% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.04% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.04% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.04% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.04% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.04% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.04% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.04% |
Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.52% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.52% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.52% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.52% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.52% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.52% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.52% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.52% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.52% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.52% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.52% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.52% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005890 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
3300025501 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025992 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 (SPAdes) | Environmental | Open in IMG/M |
3300026015 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 (SPAdes) | Environmental | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028268 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v5 | Environmental | Open in IMG/M |
3300028565 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3 | Environmental | Open in IMG/M |
3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028765 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2 | Environmental | Open in IMG/M |
3300028769 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_1 | Environmental | Open in IMG/M |
3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031040 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300032061 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300033826 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 1-5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12269J14319_100467889 | 3300001356 | Peatlands Soil | MRIRRAFPIALGVVIVAAAVTLTVELRKAAPPEPARLLPGADAFVYGNFGWA |
JGI12269J14319_100817947 | 3300001356 | Peatlands Soil | MRIRRRLPIPLAVLLIVAAVALIVTLRKHAAPEAARLLP |
JGI12712J15308_100945561 | 3300001471 | Forest Soil | MRIRRTLPIFLTVVLVGAAVILAVQLRKXAPPEPARILPGGDAFFYVNLGPI |
JGI12659J15293_101160351 | 3300001546 | Forest Soil | MRIRRAFPIALALVIVAAAVTLAVQLRKHAPPEPARLLP |
JGI12635J15846_101534865 | 3300001593 | Forest Soil | MRIRRTFPIVLAVVAVAAAVTLAVQLRKHAPPEPA |
JGIcombinedJ26739_1010080053 | 3300002245 | Forest Soil | MRIRRRLPIFVVLLLVVAAVALIITLRKHAPPEAARLLPGADGFFYVN |
JGIcombinedJ26739_1010379381 | 3300002245 | Forest Soil | MRIRRTFPIALGVVVVAAAVTVAVQLRKHAPPEAARLLPS |
Ga0062385_102713742 | 3300004080 | Bog Forest Soil | MRIRRTFPIALVVVVVAAAVTLAVQLRKHAPPETARLLPGGDAF |
Ga0066683_108687821 | 3300005172 | Soil | MRIKRRLPILFGFLLFVAALAAVVELRKHAPPEAARLLPGAD |
Ga0066680_109063262 | 3300005174 | Soil | MISFFSTLQMRIRRSFPIFVGVLLVAAALTIIVQLRKHAPPEPARLL |
Ga0066673_106278312 | 3300005175 | Soil | MRIRRTLPILAGVLIVAAALTVIVQLRKHAPPEPARLLPGA |
Ga0066676_101905615 | 3300005186 | Soil | MRIRRTFPIVLAVVIVAAAVILAVQLRKQAPPECARLLPAGDAFLYANFGWARKTNS |
Ga0065704_105580711 | 3300005289 | Switchgrass Rhizosphere | MRIKRPLPLIIVVLLVAAAVVFIVQLRKRAPPEPARLLPGADAFFYV |
Ga0070670_1008771341 | 3300005331 | Switchgrass Rhizosphere | MRIRRRLPIWFGVVLVALAIALAVVLRQHAPPEPARLLPGA |
Ga0070703_101548451 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVRRPFPIALAVVIIAAALTLAVQLRNHAPPEAARLLPGADA |
Ga0070709_114596071 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIRRRLPILFGVVLVIAAIALAVVLRQHAPPEPARLLPG |
Ga0070714_1003062671 | 3300005435 | Agricultural Soil | MRLRRIFPVLFGLVLFAATVTIIVQLRKHAPPEAARLLPG |
Ga0070678_1009703583 | 3300005456 | Miscanthus Rhizosphere | MRIRRSFPIFLAVVLVGAAVAVMVALRKHAPPEAARLLPGADGFL |
Ga0070681_104406911 | 3300005458 | Corn Rhizosphere | MRFRRRFPVLFGLLIFLAAIAAVVELRKHAPPEAARLLPGADGF |
Ga0070699_1005157811 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIKRTLPVLIGVLAIAAAVVAIVQLRKRAPPEAVRLLPGAD |
Ga0070733_104694352 | 3300005541 | Surface Soil | MRIRRTLPIALAVVVVAAAVTLAVQLRKDAPPEPA |
Ga0070693_1000703562 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIGRRLPIWFGVVLVALAIALAVVLRQHAPPEPARLLPGA |
Ga0066701_104828151 | 3300005552 | Soil | MRIKRRLPVLFGFLLFVAAVGAVVFLRKHAPPEPARLLPGAD |
Ga0066661_108338721 | 3300005554 | Soil | MRIKRSFPIFLGVVVVAAAVTLIVQLRKQAPPEPARLLPGADAFLYVNL |
Ga0066670_106445391 | 3300005560 | Soil | MRIKRRLPVLFGFLLFVAAVAAVVFLRKHAPPEPARL |
Ga0070664_1005132584 | 3300005564 | Corn Rhizosphere | MRIRRTFPIVLVVVIVAAAVILAVQLRKQAPPECARLLPAADAFLYANLGWARK |
Ga0066703_100909077 | 3300005568 | Soil | MRIRRRLPILIGVVLVIAALALVVQLRKHAPPEPARLLP |
Ga0066705_102258081 | 3300005569 | Soil | MRLRRRFPVLFGLLLLIAAVTVAVQLRKHAPPEPAR |
Ga0066691_108942381 | 3300005586 | Soil | MRIRRSFPIFVGVLLVAAALTIIVQLRKHAPPEPARLL |
Ga0066654_104065191 | 3300005587 | Soil | MRIKRAVPVFLGFLIFVAAVALIIQLRKHAPPEPARLLPGADAF |
Ga0068856_1024189401 | 3300005614 | Corn Rhizosphere | MRIRRTFPIVLVVVIVAAAVILAVQLRKQAPPECARLLPAGDAFLYANF |
Ga0068858_1024015341 | 3300005842 | Switchgrass Rhizosphere | MRIRRRLPILFGVVLVIAAIALAVVLRQHAPPEPARLLPGA |
Ga0075285_10016983 | 3300005890 | Rice Paddy Soil | MRIRRTLPIVLAVVIVAAALILAVQLRKQAPPECARLLPA |
Ga0070766_109800261 | 3300005921 | Soil | MRIRRILPILLAVALITAALTVAVQLRKRAPPEAARLLP |
Ga0070717_106133253 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIKRRLPILFGFLLFVAAVAIVVTLRKHAPPEAARLLPGADAF |
Ga0066696_103973152 | 3300006032 | Soil | MRIRRSFPIFVGVLLVAAALTIIVQLRKHAPPEPARLLP |
Ga0075015_1000804386 | 3300006102 | Watersheds | MRIRRTFPIVLVVVIVAAAVTVTVQLRKHAPPESARLLPGADAFLYANFGWARKA |
Ga0075018_103869461 | 3300006172 | Watersheds | MRHLRRFRLIVLTVLFVVAMVTVIVQLRKAAPPEAARLLPGADAF |
Ga0097621_1021357521 | 3300006237 | Miscanthus Rhizosphere | MRIRRRLPIWFGVVLVALAIALAVVLRQHAPPEPARLLPGAD |
Ga0066659_112254452 | 3300006797 | Soil | MRIRRRLPILFGVVLVTAAVALVVVLRKHAPPEPAR |
Ga0066660_103973361 | 3300006800 | Soil | MRFRRRLPILLALVLVAAAVALLVCLRKHAPSEPARL |
Ga0075426_106811243 | 3300006903 | Populus Rhizosphere | MRLRRRFPILLGVLLIAAAVALLVVLRKHAPPEPARLLPGADS |
Ga0075424_1010757093 | 3300006904 | Populus Rhizosphere | MRIRRTLPIVLAVVIVTAALILAVQLRKQAPPECARLLPAADAFLYANLGWA |
Ga0075436_1010260601 | 3300006914 | Populus Rhizosphere | MRLRRRIPVLIGLLVVLAAIALVVFLRKHAPPESARLLPGADGF |
Ga0099827_105201401 | 3300009090 | Vadose Zone Soil | MRVRRPFPIVLAVVIIAAALTLAVQLRKHAPPEAARLLPGADAFL |
Ga0116122_12051841 | 3300009639 | Peatland | MRIRRRLPIPLAVLLVVAAIALIVTLRKHAAPEAA |
Ga0134080_105734512 | 3300010333 | Grasslands Soil | MRFRRRLPILLAVVLVAAAVALLVFLRKHAPPEPA |
Ga0074044_100706968 | 3300010343 | Bog Forest Soil | MRIRRTLPIVLAVVIVGAAVTLTVELRKNAPPEAARLLPGADAFLYANF |
Ga0074044_103626882 | 3300010343 | Bog Forest Soil | MRIRRTFPIALAVVVVAAAVTLTVELRKAAPPEPARLLPG |
Ga0126370_101648661 | 3300010358 | Tropical Forest Soil | MRIRRSLPIVLSVIAVAAVLTLLVELRKHAPPEPARLLPGADGF |
Ga0126372_130590081 | 3300010360 | Tropical Forest Soil | MRIRRTLPIALAVVTVAAAVTLTVELRKNAPPEAARLLPGADA |
Ga0126381_1030969433 | 3300010376 | Tropical Forest Soil | MRIRRTLPIFLIVVVLLAAVALVYTLRKHAPPESARLLPG |
Ga0134127_109087161 | 3300010399 | Terrestrial Soil | MRIKRPLPLIIVVLLVAAAVVFIVQLRKRAPPEPARLLPGADAF |
Ga0137365_108368722 | 3300012201 | Vadose Zone Soil | MHIRRSFPIFVGVLLVAAALTIIVQLRKHAPPEPARLLP |
Ga0137399_108031481 | 3300012203 | Vadose Zone Soil | MRVRRPFPIVLAVVIIAAALTIAVQLRKHAPPEAARLLPGADA |
Ga0137379_117042282 | 3300012209 | Vadose Zone Soil | MRIKRTLPVLIGVLAIAAAVVAVVQLRKRAPPEAVRLLPGADG |
Ga0137361_110223951 | 3300012362 | Vadose Zone Soil | MRIRRRLPIPLAVLLIIAAVALIVTLRKHAPPEAARLLPGADG |
Ga0163162_116688881 | 3300013306 | Switchgrass Rhizosphere | MRIKRPLPLIIVVLLVAAAVVFIVQLRKRAPPEPARLLPGADAFFY |
Ga0157375_128900442 | 3300013308 | Miscanthus Rhizosphere | MRLRRRLPILIGLLVVLAAIAVVVFLRKHAPPEAARLLPGA |
Ga0181538_100888191 | 3300014162 | Bog | MRIRRRLLIPLTVLLIVAAVALIVALRKHAPPEAARL |
Ga0182008_105544902 | 3300014497 | Rhizosphere | MRIRRTFPIVLVVVIVAAAVILAVQLRKQAPPECARLLPAGDAFL |
Ga0181525_106582511 | 3300014654 | Bog | MRIRRTFPIVLLFVTIVAAVTLAVQLRKHAPPEPARL |
Ga0181516_103614392 | 3300014655 | Bog | MRIRRTFPIVLAVVAIAAAVTLAVQLRKHAPPEPARLLP |
Ga0181522_107844161 | 3300014657 | Bog | MPIRRTFPIVLAVVVIAAAVTLAVQLRKHAPPEAARLLPGADGFFYL |
Ga0137414_12492414 | 3300015051 | Vadose Zone Soil | MRIRRTFPIVLAVVVIAAAVTLAVQLRKHAPPEPARLLPGADAFF |
Ga0137403_112627951 | 3300015264 | Vadose Zone Soil | MWRFRRFRLLALSVLLVAAIVTVVVQLRKIAPPEGARLLPGADAFVYVDLQWARR |
Ga0134072_101383781 | 3300015357 | Grasslands Soil | MRFRRRLPILLAVVLVVAAVALLVFLRKHAPPEPARL |
Ga0134072_103403961 | 3300015357 | Grasslands Soil | MRIRRRLPILFGVVVVTAAVALVVVLRKHAPPEPARLLPGADGY |
Ga0134089_103367412 | 3300015358 | Grasslands Soil | MRIRRSFPIFVGVLLVAAALTIIVQLRKHAPPEPAR |
Ga0132255_1042526881 | 3300015374 | Arabidopsis Rhizosphere | MRIRRSFPIFLAVVLVGAAVAVMVALRKHAPPEAARLLPGADGFLYI |
Ga0182035_119875322 | 3300016341 | Soil | MRFRRRIPVLLGLAIFLAAVFAVVELRKHAPPEPARLLPGAAGFLY |
Ga0187806_12267211 | 3300017928 | Freshwater Sediment | MRIRRTLPLVLTVVVIAAAVTIAVQLRKHAPPEPARLLPGGDAF |
Ga0187803_104663091 | 3300017934 | Freshwater Sediment | MRIRRHLLIPLVVVLIAAGVALIVTLRKHAPPEAARL |
Ga0187848_104006891 | 3300017935 | Peatland | MRIRRTLPVFVFVVLITAAVFIAVQLRKHAPPEAARLLPGADAFIYADLTW |
Ga0187853_104531161 | 3300017940 | Peatland | MRIRRRLLIPLTVLLIVAAVALIVVLRMHAPPEAARLLPGA |
Ga0187779_105925761 | 3300017959 | Tropical Peatland | MRIRRSLPIVVAVLLVAAAVALLVVLRKHAPPEPARLLPGA |
Ga0187779_110592081 | 3300017959 | Tropical Peatland | MRIRRAYPITLAVVIVAAAVTVAVQLRKNAPPEPAR |
Ga0187783_105183243 | 3300017970 | Tropical Peatland | MRLKRTLPLALAVVIVAAAIVAAVQLRKHAPPEAARLLPGGDAFFYVNYNWIRR |
Ga0187780_107272691 | 3300017973 | Tropical Peatland | MRLRRRLPIILGVLRVAAAVALVVVLRKHAPPESAR |
Ga0187780_110442141 | 3300017973 | Tropical Peatland | MRIRRRLPIVFGVLLVAGAVAVVVILRKHAPPEAARLLPGADGFAYIDLQWM |
Ga0187782_101182651 | 3300017975 | Tropical Peatland | MRIRRRLLIPLIVLLIAAAVALIVVLRMHAPPEAARLLPSAD |
Ga0187782_106154972 | 3300017975 | Tropical Peatland | MRIRRAFPIALAVVIVAAAITIAVELRKDAPPEAARLLPGADAFLYADFGW |
Ga0187822_100221201 | 3300017994 | Freshwater Sediment | MRIRRTFPIVLAVVIVAAAVILAVQLRKQAPPECARLLPAGDAFLYANLGWARK |
Ga0187816_101174291 | 3300017995 | Freshwater Sediment | MRIRRRLPIILAVLLVVAALAIAVVLRKHAPPEAARLLPGG |
Ga0187816_101684291 | 3300017995 | Freshwater Sediment | MRIRRRLPLVLAVLVIAAAVALIVTLRKHAPPEAAR |
Ga0187888_13186881 | 3300018008 | Peatland | MRIRRTLPVVLAVVVIAAALTLAVQLRKHAPPEAARLLP |
Ga0187873_12475543 | 3300018013 | Peatland | MRIRRRLLIPLIVLLIAAVVALIVVLRMHAPPEAARLL |
Ga0187889_103087781 | 3300018023 | Peatland | MRIRRRLLIPLTVLLIVAAVASIVVLRMHAPPEAARLLPGAD |
Ga0187889_105268141 | 3300018023 | Peatland | MRIRRTLSSALAVVVVAAAVTLTVQLRKSAPPEAARLLPAADGFFYA |
Ga0187867_101429976 | 3300018033 | Peatland | MRIRRRLLIPLIVLLLVAAVALIVTLRKNAPPEAA |
Ga0187883_103761622 | 3300018037 | Peatland | MRIRRTFPIALAVVVIAAAVFVAVQLRKHAPPEPARLLPG |
Ga0187887_108607881 | 3300018043 | Peatland | MRIRRRLLIPLSVLLIVVAVALIVALRKHAPPEAA |
Ga0187859_101092852 | 3300018047 | Peatland | MSPASADAMRIRRTLPILIALLVVAAAVTAIVLLLGQAPPEAARLLPGAD |
Ga0187784_103299811 | 3300018062 | Tropical Peatland | MRIRSAFPITLAVVMVAAAVTVAVQLRKHAPPEPARLLP |
Ga0187769_111538332 | 3300018086 | Tropical Peatland | MRIRRTLPIVLAVVAIAAAVTLAVQLRTHAPPEAARLLPGADAFF |
Ga0187771_103040256 | 3300018088 | Tropical Peatland | MRIRRTLPIILTVLVIAAAITVAVELRKHAPPEAARL |
Ga0066655_110342222 | 3300018431 | Grasslands Soil | MRIRRSFPIFVGVLLVAAALTIIVQLRKHAPPEPARLLPG |
Ga0066662_129321171 | 3300018468 | Grasslands Soil | MRIRRRLPIIIGVLAVIAAVAIVVELRRHAPPEPARLL |
Ga0182031_11146974 | 3300019787 | Bog | MRIRRRLLIPLIVLLLVAAVALIVTLRKNAPPEAARLL |
Ga0179592_104751322 | 3300020199 | Vadose Zone Soil | MRVRRPFPIVLAVVIIAAALTLAVQLRKHAPPEAAR |
Ga0210403_104668091 | 3300020580 | Soil | MRIRPTFLIVLAVVVLAASVTLAVQLRKHAPPEPARLLPGADAFFYLDLSWARR |
Ga0210403_112839351 | 3300020580 | Soil | MRIRRIFPIALVVVVVAAAVTLTVELRKAAPPVPA |
Ga0210395_104924212 | 3300020582 | Soil | MRIRPTFLIVLAVVVLAASVTLAVQLRKHAPPEPARLLPGADAFFYLDLSWARRANA |
Ga0210401_110773971 | 3300020583 | Soil | MRIRRAFPITLAIVTVAAAVTLAVQLRKIAPPEPARLLP |
Ga0210401_111018721 | 3300020583 | Soil | MRKRRSLPIFLTAILVAAVLVLLVQLRKHAPPEPARLLPSADGFF |
Ga0210405_111109931 | 3300021171 | Soil | MRIRRIFPIALVVVVVAAAVTLTVELRKAAPPEPARLLPGADAFVYADFS |
Ga0210408_114977291 | 3300021178 | Soil | MAPRTSYFMRIRRRLPILFGVVLVIAAIALAVVLRKHAPPEPARLLP |
Ga0210396_102245701 | 3300021180 | Soil | MRIRRTFPIALGVVVVAAAVTLAVQLRKHAPPEPARLLPSA |
Ga0210388_108012961 | 3300021181 | Soil | MRIRRRLPIFLAVLLIASAVALAVVLRKHAPPEPARL |
Ga0210393_102358871 | 3300021401 | Soil | MRIRRAFPITLAIVIVAAAVTLAVQLRKIAPPEPARLLPGADG |
Ga0210383_115217731 | 3300021407 | Soil | MRFRRRLPILIVVLLIAGAIALLVTLRKHAPPEAARLLPGADGFF |
Ga0210383_115563181 | 3300021407 | Soil | MRIRRTLPIFLTVVLVAAAVILAVQLRKHAPPEAARLLPGGDVFFYANLGRIRKAN |
Ga0210394_105057861 | 3300021420 | Soil | MRIRRTFPLVLAVVVIAGAVVLAVQLRKHAPPEPARLLPG |
Ga0210384_101784841 | 3300021432 | Soil | MRIRRSLPVVLGVVAVAAALTLIVQLRKHAPPEPARLLPGADGF |
Ga0210410_100192049 | 3300021479 | Soil | MRIRRTFPIALVVVIVAAALVIAVQLRKHAPPEPARLLP |
Ga0210409_103960151 | 3300021559 | Soil | MRIRRRLPIPLAVLLIVAAVALIVTLRKHAPPEAARL |
Ga0126371_104879291 | 3300021560 | Tropical Forest Soil | MRIRRTLPVVLAVAVVAAAVIVAVQLRKAAPPEPARLLPGADGFLYAD |
Ga0212123_104957731 | 3300022557 | Iron-Sulfur Acid Spring | MRIRRVFPITLALVVVAAALTLAVQLRKHAPPEAARLLPSADAFVFANLG |
Ga0224556_10321672 | 3300024295 | Soil | MRIRRTFPIVLAVLVIAAAVTLAVQLRKHAPPEAARLLPGGDAYFYLDLSW |
Ga0207697_102842862 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFRRKLPILAGILVIAIAVAVVVFLRKHAPPEAA |
Ga0208935_10336902 | 3300025414 | Peatland | MRIRRTLPVVLAVVVIAAAVTLAVQLRKHAPPEAARLLPGAD |
Ga0208563_10600181 | 3300025501 | Peatland | MRIRRTLPVFVFVVLITAAVFIAVQLRKHAPPEAARLLPGADAFIYADLTWV |
Ga0207695_104308991 | 3300025913 | Corn Rhizosphere | MRIRRTFPIVLAVVIVAAAVILAVQLRKQAPPECARLLPAGDAFLYANFGWA |
Ga0207671_105363964 | 3300025914 | Corn Rhizosphere | MRIRRTFPIVLVVVIVAAAVILAVQLRKQAPPECARLL |
Ga0207664_110121861 | 3300025929 | Agricultural Soil | MRIRRTYPIALVVVIVAAAVTLAVQLRKHAPPEPAR |
Ga0207664_117870241 | 3300025929 | Agricultural Soil | MRIRRTFPIVLAVVIVAAAVILAVQLRKPAPPECARLL |
Ga0207686_101010572 | 3300025934 | Miscanthus Rhizosphere | MRIRRRLPIWFGVVLVALAIAAAVVLRQHAPPEPAR |
Ga0207665_115441812 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIRRTFPIVLAVVIVAAAVILAVQLRKQAPPECARLLPAGDAFLYANFGWARKTNSEA |
Ga0207711_105053554 | 3300025941 | Switchgrass Rhizosphere | MRIRRRLPIILGVVLVAAAVVVVVQLRKHAPPEPARLLPS |
Ga0207689_104844915 | 3300025942 | Miscanthus Rhizosphere | MRLRRRLPIFIGLLVVVAAIAVVVLLRKHAPPEAAR |
Ga0207667_112512922 | 3300025949 | Corn Rhizosphere | MRIRRTLPIVLAVVIVAAALILAVQLRKQAPPECARLLPAADAFLY |
Ga0208775_10196761 | 3300025992 | Rice Paddy Soil | MRIRRTLPIVLAVVIVAAALILAVQLRKQAPPECARLLPAAD |
Ga0208286_10102371 | 3300026015 | Rice Paddy Soil | MRLRRRLPLIIGVLLVVAAVAVVVVLRKHAPPEAAR |
Ga0207703_119068931 | 3300026035 | Switchgrass Rhizosphere | MRIRRRLPILFGVVLVIAAIALAVVLRQHAPPEHARLLPGADGY |
Ga0209863_101975051 | 3300026281 | Prmafrost Soil | MRIRRRLPILFGVVLVIAAIALAVVLRKHAPPEPARLLPGA |
Ga0209236_10684183 | 3300026298 | Grasslands Soil | MRIRRSLPILLAVLLIAAAVALVVVLRKHAPPEPARLLPG |
Ga0209266_12781002 | 3300026327 | Soil | MRIKRRLPILFGFLLFVAALAAVVELRKHAPPEAARLLPGADAFVY |
Ga0209802_11962171 | 3300026328 | Soil | MRIRRSFPIFVGVLLVAAALTIIVQLRKHAPPEPARLLPGA |
Ga0257167_10076461 | 3300026376 | Soil | MRIRRRLPIPLAVLLFVAAVALIVTLRKHAPPEAARLLP |
Ga0207761_11006173 | 3300027516 | Tropical Forest Soil | MRIKRTLPVLIGVLVLAATVVVLVQLRKHAPPEPAR |
Ga0209221_10791602 | 3300027609 | Forest Soil | MRIRRPLPLVLVVVVVAAAVTVAVQLRKSAPPEPARL |
Ga0209625_10693802 | 3300027635 | Forest Soil | MRIRRTFPIVLAVVAVAAAVTLAVQLRKHAPPEPARLLPGADAFFY |
Ga0209530_11271562 | 3300027692 | Forest Soil | MRIRRTFPIALGVVVIAAAVFLAVQLRKHAPPEPARLLPGA |
Ga0209446_10305576 | 3300027698 | Bog Forest Soil | MRIRRHLLIPLIVLLIVGAVALIVVLRKQAPPEAA |
Ga0209248_102248621 | 3300027729 | Bog Forest Soil | MRIRRSLPILLAVAVVAAAVALMVVLRKHAPPEPARL |
Ga0209180_103456381 | 3300027846 | Vadose Zone Soil | MRIKRSLPILLAVLLVAAAVALVVVLRKHAPPEPARLL |
Ga0209517_100471841 | 3300027854 | Peatlands Soil | MRIRRTLPIVCGVLLIVAALILAVQLRKHAPPEPARL |
Ga0209693_100222114 | 3300027855 | Soil | MRIRRTFPLVLAVVVVAAAVTVAVQLRKNAPPEPARLLPGAD |
Ga0209166_102468844 | 3300027857 | Surface Soil | MRIRRAFPLTLALVIVAAAVTLAVQLRKQAPPEPARLLPG |
Ga0209590_101561891 | 3300027882 | Vadose Zone Soil | MRLRTKRTLPIVFGVLLIAAAVTLAVQLRKHAPPEPARLLPGADG |
Ga0209275_101108482 | 3300027884 | Soil | MRVRSPFPLVLAVVVVAAAVTVAVQLRKNAPPEPARLLPGADAFMY |
Ga0209415_101064941 | 3300027905 | Peatlands Soil | MRIRRAFPIALAVVTVGAAVTLAVQLRKHAPPEPARLLPG |
Ga0209415_102309151 | 3300027905 | Peatlands Soil | MRIRPTFPIALAVVVVAASVTLAVQLRKHAPPEAARLLPGADAFFYLDLN |
Ga0209006_106940923 | 3300027908 | Forest Soil | MRIRRAFPITLAIVTVAAAVTLAVQLRKIAPPEPARLLPGADGFVY |
Ga0255348_10369273 | 3300028268 | Soil | MRIRRRLLIPLIVLLLVAAVALIVTLRKNAPPEAARLLPGADGF |
Ga0302145_103337352 | 3300028565 | Bog | MRIRRTFPIVLAVVAIAAAVTLAVQLRKHAPPEPARLLPGADAF |
Ga0302147_102898901 | 3300028566 | Bog | MRIRRTLPIVVLVLAIAAAVTFAVQLRKHAPPEPAR |
Ga0302219_100461961 | 3300028747 | Palsa | MRIRRRLPIFLAVVLIAAAVALIVTLRKHAPPEAA |
Ga0302198_105524701 | 3300028765 | Bog | MRIRRTLPIVVLVLAIAAAVTFAVQLRKHAPPEPARLLPGADAF |
Ga0302213_11855341 | 3300028769 | Fen | MRIKRILPVLIAVLLIAAAITALVQLRKHAPPEAARLLPGADGFFYIN |
Ga0302228_103686661 | 3300028808 | Palsa | MRIRRPFPLVLAVVVVAAAVTVAVQLRKNAPPEPARLLPG |
Ga0308309_104323852 | 3300028906 | Soil | MRIRRPYPIALAVVIVAAALTLAVQLRKSAPPEPARLLPGADAFFY |
Ga0308309_114206002 | 3300028906 | Soil | MRIRRTLPIFLTVGLVGAAVILAVQLRKHAPPEPARILPGGDAFFYVNLGPIRR |
Ga0311327_103123162 | 3300029883 | Bog | MRIRRTFPIVVAVLVIAAAVTLAVQLRKHAPPEVTLIFISI |
Ga0311352_100688891 | 3300029944 | Palsa | MRIRRHLLIPLVVLLLGAAVALIVTLRKHAPPEAA |
Ga0302177_101286473 | 3300030053 | Palsa | MRKRRTLPIVLAVLIVAAAIVAAVQLRKHAPPEAARLLP |
Ga0302177_107231622 | 3300030053 | Palsa | MRIRRRLLIPLSVLLIVAAVALIVALRKQAPPEAARLLPGADGF |
Ga0311353_114272232 | 3300030399 | Palsa | MRIRRRLPIPLVVLLIVAVVALIVTLRKHAPPEAARLL |
Ga0310039_101444812 | 3300030706 | Peatlands Soil | MRIRRTLPTALAVVVVAAAVTLAVQLRKLAPPEPARLLPGAD |
Ga0265462_111902381 | 3300030738 | Soil | MRIRRTFPIVLLFVVIVAAVTLAVQLRKHAPPEPARLLPGADA |
Ga0265461_136589291 | 3300030743 | Soil | MRIRRTFPVVLAVVVIAAAVTLAVQLRKHAPPEPAR |
Ga0073994_100179363 | 3300030991 | Soil | MRIRRTLPIALGVVIVAAAVTLAVQLRKHAPPESARLLPGGDAFLYLNLGWARKANGGNNLPAV |
Ga0073994_123088661 | 3300030991 | Soil | MRIRRAFPIALALVIVTAAVTLAVQLRKHAPPEAARLLPGADAFVYGNFVWARKANGGKLLLPV |
Ga0265754_10340031 | 3300031040 | Soil | MRIRRRLPIILAVLLIAAAVALAVVLRKHAPPEPARL |
Ga0170824_1061659742 | 3300031231 | Forest Soil | MRIRRTFPIALAVVAVAAALTFAVQLRKNAPPEPARLLPGADAFVYGDLGWARKM |
Ga0170824_1243175211 | 3300031231 | Forest Soil | MRIRRTFPIALAVVVVGAAVTLAVQLRKHAPPEPARLLPGA |
Ga0265339_101190682 | 3300031249 | Rhizosphere | MRIRRTLPIVLAVVVIAAAVTVAVQLRKSAPPEPARLLPGADAF |
Ga0265316_106148602 | 3300031344 | Rhizosphere | MRIRRTLPIVLAVVVIAAAVTVAVQLRKSAPPEPARLLPGADAFV |
Ga0307476_100909408 | 3300031715 | Hardwood Forest Soil | MRIRRSLPIALVVVIVAAAVTLTVELRKSAPPEAARLLPGADAFLYANL |
Ga0307474_114559792 | 3300031718 | Hardwood Forest Soil | MRIRRTFPIALVVVIVAAAVILAVQLRKHAPPEAARLLPGA |
Ga0307477_103852651 | 3300031753 | Hardwood Forest Soil | MRIRRTFPIVLAVVVIAAAVTLAVQLRKHAPPEPARLL |
Ga0307475_107758981 | 3300031754 | Hardwood Forest Soil | MRIRRSLPILFGVLLIAASVALVVVLRKHAPPEPA |
Ga0307475_109321352 | 3300031754 | Hardwood Forest Soil | MRIRRTFPLALAVVIVAAAVTLAVQLRKHAPPEAARLLPGADSFFYLDLGRARRAN |
Ga0307478_104589343 | 3300031823 | Hardwood Forest Soil | MRIKRALPVLFGFLIFVAAVALIVQLRKHAPPEPARLL |
Ga0307478_107414722 | 3300031823 | Hardwood Forest Soil | MRIRRTFPIVVAVAVVAAAVTLAVQLRKHAPPEPARLLPAAD |
Ga0315540_103271622 | 3300032061 | Salt Marsh Sediment | MLRTPFMRIKRRLPILLGVLVVAAAVAVVVVLRKH |
Ga0311301_111203552 | 3300032160 | Peatlands Soil | MRIRRTLPIALAVVVVAAAVTLAVQLRKDAPPEPARLL |
Ga0335085_116345431 | 3300032770 | Soil | MRIRRTLPVLIVVLAIAAAVVAIVQLRKRAPPEAARLLPG |
Ga0335080_107188311 | 3300032828 | Soil | MRIKRTLPVLIAVLLIVAAIVALVQLRKHAPPEAARLLP |
Ga0335081_109022454 | 3300032892 | Soil | MRLKRSYPVLVAVLLVAAAIALVVVLRKHAPPEPARLLPSAD |
Ga0335071_108807144 | 3300032897 | Soil | MRFKRSLPILLAVLVVAGAVALVVVLRKHAPPEAARLLPGAD |
Ga0334847_022419_2_154 | 3300033826 | Soil | MRIRRTLPIALAVVIVAAAVTVAVQLRKHAPPEAARLLPGADAFLYADFSW |
⦗Top⦘ |