NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F028288

Metagenome / Metatranscriptome Family F028288

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F028288
Family Type Metagenome / Metatranscriptome
Number of Sequences 192
Average Sequence Length 42 residues
Representative Sequence MRIRRTFPIVLAVVAIAAAVTLAVQLRKHAPPEPARLLP
Number of Associated Samples 172
Number of Associated Scaffolds 192

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 13.02 %
% of genes near scaffold ends (potentially truncated) 99.48 %
% of genes from short scaffolds (< 2000 bps) 94.27 %
Associated GOLD sequencing projects 163
AlphaFold2 3D model prediction Yes
3D model pTM-score0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.167 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(10.938 % of family members)
Environment Ontology (ENVO) Unclassified
(19.792 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.042 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 41.79%    β-sheet: 0.00%    Coil/Unstructured: 58.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 192 Family Scaffolds
PF02687FtsX 3.12
PF03869Arc 2.60
PF12704MacB_PCD 2.60
PF07883Cupin_2 2.60
PF00009GTP_EFTU 2.60
PF00072Response_reg 2.08
PF12681Glyoxalase_2 1.04
PF16694Cytochrome_P460 1.04
PF13442Cytochrome_CBB3 1.04
PF00561Abhydrolase_1 0.52
PF09832DUF2059 0.52
PF12697Abhydrolase_6 0.52
PF02810SEC-C 0.52
PF12836HHH_3 0.52
PF07676PD40 0.52
PF13181TPR_8 0.52
PF04238DUF420 0.52
PF01258zf-dskA_traR 0.52
PF01833TIG 0.52
PF13414TPR_11 0.52
PF02777Sod_Fe_C 0.52
PF00491Arginase 0.52
PF03551PadR 0.52
PF13432TPR_16 0.52

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 192 Family Scaffolds
COG0010Arginase/agmatinase family enzymeAmino acid transport and metabolism [E] 0.52
COG0605Superoxide dismutaseInorganic ion transport and metabolism [P] 0.52
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.52
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.52
COG1734RNA polymerase-binding transcription factor DksATranscription [K] 0.52
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.52
COG2322Cytochrome oxidase assembly protein CtaM/YozB, DUF420 familyPosttranslational modification, protein turnover, chaperones [O] 0.52


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.69 %
UnclassifiedrootN/A20.31 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001356|JGI12269J14319_10046788All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2630Open in IMG/M
3300001356|JGI12269J14319_10081794All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium1704Open in IMG/M
3300001471|JGI12712J15308_10094556All Organisms → cellular organisms → Bacteria → Acidobacteria758Open in IMG/M
3300001546|JGI12659J15293_10116035All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter582Open in IMG/M
3300001593|JGI12635J15846_10153486All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1576Open in IMG/M
3300002245|JGIcombinedJ26739_101008005All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium717Open in IMG/M
3300002245|JGIcombinedJ26739_101037938All Organisms → cellular organisms → Bacteria → Acidobacteria705Open in IMG/M
3300004080|Ga0062385_10271374All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae957Open in IMG/M
3300005172|Ga0066683_10868782All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300005174|Ga0066680_10906326All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300005175|Ga0066673_10627831All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium623Open in IMG/M
3300005186|Ga0066676_10190561Not Available1312Open in IMG/M
3300005289|Ga0065704_10558071All Organisms → cellular organisms → Bacteria → Acidobacteria630Open in IMG/M
3300005331|Ga0070670_100877134All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae813Open in IMG/M
3300005406|Ga0070703_10154845All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300005434|Ga0070709_11459607All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae555Open in IMG/M
3300005435|Ga0070714_100306267All Organisms → cellular organisms → Bacteria1482Open in IMG/M
3300005456|Ga0070678_100970358All Organisms → cellular organisms → Bacteria → Acidobacteria780Open in IMG/M
3300005458|Ga0070681_10440691All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1215Open in IMG/M
3300005518|Ga0070699_100515781Not Available1086Open in IMG/M
3300005541|Ga0070733_10469435All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium841Open in IMG/M
3300005547|Ga0070693_100070356All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2059Open in IMG/M
3300005552|Ga0066701_10482815All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300005554|Ga0066661_10833872All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae539Open in IMG/M
3300005560|Ga0066670_10644539All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300005564|Ga0070664_100513258All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1106Open in IMG/M
3300005568|Ga0066703_10090907All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1780Open in IMG/M
3300005569|Ga0066705_10225808All Organisms → Viruses → Predicted Viral1181Open in IMG/M
3300005586|Ga0066691_10894238All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300005587|Ga0066654_10406519All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300005614|Ga0068856_102418940Not Available532Open in IMG/M
3300005842|Ga0068858_102401534All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae521Open in IMG/M
3300005890|Ga0075285_1001698All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2266Open in IMG/M
3300005921|Ga0070766_10980026All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui581Open in IMG/M
3300006028|Ga0070717_10613325All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300006032|Ga0066696_10397315All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300006102|Ga0075015_100080438All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1604Open in IMG/M
3300006172|Ga0075018_10386946Not Available708Open in IMG/M
3300006237|Ga0097621_102135752All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae535Open in IMG/M
3300006797|Ga0066659_11225445Not Available626Open in IMG/M
3300006800|Ga0066660_10397336All Organisms → cellular organisms → Bacteria1136Open in IMG/M
3300006903|Ga0075426_10681124All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium770Open in IMG/M
3300006904|Ga0075424_101075709Not Available857Open in IMG/M
3300006914|Ga0075436_101026060All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium620Open in IMG/M
3300009090|Ga0099827_10520140All Organisms → cellular organisms → Bacteria1023Open in IMG/M
3300009639|Ga0116122_1205184Not Available616Open in IMG/M
3300010333|Ga0134080_10573451Not Available546Open in IMG/M
3300010343|Ga0074044_10070696All Organisms → cellular organisms → Bacteria → Acidobacteria2363Open in IMG/M
3300010343|Ga0074044_10362688All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300010358|Ga0126370_10164866All Organisms → cellular organisms → Bacteria1633Open in IMG/M
3300010360|Ga0126372_13059008Not Available519Open in IMG/M
3300010376|Ga0126381_103096943Not Available659Open in IMG/M
3300010399|Ga0134127_10908716All Organisms → cellular organisms → Bacteria → Acidobacteria936Open in IMG/M
3300012201|Ga0137365_10836872All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium672Open in IMG/M
3300012203|Ga0137399_10803148All Organisms → cellular organisms → Bacteria → Acidobacteria792Open in IMG/M
3300012209|Ga0137379_11704228Not Available527Open in IMG/M
3300012362|Ga0137361_11022395All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium746Open in IMG/M
3300013306|Ga0163162_11668888All Organisms → cellular organisms → Bacteria → Acidobacteria727Open in IMG/M
3300013308|Ga0157375_12890044All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300014162|Ga0181538_10088819Not Available1839Open in IMG/M
3300014497|Ga0182008_10554490Not Available639Open in IMG/M
3300014654|Ga0181525_10658251Not Available586Open in IMG/M
3300014655|Ga0181516_10361439Not Available740Open in IMG/M
3300014657|Ga0181522_10784416All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae584Open in IMG/M
3300015051|Ga0137414_1249241All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1820Open in IMG/M
3300015264|Ga0137403_11262795All Organisms → cellular organisms → Bacteria → Acidobacteria584Open in IMG/M
3300015357|Ga0134072_10138378Not Available789Open in IMG/M
3300015357|Ga0134072_10340396All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium572Open in IMG/M
3300015358|Ga0134089_10336741All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium633Open in IMG/M
3300015374|Ga0132255_104252688All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira607Open in IMG/M
3300016341|Ga0182035_11987532All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300017928|Ga0187806_1226721All Organisms → cellular organisms → Bacteria → Acidobacteria641Open in IMG/M
3300017934|Ga0187803_10466309All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Paracidobacterium → Paracidobacterium acidisoli515Open in IMG/M
3300017935|Ga0187848_10400689All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300017940|Ga0187853_10453116All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300017959|Ga0187779_10592576All Organisms → cellular organisms → Bacteria → Acidobacteria741Open in IMG/M
3300017959|Ga0187779_11059208All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300017970|Ga0187783_10518324All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae864Open in IMG/M
3300017973|Ga0187780_10727269Not Available716Open in IMG/M
3300017973|Ga0187780_11044214All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium596Open in IMG/M
3300017975|Ga0187782_10118265All Organisms → cellular organisms → Bacteria → Acidobacteria1958Open in IMG/M
3300017975|Ga0187782_10615497All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium835Open in IMG/M
3300017994|Ga0187822_10022120All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1636Open in IMG/M
3300017995|Ga0187816_10117429All Organisms → cellular organisms → Bacteria → Acidobacteria1145Open in IMG/M
3300017995|Ga0187816_10168429Not Available950Open in IMG/M
3300018008|Ga0187888_1318688All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium595Open in IMG/M
3300018013|Ga0187873_1247554All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300018023|Ga0187889_10308778All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300018023|Ga0187889_10526814All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae502Open in IMG/M
3300018033|Ga0187867_10142997Not Available1379Open in IMG/M
3300018037|Ga0187883_10376162All Organisms → cellular organisms → Bacteria → Acidobacteria727Open in IMG/M
3300018043|Ga0187887_10860788Not Available536Open in IMG/M
3300018047|Ga0187859_10109285Not Available1457Open in IMG/M
3300018062|Ga0187784_10329981All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1238Open in IMG/M
3300018086|Ga0187769_11153833All Organisms → cellular organisms → Bacteria → Acidobacteria586Open in IMG/M
3300018088|Ga0187771_10304025All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71337Open in IMG/M
3300018431|Ga0066655_11034222All Organisms → cellular organisms → Bacteria → Acidobacteria570Open in IMG/M
3300018468|Ga0066662_12932117Not Available507Open in IMG/M
3300019787|Ga0182031_1114697Not Available969Open in IMG/M
3300020199|Ga0179592_10475132Not Available538Open in IMG/M
3300020580|Ga0210403_10466809All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1027Open in IMG/M
3300020580|Ga0210403_11283935All Organisms → cellular organisms → Bacteria → Acidobacteria560Open in IMG/M
3300020582|Ga0210395_10492421All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae922Open in IMG/M
3300020583|Ga0210401_11077397Not Available662Open in IMG/M
3300020583|Ga0210401_11101872All Organisms → cellular organisms → Bacteria → Acidobacteria652Open in IMG/M
3300021171|Ga0210405_11110993All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae590Open in IMG/M
3300021178|Ga0210408_11497729All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300021180|Ga0210396_10224570All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1673Open in IMG/M
3300021181|Ga0210388_10801296All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300021401|Ga0210393_10235887All Organisms → cellular organisms → Bacteria → Acidobacteria1482Open in IMG/M
3300021407|Ga0210383_11521773All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300021407|Ga0210383_11556318All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89545Open in IMG/M
3300021420|Ga0210394_10505786All Organisms → cellular organisms → Bacteria → Acidobacteria1063Open in IMG/M
3300021432|Ga0210384_10178484All Organisms → cellular organisms → Bacteria → Acidobacteria1908Open in IMG/M
3300021479|Ga0210410_10019204All Organisms → cellular organisms → Bacteria → Acidobacteria5903Open in IMG/M
3300021559|Ga0210409_10396015Not Available1236Open in IMG/M
3300021560|Ga0126371_10487929All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1380Open in IMG/M
3300022557|Ga0212123_10495773All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae794Open in IMG/M
3300024295|Ga0224556_1032167All Organisms → cellular organisms → Bacteria1315Open in IMG/M
3300025315|Ga0207697_10284286All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300025414|Ga0208935_1033690All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium679Open in IMG/M
3300025501|Ga0208563_1060018All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium791Open in IMG/M
3300025913|Ga0207695_10430899All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1203Open in IMG/M
3300025914|Ga0207671_10536396All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium933Open in IMG/M
3300025929|Ga0207664_11012186All Organisms → cellular organisms → Bacteria → Acidobacteria744Open in IMG/M
3300025929|Ga0207664_11787024All Organisms → cellular organisms → Bacteria → Acidobacteria537Open in IMG/M
3300025934|Ga0207686_10101057All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1925Open in IMG/M
3300025939|Ga0207665_11544181All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300025941|Ga0207711_10505355All Organisms → cellular organisms → Bacteria → Acidobacteria1127Open in IMG/M
3300025942|Ga0207689_10484491Not Available1036Open in IMG/M
3300025949|Ga0207667_11251292All Organisms → cellular organisms → Bacteria → Acidobacteria720Open in IMG/M
3300025992|Ga0208775_1019676All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300026015|Ga0208286_1010237All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300026035|Ga0207703_11906893All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium570Open in IMG/M
3300026281|Ga0209863_10197505All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium583Open in IMG/M
3300026298|Ga0209236_1068418All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1691Open in IMG/M
3300026327|Ga0209266_1278100All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300026328|Ga0209802_1196217All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium783Open in IMG/M
3300026376|Ga0257167_1007646All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1376Open in IMG/M
3300027516|Ga0207761_1100617Not Available563Open in IMG/M
3300027609|Ga0209221_1079160All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae856Open in IMG/M
3300027635|Ga0209625_1069380All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium788Open in IMG/M
3300027692|Ga0209530_1127156All Organisms → cellular organisms → Bacteria → Acidobacteria718Open in IMG/M
3300027698|Ga0209446_1030557Not Available1351Open in IMG/M
3300027729|Ga0209248_10224862Not Available550Open in IMG/M
3300027846|Ga0209180_10345638All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii848Open in IMG/M
3300027854|Ga0209517_10047184All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3303Open in IMG/M
3300027855|Ga0209693_10022211All Organisms → cellular organisms → Bacteria3062Open in IMG/M
3300027857|Ga0209166_10246884All Organisms → cellular organisms → Bacteria → Acidobacteria949Open in IMG/M
3300027882|Ga0209590_10156189All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1418Open in IMG/M
3300027884|Ga0209275_10110848All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1416Open in IMG/M
3300027905|Ga0209415_10106494All Organisms → cellular organisms → Bacteria → Acidobacteria3042Open in IMG/M
3300027905|Ga0209415_10230915All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1695Open in IMG/M
3300027908|Ga0209006_10694092All Organisms → cellular organisms → Bacteria → Acidobacteria834Open in IMG/M
3300028268|Ga0255348_1036927All Organisms → cellular organisms → Bacteria → Acidobacteria924Open in IMG/M
3300028565|Ga0302145_10333735All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli501Open in IMG/M
3300028566|Ga0302147_10289890Not Available543Open in IMG/M
3300028747|Ga0302219_10046196Not Available1624Open in IMG/M
3300028765|Ga0302198_10552470All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300028769|Ga0302213_1185534All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300028808|Ga0302228_10368666Not Available639Open in IMG/M
3300028906|Ga0308309_10432385All Organisms → cellular organisms → Bacteria → Acidobacteria1132Open in IMG/M
3300028906|Ga0308309_11420600All Organisms → cellular organisms → Bacteria → Acidobacteria594Open in IMG/M
3300029883|Ga0311327_10312316All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1018Open in IMG/M
3300029944|Ga0311352_10068889Not Available3170Open in IMG/M
3300030053|Ga0302177_10128647Not Available1444Open in IMG/M
3300030053|Ga0302177_10723162All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300030399|Ga0311353_11427223Not Available563Open in IMG/M
3300030706|Ga0310039_10144481All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia grimesii966Open in IMG/M
3300030738|Ga0265462_11190238All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300030743|Ga0265461_13658929Not Available522Open in IMG/M
3300030991|Ga0073994_10017936All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae833Open in IMG/M
3300030991|Ga0073994_12308866All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae821Open in IMG/M
3300031040|Ga0265754_1034003All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Alloacidobacterium → Alloacidobacterium dinghuense536Open in IMG/M
3300031231|Ga0170824_106165974All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1118Open in IMG/M
3300031231|Ga0170824_124317521All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3308Open in IMG/M
3300031249|Ga0265339_10119068All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1359Open in IMG/M
3300031344|Ga0265316_10614860All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300031715|Ga0307476_10090940All Organisms → cellular organisms → Bacteria2142Open in IMG/M
3300031718|Ga0307474_11455979All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300031753|Ga0307477_10385265Not Available961Open in IMG/M
3300031754|Ga0307475_10775898All Organisms → cellular organisms → Bacteria → Acidobacteria762Open in IMG/M
3300031754|Ga0307475_10932135All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae685Open in IMG/M
3300031823|Ga0307478_10458934All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300031823|Ga0307478_10741472All Organisms → cellular organisms → Bacteria → Acidobacteria823Open in IMG/M
3300032061|Ga0315540_10327162All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300032160|Ga0311301_11120355All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1021Open in IMG/M
3300032770|Ga0335085_11634543Not Available666Open in IMG/M
3300032828|Ga0335080_10718831All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1039Open in IMG/M
3300032892|Ga0335081_10902245All Organisms → cellular organisms → Bacteria1042Open in IMG/M
3300032897|Ga0335071_10880714All Organisms → cellular organisms → Bacteria → Acidobacteria843Open in IMG/M
3300033826|Ga0334847_022419All Organisms → cellular organisms → Bacteria → Acidobacteria691Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.81%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland5.21%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.21%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.21%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.69%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.65%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.12%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.12%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.60%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.60%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.08%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.08%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.08%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.08%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.08%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.56%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.56%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.56%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.56%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.56%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.56%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.04%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.04%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.04%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.04%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.04%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.04%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.04%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.04%
Salt Marsh SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment0.52%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.52%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.52%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.52%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.52%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.52%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.52%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.52%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.52%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.52%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.52%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.52%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.52%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.52%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300001546Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005890Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300015051Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025414Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025501Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025992Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 (SPAdes)EnvironmentalOpen in IMG/M
3300026015Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026281Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026376Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-BEnvironmentalOpen in IMG/M
3300027516Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes)EnvironmentalOpen in IMG/M
3300027609Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027635Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027692Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028268Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v5EnvironmentalOpen in IMG/M
3300028565Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3EnvironmentalOpen in IMG/M
3300028566Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028765Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2EnvironmentalOpen in IMG/M
3300028769Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_1EnvironmentalOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031040Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300032061Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033826Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 1-5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12269J14319_1004678893300001356Peatlands SoilMRIRRAFPIALGVVIVAAAVTLTVELRKAAPPEPARLLPGADAFVYGNFGWA
JGI12269J14319_1008179473300001356Peatlands SoilMRIRRRLPIPLAVLLIVAAVALIVTLRKHAAPEAARLLP
JGI12712J15308_1009455613300001471Forest SoilMRIRRTLPIFLTVVLVGAAVILAVQLRKXAPPEPARILPGGDAFFYVNLGPI
JGI12659J15293_1011603513300001546Forest SoilMRIRRAFPIALALVIVAAAVTLAVQLRKHAPPEPARLLP
JGI12635J15846_1015348653300001593Forest SoilMRIRRTFPIVLAVVAVAAAVTLAVQLRKHAPPEPA
JGIcombinedJ26739_10100800533300002245Forest SoilMRIRRRLPIFVVLLLVVAAVALIITLRKHAPPEAARLLPGADGFFYVN
JGIcombinedJ26739_10103793813300002245Forest SoilMRIRRTFPIALGVVVVAAAVTVAVQLRKHAPPEAARLLPS
Ga0062385_1027137423300004080Bog Forest SoilMRIRRTFPIALVVVVVAAAVTLAVQLRKHAPPETARLLPGGDAF
Ga0066683_1086878213300005172SoilMRIKRRLPILFGFLLFVAALAAVVELRKHAPPEAARLLPGAD
Ga0066680_1090632623300005174SoilMISFFSTLQMRIRRSFPIFVGVLLVAAALTIIVQLRKHAPPEPARLL
Ga0066673_1062783123300005175SoilMRIRRTLPILAGVLIVAAALTVIVQLRKHAPPEPARLLPGA
Ga0066676_1019056153300005186SoilMRIRRTFPIVLAVVIVAAAVILAVQLRKQAPPECARLLPAGDAFLYANFGWARKTNS
Ga0065704_1055807113300005289Switchgrass RhizosphereMRIKRPLPLIIVVLLVAAAVVFIVQLRKRAPPEPARLLPGADAFFYV
Ga0070670_10087713413300005331Switchgrass RhizosphereMRIRRRLPIWFGVVLVALAIALAVVLRQHAPPEPARLLPGA
Ga0070703_1015484513300005406Corn, Switchgrass And Miscanthus RhizosphereMRVRRPFPIALAVVIIAAALTLAVQLRNHAPPEAARLLPGADA
Ga0070709_1145960713300005434Corn, Switchgrass And Miscanthus RhizosphereMRIRRRLPILFGVVLVIAAIALAVVLRQHAPPEPARLLPG
Ga0070714_10030626713300005435Agricultural SoilMRLRRIFPVLFGLVLFAATVTIIVQLRKHAPPEAARLLPG
Ga0070678_10097035833300005456Miscanthus RhizosphereMRIRRSFPIFLAVVLVGAAVAVMVALRKHAPPEAARLLPGADGFL
Ga0070681_1044069113300005458Corn RhizosphereMRFRRRFPVLFGLLIFLAAIAAVVELRKHAPPEAARLLPGADGF
Ga0070699_10051578113300005518Corn, Switchgrass And Miscanthus RhizosphereMRIKRTLPVLIGVLAIAAAVVAIVQLRKRAPPEAVRLLPGAD
Ga0070733_1046943523300005541Surface SoilMRIRRTLPIALAVVVVAAAVTLAVQLRKDAPPEPA
Ga0070693_10007035623300005547Corn, Switchgrass And Miscanthus RhizosphereMRIGRRLPIWFGVVLVALAIALAVVLRQHAPPEPARLLPGA
Ga0066701_1048281513300005552SoilMRIKRRLPVLFGFLLFVAAVGAVVFLRKHAPPEPARLLPGAD
Ga0066661_1083387213300005554SoilMRIKRSFPIFLGVVVVAAAVTLIVQLRKQAPPEPARLLPGADAFLYVNL
Ga0066670_1064453913300005560SoilMRIKRRLPVLFGFLLFVAAVAAVVFLRKHAPPEPARL
Ga0070664_10051325843300005564Corn RhizosphereMRIRRTFPIVLVVVIVAAAVILAVQLRKQAPPECARLLPAADAFLYANLGWARK
Ga0066703_1009090773300005568SoilMRIRRRLPILIGVVLVIAALALVVQLRKHAPPEPARLLP
Ga0066705_1022580813300005569SoilMRLRRRFPVLFGLLLLIAAVTVAVQLRKHAPPEPAR
Ga0066691_1089423813300005586SoilMRIRRSFPIFVGVLLVAAALTIIVQLRKHAPPEPARLL
Ga0066654_1040651913300005587SoilMRIKRAVPVFLGFLIFVAAVALIIQLRKHAPPEPARLLPGADAF
Ga0068856_10241894013300005614Corn RhizosphereMRIRRTFPIVLVVVIVAAAVILAVQLRKQAPPECARLLPAGDAFLYANF
Ga0068858_10240153413300005842Switchgrass RhizosphereMRIRRRLPILFGVVLVIAAIALAVVLRQHAPPEPARLLPGA
Ga0075285_100169833300005890Rice Paddy SoilMRIRRTLPIVLAVVIVAAALILAVQLRKQAPPECARLLPA
Ga0070766_1098002613300005921SoilMRIRRILPILLAVALITAALTVAVQLRKRAPPEAARLLP
Ga0070717_1061332533300006028Corn, Switchgrass And Miscanthus RhizosphereMRIKRRLPILFGFLLFVAAVAIVVTLRKHAPPEAARLLPGADAF
Ga0066696_1039731523300006032SoilMRIRRSFPIFVGVLLVAAALTIIVQLRKHAPPEPARLLP
Ga0075015_10008043863300006102WatershedsMRIRRTFPIVLVVVIVAAAVTVTVQLRKHAPPESARLLPGADAFLYANFGWARKA
Ga0075018_1038694613300006172WatershedsMRHLRRFRLIVLTVLFVVAMVTVIVQLRKAAPPEAARLLPGADAF
Ga0097621_10213575213300006237Miscanthus RhizosphereMRIRRRLPIWFGVVLVALAIALAVVLRQHAPPEPARLLPGAD
Ga0066659_1122544523300006797SoilMRIRRRLPILFGVVLVTAAVALVVVLRKHAPPEPAR
Ga0066660_1039733613300006800SoilMRFRRRLPILLALVLVAAAVALLVCLRKHAPSEPARL
Ga0075426_1068112433300006903Populus RhizosphereMRLRRRFPILLGVLLIAAAVALLVVLRKHAPPEPARLLPGADS
Ga0075424_10107570933300006904Populus RhizosphereMRIRRTLPIVLAVVIVTAALILAVQLRKQAPPECARLLPAADAFLYANLGWA
Ga0075436_10102606013300006914Populus RhizosphereMRLRRRIPVLIGLLVVLAAIALVVFLRKHAPPESARLLPGADGF
Ga0099827_1052014013300009090Vadose Zone SoilMRVRRPFPIVLAVVIIAAALTLAVQLRKHAPPEAARLLPGADAFL
Ga0116122_120518413300009639PeatlandMRIRRRLPIPLAVLLVVAAIALIVTLRKHAAPEAA
Ga0134080_1057345123300010333Grasslands SoilMRFRRRLPILLAVVLVAAAVALLVFLRKHAPPEPA
Ga0074044_1007069683300010343Bog Forest SoilMRIRRTLPIVLAVVIVGAAVTLTVELRKNAPPEAARLLPGADAFLYANF
Ga0074044_1036268823300010343Bog Forest SoilMRIRRTFPIALAVVVVAAAVTLTVELRKAAPPEPARLLPG
Ga0126370_1016486613300010358Tropical Forest SoilMRIRRSLPIVLSVIAVAAVLTLLVELRKHAPPEPARLLPGADGF
Ga0126372_1305900813300010360Tropical Forest SoilMRIRRTLPIALAVVTVAAAVTLTVELRKNAPPEAARLLPGADA
Ga0126381_10309694333300010376Tropical Forest SoilMRIRRTLPIFLIVVVLLAAVALVYTLRKHAPPESARLLPG
Ga0134127_1090871613300010399Terrestrial SoilMRIKRPLPLIIVVLLVAAAVVFIVQLRKRAPPEPARLLPGADAF
Ga0137365_1083687223300012201Vadose Zone SoilMHIRRSFPIFVGVLLVAAALTIIVQLRKHAPPEPARLLP
Ga0137399_1080314813300012203Vadose Zone SoilMRVRRPFPIVLAVVIIAAALTIAVQLRKHAPPEAARLLPGADA
Ga0137379_1170422823300012209Vadose Zone SoilMRIKRTLPVLIGVLAIAAAVVAVVQLRKRAPPEAVRLLPGADG
Ga0137361_1102239513300012362Vadose Zone SoilMRIRRRLPIPLAVLLIIAAVALIVTLRKHAPPEAARLLPGADG
Ga0163162_1166888813300013306Switchgrass RhizosphereMRIKRPLPLIIVVLLVAAAVVFIVQLRKRAPPEPARLLPGADAFFY
Ga0157375_1289004423300013308Miscanthus RhizosphereMRLRRRLPILIGLLVVLAAIAVVVFLRKHAPPEAARLLPGA
Ga0181538_1008881913300014162BogMRIRRRLLIPLTVLLIVAAVALIVALRKHAPPEAARL
Ga0182008_1055449023300014497RhizosphereMRIRRTFPIVLVVVIVAAAVILAVQLRKQAPPECARLLPAGDAFL
Ga0181525_1065825113300014654BogMRIRRTFPIVLLFVTIVAAVTLAVQLRKHAPPEPARL
Ga0181516_1036143923300014655BogMRIRRTFPIVLAVVAIAAAVTLAVQLRKHAPPEPARLLP
Ga0181522_1078441613300014657BogMPIRRTFPIVLAVVVIAAAVTLAVQLRKHAPPEAARLLPGADGFFYL
Ga0137414_124924143300015051Vadose Zone SoilMRIRRTFPIVLAVVVIAAAVTLAVQLRKHAPPEPARLLPGADAFF
Ga0137403_1126279513300015264Vadose Zone SoilMWRFRRFRLLALSVLLVAAIVTVVVQLRKIAPPEGARLLPGADAFVYVDLQWARR
Ga0134072_1013837813300015357Grasslands SoilMRFRRRLPILLAVVLVVAAVALLVFLRKHAPPEPARL
Ga0134072_1034039613300015357Grasslands SoilMRIRRRLPILFGVVVVTAAVALVVVLRKHAPPEPARLLPGADGY
Ga0134089_1033674123300015358Grasslands SoilMRIRRSFPIFVGVLLVAAALTIIVQLRKHAPPEPAR
Ga0132255_10425268813300015374Arabidopsis RhizosphereMRIRRSFPIFLAVVLVGAAVAVMVALRKHAPPEAARLLPGADGFLYI
Ga0182035_1198753223300016341SoilMRFRRRIPVLLGLAIFLAAVFAVVELRKHAPPEPARLLPGAAGFLY
Ga0187806_122672113300017928Freshwater SedimentMRIRRTLPLVLTVVVIAAAVTIAVQLRKHAPPEPARLLPGGDAF
Ga0187803_1046630913300017934Freshwater SedimentMRIRRHLLIPLVVVLIAAGVALIVTLRKHAPPEAARL
Ga0187848_1040068913300017935PeatlandMRIRRTLPVFVFVVLITAAVFIAVQLRKHAPPEAARLLPGADAFIYADLTW
Ga0187853_1045311613300017940PeatlandMRIRRRLLIPLTVLLIVAAVALIVVLRMHAPPEAARLLPGA
Ga0187779_1059257613300017959Tropical PeatlandMRIRRSLPIVVAVLLVAAAVALLVVLRKHAPPEPARLLPGA
Ga0187779_1105920813300017959Tropical PeatlandMRIRRAYPITLAVVIVAAAVTVAVQLRKNAPPEPAR
Ga0187783_1051832433300017970Tropical PeatlandMRLKRTLPLALAVVIVAAAIVAAVQLRKHAPPEAARLLPGGDAFFYVNYNWIRR
Ga0187780_1072726913300017973Tropical PeatlandMRLRRRLPIILGVLRVAAAVALVVVLRKHAPPESAR
Ga0187780_1104421413300017973Tropical PeatlandMRIRRRLPIVFGVLLVAGAVAVVVILRKHAPPEAARLLPGADGFAYIDLQWM
Ga0187782_1011826513300017975Tropical PeatlandMRIRRRLLIPLIVLLIAAAVALIVVLRMHAPPEAARLLPSAD
Ga0187782_1061549723300017975Tropical PeatlandMRIRRAFPIALAVVIVAAAITIAVELRKDAPPEAARLLPGADAFLYADFGW
Ga0187822_1002212013300017994Freshwater SedimentMRIRRTFPIVLAVVIVAAAVILAVQLRKQAPPECARLLPAGDAFLYANLGWARK
Ga0187816_1011742913300017995Freshwater SedimentMRIRRRLPIILAVLLVVAALAIAVVLRKHAPPEAARLLPGG
Ga0187816_1016842913300017995Freshwater SedimentMRIRRRLPLVLAVLVIAAAVALIVTLRKHAPPEAAR
Ga0187888_131868813300018008PeatlandMRIRRTLPVVLAVVVIAAALTLAVQLRKHAPPEAARLLP
Ga0187873_124755433300018013PeatlandMRIRRRLLIPLIVLLIAAVVALIVVLRMHAPPEAARLL
Ga0187889_1030877813300018023PeatlandMRIRRRLLIPLTVLLIVAAVASIVVLRMHAPPEAARLLPGAD
Ga0187889_1052681413300018023PeatlandMRIRRTLSSALAVVVVAAAVTLTVQLRKSAPPEAARLLPAADGFFYA
Ga0187867_1014299763300018033PeatlandMRIRRRLLIPLIVLLLVAAVALIVTLRKNAPPEAA
Ga0187883_1037616223300018037PeatlandMRIRRTFPIALAVVVIAAAVFVAVQLRKHAPPEPARLLPG
Ga0187887_1086078813300018043PeatlandMRIRRRLLIPLSVLLIVVAVALIVALRKHAPPEAA
Ga0187859_1010928523300018047PeatlandMSPASADAMRIRRTLPILIALLVVAAAVTAIVLLLGQAPPEAARLLPGAD
Ga0187784_1032998113300018062Tropical PeatlandMRIRSAFPITLAVVMVAAAVTVAVQLRKHAPPEPARLLP
Ga0187769_1115383323300018086Tropical PeatlandMRIRRTLPIVLAVVAIAAAVTLAVQLRTHAPPEAARLLPGADAFF
Ga0187771_1030402563300018088Tropical PeatlandMRIRRTLPIILTVLVIAAAITVAVELRKHAPPEAARL
Ga0066655_1103422223300018431Grasslands SoilMRIRRSFPIFVGVLLVAAALTIIVQLRKHAPPEPARLLPG
Ga0066662_1293211713300018468Grasslands SoilMRIRRRLPIIIGVLAVIAAVAIVVELRRHAPPEPARLL
Ga0182031_111469743300019787BogMRIRRRLLIPLIVLLLVAAVALIVTLRKNAPPEAARLL
Ga0179592_1047513223300020199Vadose Zone SoilMRVRRPFPIVLAVVIIAAALTLAVQLRKHAPPEAAR
Ga0210403_1046680913300020580SoilMRIRPTFLIVLAVVVLAASVTLAVQLRKHAPPEPARLLPGADAFFYLDLSWARR
Ga0210403_1128393513300020580SoilMRIRRIFPIALVVVVVAAAVTLTVELRKAAPPVPA
Ga0210395_1049242123300020582SoilMRIRPTFLIVLAVVVLAASVTLAVQLRKHAPPEPARLLPGADAFFYLDLSWARRANA
Ga0210401_1107739713300020583SoilMRIRRAFPITLAIVTVAAAVTLAVQLRKIAPPEPARLLP
Ga0210401_1110187213300020583SoilMRKRRSLPIFLTAILVAAVLVLLVQLRKHAPPEPARLLPSADGFF
Ga0210405_1111099313300021171SoilMRIRRIFPIALVVVVVAAAVTLTVELRKAAPPEPARLLPGADAFVYADFS
Ga0210408_1149772913300021178SoilMAPRTSYFMRIRRRLPILFGVVLVIAAIALAVVLRKHAPPEPARLLP
Ga0210396_1022457013300021180SoilMRIRRTFPIALGVVVVAAAVTLAVQLRKHAPPEPARLLPSA
Ga0210388_1080129613300021181SoilMRIRRRLPIFLAVLLIASAVALAVVLRKHAPPEPARL
Ga0210393_1023588713300021401SoilMRIRRAFPITLAIVIVAAAVTLAVQLRKIAPPEPARLLPGADG
Ga0210383_1152177313300021407SoilMRFRRRLPILIVVLLIAGAIALLVTLRKHAPPEAARLLPGADGFF
Ga0210383_1155631813300021407SoilMRIRRTLPIFLTVVLVAAAVILAVQLRKHAPPEAARLLPGGDVFFYANLGRIRKAN
Ga0210394_1050578613300021420SoilMRIRRTFPLVLAVVVIAGAVVLAVQLRKHAPPEPARLLPG
Ga0210384_1017848413300021432SoilMRIRRSLPVVLGVVAVAAALTLIVQLRKHAPPEPARLLPGADGF
Ga0210410_1001920493300021479SoilMRIRRTFPIALVVVIVAAALVIAVQLRKHAPPEPARLLP
Ga0210409_1039601513300021559SoilMRIRRRLPIPLAVLLIVAAVALIVTLRKHAPPEAARL
Ga0126371_1048792913300021560Tropical Forest SoilMRIRRTLPVVLAVAVVAAAVIVAVQLRKAAPPEPARLLPGADGFLYAD
Ga0212123_1049577313300022557Iron-Sulfur Acid SpringMRIRRVFPITLALVVVAAALTLAVQLRKHAPPEAARLLPSADAFVFANLG
Ga0224556_103216723300024295SoilMRIRRTFPIVLAVLVIAAAVTLAVQLRKHAPPEAARLLPGGDAYFYLDLSW
Ga0207697_1028428623300025315Corn, Switchgrass And Miscanthus RhizosphereMRFRRKLPILAGILVIAIAVAVVVFLRKHAPPEAA
Ga0208935_103369023300025414PeatlandMRIRRTLPVVLAVVVIAAAVTLAVQLRKHAPPEAARLLPGAD
Ga0208563_106001813300025501PeatlandMRIRRTLPVFVFVVLITAAVFIAVQLRKHAPPEAARLLPGADAFIYADLTWV
Ga0207695_1043089913300025913Corn RhizosphereMRIRRTFPIVLAVVIVAAAVILAVQLRKQAPPECARLLPAGDAFLYANFGWA
Ga0207671_1053639643300025914Corn RhizosphereMRIRRTFPIVLVVVIVAAAVILAVQLRKQAPPECARLL
Ga0207664_1101218613300025929Agricultural SoilMRIRRTYPIALVVVIVAAAVTLAVQLRKHAPPEPAR
Ga0207664_1178702413300025929Agricultural SoilMRIRRTFPIVLAVVIVAAAVILAVQLRKPAPPECARLL
Ga0207686_1010105723300025934Miscanthus RhizosphereMRIRRRLPIWFGVVLVALAIAAAVVLRQHAPPEPAR
Ga0207665_1154418123300025939Corn, Switchgrass And Miscanthus RhizosphereMRIRRTFPIVLAVVIVAAAVILAVQLRKQAPPECARLLPAGDAFLYANFGWARKTNSEA
Ga0207711_1050535543300025941Switchgrass RhizosphereMRIRRRLPIILGVVLVAAAVVVVVQLRKHAPPEPARLLPS
Ga0207689_1048449153300025942Miscanthus RhizosphereMRLRRRLPIFIGLLVVVAAIAVVVLLRKHAPPEAAR
Ga0207667_1125129223300025949Corn RhizosphereMRIRRTLPIVLAVVIVAAALILAVQLRKQAPPECARLLPAADAFLY
Ga0208775_101967613300025992Rice Paddy SoilMRIRRTLPIVLAVVIVAAALILAVQLRKQAPPECARLLPAAD
Ga0208286_101023713300026015Rice Paddy SoilMRLRRRLPLIIGVLLVVAAVAVVVVLRKHAPPEAAR
Ga0207703_1190689313300026035Switchgrass RhizosphereMRIRRRLPILFGVVLVIAAIALAVVLRQHAPPEHARLLPGADGY
Ga0209863_1019750513300026281Prmafrost SoilMRIRRRLPILFGVVLVIAAIALAVVLRKHAPPEPARLLPGA
Ga0209236_106841833300026298Grasslands SoilMRIRRSLPILLAVLLIAAAVALVVVLRKHAPPEPARLLPG
Ga0209266_127810023300026327SoilMRIKRRLPILFGFLLFVAALAAVVELRKHAPPEAARLLPGADAFVY
Ga0209802_119621713300026328SoilMRIRRSFPIFVGVLLVAAALTIIVQLRKHAPPEPARLLPGA
Ga0257167_100764613300026376SoilMRIRRRLPIPLAVLLFVAAVALIVTLRKHAPPEAARLLP
Ga0207761_110061733300027516Tropical Forest SoilMRIKRTLPVLIGVLVLAATVVVLVQLRKHAPPEPAR
Ga0209221_107916023300027609Forest SoilMRIRRPLPLVLVVVVVAAAVTVAVQLRKSAPPEPARL
Ga0209625_106938023300027635Forest SoilMRIRRTFPIVLAVVAVAAAVTLAVQLRKHAPPEPARLLPGADAFFY
Ga0209530_112715623300027692Forest SoilMRIRRTFPIALGVVVIAAAVFLAVQLRKHAPPEPARLLPGA
Ga0209446_103055763300027698Bog Forest SoilMRIRRHLLIPLIVLLIVGAVALIVVLRKQAPPEAA
Ga0209248_1022486213300027729Bog Forest SoilMRIRRSLPILLAVAVVAAAVALMVVLRKHAPPEPARL
Ga0209180_1034563813300027846Vadose Zone SoilMRIKRSLPILLAVLLVAAAVALVVVLRKHAPPEPARLL
Ga0209517_1004718413300027854Peatlands SoilMRIRRTLPIVCGVLLIVAALILAVQLRKHAPPEPARL
Ga0209693_1002221143300027855SoilMRIRRTFPLVLAVVVVAAAVTVAVQLRKNAPPEPARLLPGAD
Ga0209166_1024688443300027857Surface SoilMRIRRAFPLTLALVIVAAAVTLAVQLRKQAPPEPARLLPG
Ga0209590_1015618913300027882Vadose Zone SoilMRLRTKRTLPIVFGVLLIAAAVTLAVQLRKHAPPEPARLLPGADG
Ga0209275_1011084823300027884SoilMRVRSPFPLVLAVVVVAAAVTVAVQLRKNAPPEPARLLPGADAFMY
Ga0209415_1010649413300027905Peatlands SoilMRIRRAFPIALAVVTVGAAVTLAVQLRKHAPPEPARLLPG
Ga0209415_1023091513300027905Peatlands SoilMRIRPTFPIALAVVVVAASVTLAVQLRKHAPPEAARLLPGADAFFYLDLN
Ga0209006_1069409233300027908Forest SoilMRIRRAFPITLAIVTVAAAVTLAVQLRKIAPPEPARLLPGADGFVY
Ga0255348_103692733300028268SoilMRIRRRLLIPLIVLLLVAAVALIVTLRKNAPPEAARLLPGADGF
Ga0302145_1033373523300028565BogMRIRRTFPIVLAVVAIAAAVTLAVQLRKHAPPEPARLLPGADAF
Ga0302147_1028989013300028566BogMRIRRTLPIVVLVLAIAAAVTFAVQLRKHAPPEPAR
Ga0302219_1004619613300028747PalsaMRIRRRLPIFLAVVLIAAAVALIVTLRKHAPPEAA
Ga0302198_1055247013300028765BogMRIRRTLPIVVLVLAIAAAVTFAVQLRKHAPPEPARLLPGADAF
Ga0302213_118553413300028769FenMRIKRILPVLIAVLLIAAAITALVQLRKHAPPEAARLLPGADGFFYIN
Ga0302228_1036866613300028808PalsaMRIRRPFPLVLAVVVVAAAVTVAVQLRKNAPPEPARLLPG
Ga0308309_1043238523300028906SoilMRIRRPYPIALAVVIVAAALTLAVQLRKSAPPEPARLLPGADAFFY
Ga0308309_1142060023300028906SoilMRIRRTLPIFLTVGLVGAAVILAVQLRKHAPPEPARILPGGDAFFYVNLGPIRR
Ga0311327_1031231623300029883BogMRIRRTFPIVVAVLVIAAAVTLAVQLRKHAPPEVTLIFISI
Ga0311352_1006888913300029944PalsaMRIRRHLLIPLVVLLLGAAVALIVTLRKHAPPEAA
Ga0302177_1012864733300030053PalsaMRKRRTLPIVLAVLIVAAAIVAAVQLRKHAPPEAARLLP
Ga0302177_1072316223300030053PalsaMRIRRRLLIPLSVLLIVAAVALIVALRKQAPPEAARLLPGADGF
Ga0311353_1142722323300030399PalsaMRIRRRLPIPLVVLLIVAVVALIVTLRKHAPPEAARLL
Ga0310039_1014448123300030706Peatlands SoilMRIRRTLPTALAVVVVAAAVTLAVQLRKLAPPEPARLLPGAD
Ga0265462_1119023813300030738SoilMRIRRTFPIVLLFVVIVAAVTLAVQLRKHAPPEPARLLPGADA
Ga0265461_1365892913300030743SoilMRIRRTFPVVLAVVVIAAAVTLAVQLRKHAPPEPAR
Ga0073994_1001793633300030991SoilMRIRRTLPIALGVVIVAAAVTLAVQLRKHAPPESARLLPGGDAFLYLNLGWARKANGGNNLPAV
Ga0073994_1230886613300030991SoilMRIRRAFPIALALVIVTAAVTLAVQLRKHAPPEAARLLPGADAFVYGNFVWARKANGGKLLLPV
Ga0265754_103400313300031040SoilMRIRRRLPIILAVLLIAAAVALAVVLRKHAPPEPARL
Ga0170824_10616597423300031231Forest SoilMRIRRTFPIALAVVAVAAALTFAVQLRKNAPPEPARLLPGADAFVYGDLGWARKM
Ga0170824_12431752113300031231Forest SoilMRIRRTFPIALAVVVVGAAVTLAVQLRKHAPPEPARLLPGA
Ga0265339_1011906823300031249RhizosphereMRIRRTLPIVLAVVVIAAAVTVAVQLRKSAPPEPARLLPGADAF
Ga0265316_1061486023300031344RhizosphereMRIRRTLPIVLAVVVIAAAVTVAVQLRKSAPPEPARLLPGADAFV
Ga0307476_1009094083300031715Hardwood Forest SoilMRIRRSLPIALVVVIVAAAVTLTVELRKSAPPEAARLLPGADAFLYANL
Ga0307474_1145597923300031718Hardwood Forest SoilMRIRRTFPIALVVVIVAAAVILAVQLRKHAPPEAARLLPGA
Ga0307477_1038526513300031753Hardwood Forest SoilMRIRRTFPIVLAVVVIAAAVTLAVQLRKHAPPEPARLL
Ga0307475_1077589813300031754Hardwood Forest SoilMRIRRSLPILFGVLLIAASVALVVVLRKHAPPEPA
Ga0307475_1093213523300031754Hardwood Forest SoilMRIRRTFPLALAVVIVAAAVTLAVQLRKHAPPEAARLLPGADSFFYLDLGRARRAN
Ga0307478_1045893433300031823Hardwood Forest SoilMRIKRALPVLFGFLIFVAAVALIVQLRKHAPPEPARLL
Ga0307478_1074147223300031823Hardwood Forest SoilMRIRRTFPIVVAVAVVAAAVTLAVQLRKHAPPEPARLLPAAD
Ga0315540_1032716223300032061Salt Marsh SedimentMLRTPFMRIKRRLPILLGVLVVAAAVAVVVVLRKH
Ga0311301_1112035523300032160Peatlands SoilMRIRRTLPIALAVVVVAAAVTLAVQLRKDAPPEPARLL
Ga0335085_1163454313300032770SoilMRIRRTLPVLIVVLAIAAAVVAIVQLRKRAPPEAARLLPG
Ga0335080_1071883113300032828SoilMRIKRTLPVLIAVLLIVAAIVALVQLRKHAPPEAARLLP
Ga0335081_1090224543300032892SoilMRLKRSYPVLVAVLLVAAAIALVVVLRKHAPPEPARLLPSAD
Ga0335071_1088071443300032897SoilMRFKRSLPILLAVLVVAGAVALVVVLRKHAPPEAARLLPGAD
Ga0334847_022419_2_1543300033826SoilMRIRRTLPIALAVVIVAAAVTVAVQLRKHAPPEAARLLPGADAFLYADFSW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.