| Basic Information | |
|---|---|
| Family ID | F028281 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 192 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MAEMTIAPVATHGFFVDGRWHEDGDIVEIRAPYDGSVIARVVQ |
| Number of Associated Samples | 158 |
| Number of Associated Scaffolds | 192 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.44 % |
| % of genes near scaffold ends (potentially truncated) | 98.44 % |
| % of genes from short scaffolds (< 2000 bps) | 91.15 % |
| Associated GOLD sequencing projects | 149 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.375 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.021 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.396 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.646 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 26.76% Coil/Unstructured: 73.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 192 Family Scaffolds |
|---|---|---|
| PF01425 | Amidase | 66.15 |
| PF02627 | CMD | 19.27 |
| PF01266 | DAO | 4.69 |
| PF13432 | TPR_16 | 1.04 |
| PF13620 | CarboxypepD_reg | 0.52 |
| PF01850 | PIN | 0.52 |
| PF00483 | NTP_transferase | 0.52 |
| PF00171 | Aldedh | 0.52 |
| PF07963 | N_methyl | 0.52 |
| PF14559 | TPR_19 | 0.52 |
| PF04237 | YjbR | 0.52 |
| PF15919 | HicB_lk_antitox | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 192 Family Scaffolds |
|---|---|---|---|
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 66.15 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 19.27 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 19.27 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.52 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.52 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.52 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.38 % |
| Unclassified | root | N/A | 15.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459023|GZGNO2B02G4DBT | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105097539 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300000567|JGI12270J11330_10269715 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300000955|JGI1027J12803_104695707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 736 | Open in IMG/M |
| 3300000955|JGI1027J12803_107038693 | Not Available | 527 | Open in IMG/M |
| 3300001174|JGI12679J13547_1001633 | Not Available | 1196 | Open in IMG/M |
| 3300001661|JGI12053J15887_10649258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 501 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100334061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1397 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101628092 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300004080|Ga0062385_10126853 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300004082|Ga0062384_100241648 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300004082|Ga0062384_101041988 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300004092|Ga0062389_103910348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 560 | Open in IMG/M |
| 3300004633|Ga0066395_10634702 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300005181|Ga0066678_10836979 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300005454|Ga0066687_10143669 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300005468|Ga0070707_100779437 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300005533|Ga0070734_10633034 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300005541|Ga0070733_10308722 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300005542|Ga0070732_10646763 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300005542|Ga0070732_10907119 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005561|Ga0066699_10249973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1251 | Open in IMG/M |
| 3300005591|Ga0070761_10593095 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300005602|Ga0070762_10461186 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300005874|Ga0075288_1060973 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300005875|Ga0075293_1012948 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300006052|Ga0075029_100023304 | All Organisms → cellular organisms → Bacteria | 3478 | Open in IMG/M |
| 3300006052|Ga0075029_101329393 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300006059|Ga0075017_101678399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Clostridiales Family XVII. Incertae Sedis → Thermaerobacter → Thermaerobacter subterraneus | 502 | Open in IMG/M |
| 3300006102|Ga0075015_100218080 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300006162|Ga0075030_100533091 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300006173|Ga0070716_100209562 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
| 3300006174|Ga0075014_100392879 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300006176|Ga0070765_100174414 | All Organisms → cellular organisms → Bacteria | 1936 | Open in IMG/M |
| 3300009038|Ga0099829_10326731 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300009521|Ga0116222_1012509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3960 | Open in IMG/M |
| 3300009521|Ga0116222_1304028 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300009521|Ga0116222_1555130 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300009616|Ga0116111_1137547 | Not Available | 587 | Open in IMG/M |
| 3300009618|Ga0116127_1091555 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300009623|Ga0116133_1169467 | Not Available | 578 | Open in IMG/M |
| 3300009759|Ga0116101_1033378 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300009839|Ga0116223_10153059 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300010048|Ga0126373_10994433 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300010159|Ga0099796_10539920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300010341|Ga0074045_10191624 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300010341|Ga0074045_10405775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 883 | Open in IMG/M |
| 3300010341|Ga0074045_11038820 | Not Available | 514 | Open in IMG/M |
| 3300010343|Ga0074044_10364110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 948 | Open in IMG/M |
| 3300010343|Ga0074044_10474800 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300010359|Ga0126376_10270452 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
| 3300010360|Ga0126372_13217055 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300010376|Ga0126381_100037212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5870 | Open in IMG/M |
| 3300011271|Ga0137393_10584499 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300012200|Ga0137382_10023926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3553 | Open in IMG/M |
| 3300012200|Ga0137382_10621126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300012353|Ga0137367_10415027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
| 3300012362|Ga0137361_11351534 | Not Available | 636 | Open in IMG/M |
| 3300012683|Ga0137398_10539906 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300012925|Ga0137419_10226723 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
| 3300012927|Ga0137416_10966725 | Not Available | 759 | Open in IMG/M |
| 3300012930|Ga0137407_11755523 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300012971|Ga0126369_11109621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
| 3300013307|Ga0157372_10466284 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
| 3300014158|Ga0181521_10618250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300014162|Ga0181538_10139700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1397 | Open in IMG/M |
| 3300014169|Ga0181531_10319713 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300014200|Ga0181526_10808463 | Not Available | 590 | Open in IMG/M |
| 3300014490|Ga0182010_10483639 | Not Available | 683 | Open in IMG/M |
| 3300014838|Ga0182030_10126777 | All Organisms → cellular organisms → Bacteria | 3366 | Open in IMG/M |
| 3300015372|Ga0132256_100517342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1305 | Open in IMG/M |
| 3300015372|Ga0132256_101627614 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300016319|Ga0182033_11738270 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300016319|Ga0182033_11792537 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300016702|Ga0181511_1029828 | Not Available | 635 | Open in IMG/M |
| 3300017823|Ga0187818_10057942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1666 | Open in IMG/M |
| 3300017823|Ga0187818_10589277 | Not Available | 502 | Open in IMG/M |
| 3300017932|Ga0187814_10229838 | Not Available | 700 | Open in IMG/M |
| 3300017935|Ga0187848_10411055 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300017941|Ga0187850_10042134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2411 | Open in IMG/M |
| 3300017942|Ga0187808_10422137 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300017943|Ga0187819_10087659 | All Organisms → cellular organisms → Bacteria | 1858 | Open in IMG/M |
| 3300017946|Ga0187879_10004351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9466 | Open in IMG/M |
| 3300017959|Ga0187779_10908159 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300017966|Ga0187776_10460022 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300017975|Ga0187782_10489060 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300017975|Ga0187782_10935283 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300017975|Ga0187782_11090790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300018022|Ga0187864_10313014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 697 | Open in IMG/M |
| 3300018030|Ga0187869_10579354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300018034|Ga0187863_10141799 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
| 3300018035|Ga0187875_10649381 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300018037|Ga0187883_10004697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8061 | Open in IMG/M |
| 3300018042|Ga0187871_10668388 | Not Available | 577 | Open in IMG/M |
| 3300018043|Ga0187887_10962925 | Not Available | 505 | Open in IMG/M |
| 3300018057|Ga0187858_10394093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
| 3300018085|Ga0187772_10295375 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300018085|Ga0187772_10404645 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300018085|Ga0187772_11391484 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300018090|Ga0187770_10202736 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300019786|Ga0182025_1143609 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300019786|Ga0182025_1210099 | All Organisms → cellular organisms → Bacteria | 2863 | Open in IMG/M |
| 3300019787|Ga0182031_1518645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2929 | Open in IMG/M |
| 3300020199|Ga0179592_10520275 | Not Available | 508 | Open in IMG/M |
| 3300020581|Ga0210399_11383787 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300020582|Ga0210395_10185609 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
| 3300020582|Ga0210395_10625395 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300020583|Ga0210401_10359429 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300020583|Ga0210401_10435383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1174 | Open in IMG/M |
| 3300021088|Ga0210404_10471482 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300021088|Ga0210404_10810187 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300021180|Ga0210396_10194978 | All Organisms → cellular organisms → Bacteria | 1811 | Open in IMG/M |
| 3300021180|Ga0210396_11529065 | Not Available | 547 | Open in IMG/M |
| 3300021402|Ga0210385_11107506 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300021403|Ga0210397_10943743 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300021407|Ga0210383_11480635 | Not Available | 562 | Open in IMG/M |
| 3300021432|Ga0210384_11046142 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300021433|Ga0210391_10425930 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300021433|Ga0210391_11369419 | Not Available | 544 | Open in IMG/M |
| 3300021474|Ga0210390_10648516 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300021475|Ga0210392_10521319 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300021479|Ga0210410_10234852 | All Organisms → cellular organisms → Bacteria | 1644 | Open in IMG/M |
| 3300021479|Ga0210410_10849179 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300021479|Ga0210410_11839953 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300022850|Ga0224552_1063218 | Not Available | 525 | Open in IMG/M |
| 3300025414|Ga0208935_1029301 | Not Available | 729 | Open in IMG/M |
| 3300025506|Ga0208937_1031352 | Not Available | 1295 | Open in IMG/M |
| 3300025581|Ga0208355_1054136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
| 3300025910|Ga0207684_10650101 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300025922|Ga0207646_10066017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3230 | Open in IMG/M |
| 3300026301|Ga0209238_1074879 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300026304|Ga0209240_1122263 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300026330|Ga0209473_1153106 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300026333|Ga0209158_1353828 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300026356|Ga0257150_1076383 | Not Available | 509 | Open in IMG/M |
| 3300026446|Ga0257178_1035865 | Not Available | 626 | Open in IMG/M |
| 3300026552|Ga0209577_10049457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3556 | Open in IMG/M |
| 3300026557|Ga0179587_10393545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
| 3300027064|Ga0208724_1026904 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300027432|Ga0209421_1078401 | Not Available | 669 | Open in IMG/M |
| 3300027681|Ga0208991_1113740 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300027692|Ga0209530_1051186 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300027812|Ga0209656_10005716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7984 | Open in IMG/M |
| 3300027812|Ga0209656_10529838 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300027884|Ga0209275_10377940 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300027895|Ga0209624_10613487 | Not Available | 721 | Open in IMG/M |
| 3300027895|Ga0209624_10846735 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300027898|Ga0209067_10007610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5851 | Open in IMG/M |
| 3300027911|Ga0209698_10031856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4814 | Open in IMG/M |
| 3300027911|Ga0209698_11103310 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300028047|Ga0209526_10980388 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300028731|Ga0302301_1062870 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300028801|Ga0302226_10266212 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300028806|Ga0302221_10173690 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300028863|Ga0302218_10168446 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300028906|Ga0308309_10192285 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
| 3300028906|Ga0308309_10516559 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300029911|Ga0311361_10218454 | All Organisms → cellular organisms → Bacteria | 2304 | Open in IMG/M |
| 3300029917|Ga0311326_10274526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300029943|Ga0311340_10648184 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300030399|Ga0311353_10488709 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300030507|Ga0302192_10363082 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300030862|Ga0265753_1057683 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300030991|Ga0073994_12039554 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300031028|Ga0302180_10492728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300031057|Ga0170834_112789527 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300031234|Ga0302325_13307556 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium | 511 | Open in IMG/M |
| 3300031236|Ga0302324_102316944 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300031525|Ga0302326_13549968 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300031543|Ga0318516_10659798 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300031708|Ga0310686_110677636 | All Organisms → cellular organisms → Bacteria | 2363 | Open in IMG/M |
| 3300031716|Ga0310813_11289181 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300031718|Ga0307474_10779587 | Not Available | 756 | Open in IMG/M |
| 3300031718|Ga0307474_10811347 | Not Available | 740 | Open in IMG/M |
| 3300031751|Ga0318494_10187147 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300031753|Ga0307477_10343990 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300031753|Ga0307477_10539710 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300031753|Ga0307477_10745455 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300031823|Ga0307478_10128536 | All Organisms → cellular organisms → Bacteria | 1993 | Open in IMG/M |
| 3300031823|Ga0307478_10201400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1602 | Open in IMG/M |
| 3300031962|Ga0307479_10991654 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300032076|Ga0306924_11900058 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300032261|Ga0306920_100491212 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
| 3300032401|Ga0315275_12683496 | Not Available | 512 | Open in IMG/M |
| 3300032828|Ga0335080_11203995 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300032829|Ga0335070_10331613 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
| 3300032898|Ga0335072_10667624 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300033134|Ga0335073_12136812 | Not Available | 505 | Open in IMG/M |
| 3300033158|Ga0335077_10766646 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300033405|Ga0326727_10936800 | Not Available | 642 | Open in IMG/M |
| 3300033412|Ga0310810_10770016 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300034163|Ga0370515_0391273 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.02% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.77% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.25% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.73% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.21% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.17% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.12% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.12% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.60% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.60% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.60% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.08% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.08% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.04% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.04% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.04% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.04% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.04% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.52% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.52% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.52% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.52% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.52% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.52% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001174 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
| 3300005875 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022850 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 1-5 | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025581 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027064 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FA3_01811530 | 2170459023 | Grass Soil | MSDVTIAPVATHGFFVDGRWQEDGDLVEVRAPYDGGLIA |
| INPhiseqgaiiFebDRAFT_1050975392 | 3300000364 | Soil | MAEMTVAPVATHGFFVDGRWQQDGDLVEIRAPYDGSLIARV |
| JGI12270J11330_102697151 | 3300000567 | Peatlands Soil | MAEMTIAPVATHGFFVDGRWREDGDIVEIHAPYDGALIARVV |
| JGI1027J12803_1046957073 | 3300000955 | Soil | MAELTIAPVATHGFFIDGKWVEEGDIVEVRAPYDGTVI |
| JGI1027J12803_1070386932 | 3300000955 | Soil | MAEMTIAPVATHGFFVDGRWQQEGDIVEIRAPYDASL |
| JGI12679J13547_10016333 | 3300001174 | Forest Soil | MAEMTIAPVATHGFFVDGRWRDDGDVVEIRAPYDGAVIA |
| JGI12053J15887_106492581 | 3300001661 | Forest Soil | MSEMTVTPVATHGFFMDGRWLEEGDLVDVRAPYDGAVIAHVYQG |
| JGIcombinedJ26739_1003340611 | 3300002245 | Forest Soil | MTMIPVATHGFYVDGKWLDEGDIVEIHAPYDGAVIA |
| JGIcombinedJ26739_1016280921 | 3300002245 | Forest Soil | MADMTIAPVATHGFFVDGRWVEDGDIVEVRSPFDGSVIGRVVQG |
| Ga0062385_101268532 | 3300004080 | Bog Forest Soil | MAEMTLTPVATHGFFVDGHWSEDGDILEVRSPFDGAVVGRVV |
| Ga0062384_1002416481 | 3300004082 | Bog Forest Soil | MAELTIAPVATHGFYLDGKWVEDGDVVEVRAPYDGSVIARVVQGRREH |
| Ga0062384_1010419881 | 3300004082 | Bog Forest Soil | MAEMTLTPVATHGFFVDGRWMEDGDILEVRSPFDGAVVGR |
| Ga0062389_1039103481 | 3300004092 | Bog Forest Soil | MAEMTVTPVATHGFFLDGKWLEEGDLVDVRAPYDGALIAHVYRG |
| Ga0066395_106347022 | 3300004633 | Tropical Forest Soil | MAEMTIAPVATHGFFVDGRWQQEGDLVEIHAPYDGSLIAR |
| Ga0066678_108369791 | 3300005181 | Soil | MAQMTITPVATHGFLVDGRWIEDGNLVEVRAPYDGAVIGRVFQG |
| Ga0066687_101436692 | 3300005454 | Soil | MAEMTIAPVATHGFFVDGRWQQEGDIVEIRSPYDGNLIARVSQGRKQHAE |
| Ga0070707_1007794372 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEMTIAPVATHGFFVDGRWWEDGDLVEIRAPYDGGLIARVVQGRRE |
| Ga0070734_106330342 | 3300005533 | Surface Soil | MAEMTIAPVATHGFFVDGHWREDGDVVEIHAPYDGSLIARVV |
| Ga0070733_103087222 | 3300005541 | Surface Soil | MAELTIAPVATYGFFVDGRWQEDGDLVEIRAPYDG |
| Ga0070732_106467631 | 3300005542 | Surface Soil | MAEMTIAPVAMHGFFVDGRWWDDGDLVEIRSPYDGTLIARVVQG |
| Ga0070732_109071191 | 3300005542 | Surface Soil | MAEMTIAPVATHGFFVDGRWKEDGDIVEIHAPYDGSLIARVVQ |
| Ga0066699_102499733 | 3300005561 | Soil | MAEMTVIPVATHGFFMDGKWLEEGDIVDVRAPYDGALIAH |
| Ga0070761_105930952 | 3300005591 | Soil | MAEMTLAPVATHGFFVDGRWMEDGDIVEVRAPFDGSI |
| Ga0070762_104611862 | 3300005602 | Soil | MAEMTLAPVATHGFFVDGRWIEDGDIVDVRAPFDGSVIGRVVQ |
| Ga0075288_10609732 | 3300005874 | Rice Paddy Soil | MAEMTIAPVATHGFFVDGRWQQEGDLVDIRSPYDGSLIARVTQ |
| Ga0075293_10129482 | 3300005875 | Rice Paddy Soil | MAEMTIAPVATHGFFVDGRWQQEGDLVDIRSPYDGSLIARV |
| Ga0075029_1000233044 | 3300006052 | Watersheds | MAEMTIAPVATHGFFVDGRWWDDGDSVEIRAPYDGTLIARVMQGRR |
| Ga0075029_1013293931 | 3300006052 | Watersheds | MAEMTIAPVATHGFFLDGQWRDDGDLVDIRSPYDGSLIAHVVQG |
| Ga0075017_1016783991 | 3300006059 | Watersheds | MAQMTATPVGTHGFFVDGKWIEDGDLVEIRAPYDGSVI |
| Ga0075015_1002180801 | 3300006102 | Watersheds | MAEMTIAPVATHGFFVDGRWWEEGDAVEVRAPFDGSLIA |
| Ga0075030_1005330912 | 3300006162 | Watersheds | MSEMTVAPVATHGFFVDGSWHEDGDLVEIRAPFDNSLIARVVQGRRE |
| Ga0070716_1002095622 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEMTLTPVATHGFLVDGHWVEQGELVEVRAPYDGALIG |
| Ga0075014_1003928791 | 3300006174 | Watersheds | MPELTLAPVATHGFFVDGRWWEDGDLVEIRSPYDGTLIARVVQGRREHAEA |
| Ga0070765_1001744141 | 3300006176 | Soil | MSEMTIVPVATHGFFVDGRWRDDGDVVEIHAPYDGSLIARV |
| Ga0099829_103267313 | 3300009038 | Vadose Zone Soil | MAEMTVIPVATHGFFLDGKWLEEGDIVDVRAPYDG |
| Ga0116222_10125093 | 3300009521 | Peatlands Soil | MAEMTIAPVVTHGFFVDGRWRDDGDIIEVRAPYDGSVIG |
| Ga0116222_13040282 | 3300009521 | Peatlands Soil | MAEMTITPVATHGFFVDGRWMDDGDIVEVRSPFDGSVIG |
| Ga0116222_15551302 | 3300009521 | Peatlands Soil | MAEMTITPVATHGFFVDGRWMEDGDIVDVRSPFDGSVVGRVVQARREHA |
| Ga0116111_11375472 | 3300009616 | Peatland | MAEMTVTPVATHGFFLDGKWLEEGDIVDVRAPYDGA |
| Ga0116127_10915551 | 3300009618 | Peatland | MAEMTIAPVATHGFFVDGRWMEDGDVVDVRSPFNGSVVGRVTQARHEHAAA |
| Ga0116133_11694672 | 3300009623 | Peatland | MAELTIAPVATHGFYLDGKWVEDGDVVEVRAPYDGSVIARVVQGR |
| Ga0116101_10333781 | 3300009759 | Peatland | MAEMTVAPVAIHGFFVDGRWMEDGDIVEVRSPFDGTVVGRVTQARRDHAEAAI |
| Ga0116223_101530591 | 3300009839 | Peatlands Soil | MAEMTIIPAETPVATHGFFIDGRWMEEGDIVEVRSPF |
| Ga0126373_109944331 | 3300010048 | Tropical Forest Soil | MAEMTISPVATHGLFVDGRWRADGDVVEIHAPYDGSLIARITQGRK |
| Ga0099796_105399202 | 3300010159 | Vadose Zone Soil | MAELTIAPVATHGFFVDGRWLEDGDIVDVRSPFDGSVVGRVVQARRE |
| Ga0074045_101916241 | 3300010341 | Bog Forest Soil | MAEMTIAPVATHGFFVDGRWWDDGDPVEIRAPYDGT |
| Ga0074045_104057752 | 3300010341 | Bog Forest Soil | MAQMTAIPVATHGFFLDGKWLEEGDIVDVRAPYDGALLAHVHQG |
| Ga0074045_110388201 | 3300010341 | Bog Forest Soil | MAEMTVAPVATHGFFLDGKWLEEGDIVDVRAPYDG |
| Ga0074044_103641101 | 3300010343 | Bog Forest Soil | MAQMTAIPVATHGFFLDGKWLEEGDIVDVRAPYDGALLAH |
| Ga0074044_104748002 | 3300010343 | Bog Forest Soil | MAELTIAPVATHGFFMDGRWIEDGEPVEVRSPFDGSLVGRVI |
| Ga0126376_102704521 | 3300010359 | Tropical Forest Soil | MAEMTIAPVATHGFFLDGKWQQDGDLIEIRGPYDGSLIARVTQ |
| Ga0126372_132170552 | 3300010360 | Tropical Forest Soil | MAEMTIAPVATHGFFVDGRWQEDGDIVEIRAPYDGSL |
| Ga0126381_1000372124 | 3300010376 | Tropical Forest Soil | MAEMTIAPVATHGFFVDGRWQQDGDIVEIRAPYDNSLIARI |
| Ga0137393_105844992 | 3300011271 | Vadose Zone Soil | MAEMTMTPVATHGFLVDGRWLEEGDLVEVRSPYDGAVVGRVFQG |
| Ga0137382_100239261 | 3300012200 | Vadose Zone Soil | MAEMTIAPVATHGFFIDGKWVEEGEIVEVLAPYDGAVVGRV |
| Ga0137382_106211261 | 3300012200 | Vadose Zone Soil | MAELTIAPVATHGFFIDGKWVEEGDIVEVRAPYDGT |
| Ga0137367_104150273 | 3300012353 | Vadose Zone Soil | MAQMSVTPVATHGFFVDGKWLEEGDLVEIRAPYDG |
| Ga0137361_113515342 | 3300012362 | Vadose Zone Soil | MAEMTIAPIATHGFFLDGKWFEEGDIVEVRAPYDGAVVGRVYQG |
| Ga0137398_105399061 | 3300012683 | Vadose Zone Soil | MAELTIAPVATHGFFVDGRWIEDGDIIEIHAPFDGSVIGRVVQ |
| Ga0137419_102267231 | 3300012925 | Vadose Zone Soil | MTVADVATHGFLVDGKWMDEGDLVEVRAPYDGAVVGRVIQARR |
| Ga0137416_109667251 | 3300012927 | Vadose Zone Soil | MAEMTVIPVATHGFFLDGKWLEEGDVVDVRAPYDGALI |
| Ga0137407_117555232 | 3300012930 | Vadose Zone Soil | MPEMTIAPVSTHGFFVDGRWHEDGDLVEIHAPYDGSLIARVVQG |
| Ga0126369_111096211 | 3300012971 | Tropical Forest Soil | MAELTAVPVATHGFFLDGKWLEDGDTVDICSPYDGALV |
| Ga0157372_104662842 | 3300013307 | Corn Rhizosphere | MAEMTIAPVATHGFFVDGRWQQEGDIVEIRSPYDGSLVARVSQG |
| Ga0181521_106182502 | 3300014158 | Bog | MAQMTAIPVATHGFFLDGKWLEEGDIVDVRAPYDGALLAHVH |
| Ga0181538_101397003 | 3300014162 | Bog | MAEVTATPVATHGFFLDGKWLEEGDIVEVRAPYDGSLIACVHQGG |
| Ga0181531_103197132 | 3300014169 | Bog | MSEMTIAPVATHGFFVDGRWHEDGDLVEIRAPYDNNLIARVVQGRKEHAE |
| Ga0181526_108084631 | 3300014200 | Bog | MAEMTVTPVATHGFFLDGKWLEEGDIVDVHAPYDGVLIAHV |
| Ga0182010_104836391 | 3300014490 | Fen | MAEMTAAPVATHGFFLDGKWLEEGDILDICAPYDGALLAHVHQ |
| Ga0182030_101267774 | 3300014838 | Bog | MPEMTLAPVATHGFFMDGRWMEDGDVVEVRAPFDGSVIARVIQARREH |
| Ga0132256_1005173423 | 3300015372 | Arabidopsis Rhizosphere | MSEMTIAPVATHGFFVDGHWREDGDIVEIHAPYDGSV |
| Ga0132256_1016276142 | 3300015372 | Arabidopsis Rhizosphere | MAEMTIAPVATHGFFVDGRWQQDGDLVEVRAPYDGTVVARVIQGR |
| Ga0182033_117382701 | 3300016319 | Soil | MAEMTVAPVATHGFFVDGRWQQEGDLMEVRSPYDGSVIARV |
| Ga0182033_117925371 | 3300016319 | Soil | MAEMTVAPVATHGFFVDGKWQQEGDLIEIRSPYDAS |
| Ga0181511_10298282 | 3300016702 | Peatland | MAEMTLIPVATHGFFLDGKWSEEGDIVDVRAPYDGALIAHVY |
| Ga0187818_100579421 | 3300017823 | Freshwater Sediment | MAEMTVTPVATHGFFLDGKWLEEGDIVDVRAPYDGALIAHV |
| Ga0187818_105892771 | 3300017823 | Freshwater Sediment | MSEIMTIAPVATHGFFVDGRWQEDGDVVEIRAPFDGALIARVVQGRRE |
| Ga0187814_102298381 | 3300017932 | Freshwater Sediment | MAQMTMIPVATHGFYVDGKWLEEGDTVDVRAPYDGAVIA |
| Ga0187848_104110552 | 3300017935 | Peatland | MAEMTIAPVATHGFFMDGRWSEDGDPVEVRAPFDGSVVARVVQARRQHAESA |
| Ga0187850_100421341 | 3300017941 | Peatland | MAEMTVTPVATHGFFLDGKWLGEGDNVDVRAPYDGA |
| Ga0187808_104221371 | 3300017942 | Freshwater Sediment | MAEMTIAPVATHGFFVDGRWMEDGDIVDVRSPFDGSV |
| Ga0187819_100876591 | 3300017943 | Freshwater Sediment | MSEMTIAPVATHGFFVDGRWREDGDVVDINAPYDGSLI |
| Ga0187879_100043511 | 3300017946 | Peatland | MPEMTLAPVATHGFFMDGRWMEDGDVVEVRAPFDGSVIA |
| Ga0187779_109081591 | 3300017959 | Tropical Peatland | MAEMTIAPVATHGFFLDGHWREDGDPVEIRAPYDGSVIAR |
| Ga0187776_104600221 | 3300017966 | Tropical Peatland | MAQMTMTPIATHGFLLDGRWIEDGDVVEVRAPYDGSVIARVVQ |
| Ga0187782_104890602 | 3300017975 | Tropical Peatland | MVEMTIAPVATHGLFVDGRWRADGDVVEIRAPYDGSLIARIT |
| Ga0187782_109352831 | 3300017975 | Tropical Peatland | MAEITIAPVATHGFFVDGRWREDGDVVEVRAPYDGSVIARVVQG |
| Ga0187782_110907901 | 3300017975 | Tropical Peatland | MAEMTIAPVATHGYFVDGQWKEDGDLIEIHAPYDGALIARV |
| Ga0187864_103130141 | 3300018022 | Peatland | MAQMTAIPVATHGFFLDGKWLEEGDIVDVRAPYDGAL |
| Ga0187869_105793542 | 3300018030 | Peatland | MAQMTAIPVATHGFFLDGKWLEEGDIVDVRAPYDG |
| Ga0187863_101417991 | 3300018034 | Peatland | MAELTIAPVATHGFYLDGKWVEDGDVVEVRAPYDGSVIAR |
| Ga0187875_106493811 | 3300018035 | Peatland | MPEMTLAPVATHGFFMDGRWMEDGDVVEVRAPFDGSV |
| Ga0187883_100046978 | 3300018037 | Peatland | MAEMTVTPVATHGFFLDGKWLEEGDIVDVRAPYDGALVAHVHQG |
| Ga0187871_106683881 | 3300018042 | Peatland | MAELTVTPVATHGFFLDGKWLEEGDLVDVRAPYDGAV |
| Ga0187887_109629251 | 3300018043 | Peatland | MAEMTVAQVATHGFFLDGKWLEQGDVVDVRAPFDGSLVAHV |
| Ga0187858_103940931 | 3300018057 | Peatland | MAEMTVAPVATHGFFLDGKWLEEDDIVDVRAPYDGALVA |
| Ga0187772_102953751 | 3300018085 | Tropical Peatland | MAEMTIAPVATHGYFLDGQWRQDGDIVEIRAPFDNALIARAVQGRSEHA |
| Ga0187772_104046451 | 3300018085 | Tropical Peatland | MVEMTIAPVATHGFFIDGQWREDGDLVEIRSPFDGSLIARVVQG |
| Ga0187772_113914842 | 3300018085 | Tropical Peatland | MAEMTIAPVATYGFFVDGRWMDVGDAVEIRAPYDGTLIARVIEG |
| Ga0187770_102027362 | 3300018090 | Tropical Peatland | MAEMTIAPVATHGFFLDGQWREDGDPVEIRAPYDG |
| Ga0182025_11436092 | 3300019786 | Permafrost | MAELTSMPVETPVATHGFFIDGHWADDGDVVEVLSPFDGTVVGR |
| Ga0182025_12100995 | 3300019786 | Permafrost | MPEMTIAPVATHGFFVDGRWREDGDVIEIRAPYDGSLIARVCRAGTSMPRPP |
| Ga0182031_15186455 | 3300019787 | Bog | MAEMTVTPVATHGFFLDGKWLEEGDIVDVHAPTMAR |
| Ga0179592_105202752 | 3300020199 | Vadose Zone Soil | MAEMTVIPVATHVATYGFFLDGKWLEEGDIVDVRAPYD |
| Ga0210399_113837872 | 3300020581 | Soil | MAEMTIAPVATHGFFVDGRWQQDGDVIEIRGPYDG |
| Ga0210395_101856092 | 3300020582 | Soil | MAELTIAPVATHGFYVDGKWVEDGDVVDVRAPYDGSVIARV |
| Ga0210395_106253952 | 3300020582 | Soil | MSELVTAPAPVATHGFFLDGRWQEDGDLIEIHAPYDGSLIAR |
| Ga0210401_103594292 | 3300020583 | Soil | MPEMTIAPVATHGFFVDGRWWEDGDVVEIRAPYDGS |
| Ga0210401_104353833 | 3300020583 | Soil | MAEMTVIPVATHGFFLDGKWLEEGDIVDVRAPYDGALIAH |
| Ga0210404_104714821 | 3300021088 | Soil | MAEMTIADVATHGFLVDGKWVEDGDVVEVKAPYDGAIVGRV |
| Ga0210404_108101871 | 3300021088 | Soil | MAEMTTVPVETPVATHGFFVDGRWMEDGDVVEVRSPFDGSVVGRVTQARR |
| Ga0210396_101949781 | 3300021180 | Soil | MAELTIAPVATHGYFLDGRWSQDGDPIEVRAPYDG |
| Ga0210396_115290651 | 3300021180 | Soil | MAELTIAPVATHGFFVDGRWHDDGDIVDIRNPYDGSLIA |
| Ga0210385_111075061 | 3300021402 | Soil | MSELIVAPAPVATHGFFLDGRWQEDGDLIEIHAPYDGSLIARVVQGRHAHA |
| Ga0210397_109437431 | 3300021403 | Soil | MSEMTIAPVATHGFFVDGRWREDGDVVEIHAPYDNSLIARV |
| Ga0210383_114806352 | 3300021407 | Soil | MAEMTVTPVATHGFFLDGKWLEEGDIVDVRAPYDGALVAHVYRGG |
| Ga0210384_110461422 | 3300021432 | Soil | MPEMTIAPVATHGFFVDGRWWEDGDVVEIRAPYDGSLI |
| Ga0210391_104259301 | 3300021433 | Soil | MPEMTIAPVATHGFFVDGRWQEDGDVIEIRAPYDGSLIARVVRG |
| Ga0210391_113694191 | 3300021433 | Soil | MAEMTIAPVATHGFFVDGRWHDDGDIVDIRNPYDGSLIARVVQGR |
| Ga0210390_106485161 | 3300021474 | Soil | MAEMTIAPVATHGFFVDGRWHDDGDIVDIRNPYDG |
| Ga0210392_105213191 | 3300021475 | Soil | MAEMTIAPVATHGFFVDGRWMEDGDIVEVRSPFDGSIIGRVIQA |
| Ga0210410_102348521 | 3300021479 | Soil | MAEMTIAPVATHGFFVDGRWMEDGDIVEVRAPFDGTVIGRVI |
| Ga0210410_108491791 | 3300021479 | Soil | MPEMTIAPVATHGFFLDGRWREDGDVVEIRAPYDGSVIARVVQGRHE |
| Ga0210410_118399531 | 3300021479 | Soil | MAEMTIAPVATHGFFVDGRWIEDGDVVEVRSPFDGSVVGRVTQARRDH |
| Ga0224552_10632182 | 3300022850 | Soil | MAEMTVTPVATHGFFLDGKWLEEGDIVDVHAPYDG |
| Ga0208935_10293011 | 3300025414 | Peatland | MAEMTVTPVATHGFFLDGKWLEEGDIVDVHAPYDGALIAH |
| Ga0208937_10313521 | 3300025506 | Peatland | MAEMTVTPVATHGFFLDGKWLEEGDIVDVRAPYDG |
| Ga0208355_10541363 | 3300025581 | Arctic Peat Soil | MAEMTVTPVATHGFFLDGKWLEEGDIVDVRAPYDGALIAHVH |
| Ga0207684_106501012 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQMTITPVATHGFLVDGRWIEDGNLVEVRAPYDGAVIGRV |
| Ga0207646_100660174 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQMTVTPTVTAVATHGFFLDGKWLEEGDLLEVRAP |
| Ga0209238_10748792 | 3300026301 | Grasslands Soil | MAEMTIAPVATHGFFVDGRWQQEGDLVDIRSPYDSTLVARVTQGR |
| Ga0209240_11222632 | 3300026304 | Grasslands Soil | MAEMTVTPVATHGFFMDGRWMDDGDLVEIRAPYDGSIIGRVVQAR |
| Ga0209473_11531061 | 3300026330 | Soil | MAEMTIAPVATHGFFVDGRWQQEGDIVEIRSPYDGNLIARVSQ |
| Ga0209158_13538281 | 3300026333 | Soil | MAEMTIAPVVTHGFFVDGRWSEDGDVVEVHAAYDGSVIARVIQGRR |
| Ga0257150_10763831 | 3300026356 | Soil | MAEMTVIPVATHGFFLDGKWLEEGDIVDVRAPYDGALIAHVYQG |
| Ga0257178_10358651 | 3300026446 | Soil | MAEMTVIPVATHGFFLDGKWLEKGDLVDVRAPYDGAVIAH |
| Ga0209577_100494576 | 3300026552 | Soil | MAQMTITPVATHGFLVDGRWIEDGNLVEVRAPYDGAVIGRVFQ |
| Ga0179587_103935451 | 3300026557 | Vadose Zone Soil | MAEMTIAPIATHGFFLDGKWWEEGDIDEVRAPYDGAVVGRVYR |
| Ga0208724_10269042 | 3300027064 | Forest Soil | MAEMTLAPVATHGFFVDGRWMEDGDIIEVRSPFDGSIVG |
| Ga0209421_10784012 | 3300027432 | Forest Soil | MAEMTIAPVATHGFFVDGRWREDGDIVEIRAPYDGSLIARVVQGRR |
| Ga0208991_11137402 | 3300027681 | Forest Soil | MAEMTIVSTDLPVATRGFFVDGRWVEDGDIVEVRSPFDGSVVGRVVEG |
| Ga0209530_10511861 | 3300027692 | Forest Soil | VVEMTVIPLETALVTHGFFIDGHWAEDGDVVEVRSPFDGSVV |
| Ga0209656_100057168 | 3300027812 | Bog Forest Soil | MAEMTIAPVATHGFFVDGRWWEDGDAVEIRAPFDGSLIAR |
| Ga0209656_105298382 | 3300027812 | Bog Forest Soil | MAGMTIAPVATHGFFVDGRWLEDGDIVEVRAPFDGSIVA |
| Ga0209275_103779402 | 3300027884 | Soil | MAELTIAPVATHGFYLDGKWVEDGDVVEVRAPYDGTVIA |
| Ga0209624_106134872 | 3300027895 | Forest Soil | MAEMTVTPVITHGFFLDGRWLEEGDVIEVHAPYDGSLIAH |
| Ga0209624_108467352 | 3300027895 | Forest Soil | MAEMTIAPVASHGFFIDGRWLEDGDIVEVRAPYDGNVIARVVQARREHA |
| Ga0209067_100076107 | 3300027898 | Watersheds | MAEMTIAPVATHGFFVDGRWWEEGDAVEVRAPFDGS |
| Ga0209698_100318561 | 3300027911 | Watersheds | MTQMTMTPVATYGFFVDGHWIEDGDIVEIRAPYDGAVIARV |
| Ga0209698_111033101 | 3300027911 | Watersheds | MSEMTVAPVATHGFFVDGSWHEDGDLVEIRAPFDNSLIARVVQGRREHAE |
| Ga0209526_109803881 | 3300028047 | Forest Soil | MAEMTVTPVATHGFFMDGRWIEDGDLVEIRAPYDGGLIARVVQ |
| Ga0302301_10628702 | 3300028731 | Palsa | MSEMTLAPVATHGFLVDGRWMEDGDMVEVRAPFDGSVVGRVTQARR |
| Ga0302226_102662122 | 3300028801 | Palsa | MAEMTIAPVATHGFFVDGRWMDDGDIVEIRAPFDGTVIARVTQ |
| Ga0302221_101736902 | 3300028806 | Palsa | MAELTIAPVATHGFFVDGRWMEDGDLVEIRAPFDGS |
| Ga0302218_101684462 | 3300028863 | Palsa | MAEMTIAPVATHGFFVDGRWHEDGDIVEIRAPYDGSV |
| Ga0308309_101922851 | 3300028906 | Soil | MAEMTIAPVATHGFFVDGRWMEDGDIVEVRSPFAGS |
| Ga0308309_105165591 | 3300028906 | Soil | MAELTIAPVATHGFYLDGKWVEDGDIVEVRAPYDGSVIA |
| Ga0311361_102184541 | 3300029911 | Bog | MPEMTLAPVATHGFFMDGRWMEDGDVVEVRAPFDGSVIARV |
| Ga0311326_102745263 | 3300029917 | Bog | MAEMTVTPVATHGFFLDGKWLEEGDIVDVHAPYDGAL |
| Ga0311340_106481842 | 3300029943 | Palsa | MAEMTIAPVATHGFFVDGRWVEDGDIVDIRAPFDGSVIGRVVQARRE |
| Ga0311353_104887091 | 3300030399 | Palsa | MAEMTIAPVATHGFFVDGRWMEDGDIVDIRAPFDGSVIGRVVQARREHAE |
| Ga0302192_103630822 | 3300030507 | Bog | MPEMTLAPVATHGFFMDGRWMEDGDVVEIRAPFDGSVIGRVIQA |
| Ga0265753_10576831 | 3300030862 | Soil | MPEMTIAPVATHGFFVDGRWREDGDVIEIRAPYDGSLIARVV |
| Ga0073994_120395542 | 3300030991 | Soil | MAEMTVTPVATHGFFMDGRWIEDGDMVEIRAPYDGGLIA |
| Ga0302180_104927282 | 3300031028 | Palsa | MAEMTIAPVATHGFFVDGRWHEDGDIVEIRAPYDGSVIARVVQ |
| Ga0170834_1127895271 | 3300031057 | Forest Soil | MQELTIAPVATQGFLVDGRWMEEGDIVEVRSPYDGSVIGRVVQARR |
| Ga0302325_133075561 | 3300031234 | Palsa | MTGMTIAPVATHGFFIDGRWMEDGDIVEVRAPFDGSVIARVVQARREH |
| Ga0302324_1023169441 | 3300031236 | Palsa | MAEMTIASPETPVATHGYFIDGHWADDGDLIEVRSPFDGSVVGRVTQARREHA |
| Ga0302326_135499681 | 3300031525 | Palsa | MAELTIAPVSIHGFFVDGRWMEDGDLVDIRAPFDGGVIAR |
| Ga0318516_106597981 | 3300031543 | Soil | MAQMTIAEVATHGFWLDGKWVEEGDVYEVKAPYDGAVVGRVFQ |
| Ga0310686_1106776362 | 3300031708 | Soil | MAEMTIAPVATHGFFADGRWMEDGDVVEIRSPFDGSVIARVV |
| Ga0310813_112891812 | 3300031716 | Soil | MSQLTAAPTLTRGFFLDGKWIEEGDVLEVRAPYDQVVIAQIFQGKRQHAEA |
| Ga0307474_107795871 | 3300031718 | Hardwood Forest Soil | MAEMTVTPVATHGFFLDGKWLEEGDIVDVHAPYGGAL |
| Ga0307474_108113472 | 3300031718 | Hardwood Forest Soil | MAEMTVIPVATHGFFLDGKWLEEGDIVDVRAPYDGALIAHV |
| Ga0318494_101871472 | 3300031751 | Soil | MTIAEVATHGFWLDGKWVEEGDVYEVKAPYDGAVV |
| Ga0307477_103439901 | 3300031753 | Hardwood Forest Soil | MAEMTIAPVATHGFFVDGRWRDDGDVIEIRAPFDGTVVARVVQ |
| Ga0307477_105397101 | 3300031753 | Hardwood Forest Soil | MAEMTIAPVATHGFFVDGRWQQDGDLVEIRAPYDGGLIA |
| Ga0307477_107454551 | 3300031753 | Hardwood Forest Soil | MPEMTIAPVATHGFFVDGRWRDDGDVVEIRSPYDGGVIARVVQGR |
| Ga0307478_101285361 | 3300031823 | Hardwood Forest Soil | MAEMTIVPVAAHGFFVDGRWVEDGDIVEVRSPFDGSVVGRVVQGR |
| Ga0307478_102014001 | 3300031823 | Hardwood Forest Soil | MAQMTMIPVATHGFYVDGKWLDEGDIVEIHAPYDGAVIAS |
| Ga0307479_109916541 | 3300031962 | Hardwood Forest Soil | MAEMTIVSTELPVATHGFFVDGRWVEDGDIVEVRSPFDGSVI |
| Ga0306924_119000582 | 3300032076 | Soil | MAQMTVADIATHGFLVDGKWMEEGDVVEVKAPYDGAVA |
| Ga0306920_1004912123 | 3300032261 | Soil | MAQVTVADIATHGFLVDGKWVEEGDVVEVKAPYDGAV |
| Ga0315275_126834962 | 3300032401 | Sediment | MAQLTAAPVATHGFFLDGKWLEEGDIVEVRAPFDGAVIARVHQG |
| Ga0335080_112039951 | 3300032828 | Soil | MAEMTISPVAIQPVATHGFFVDGRWQQDGDLVEIRAPYDN |
| Ga0335070_103316132 | 3300032829 | Soil | MSQMTVAPAATYGYFLDGRWQEDGDLVEIRAPFDDTLIARVVQGRRE |
| Ga0335072_106676242 | 3300032898 | Soil | MAEMTIAPVATHGFFVDGRWQQEGDVVEIRAPYDGALI |
| Ga0335073_121368121 | 3300033134 | Soil | MAELTIAPVATHGFFADGKWHEDGDLVEIRSPYDNNLVARVVQGRKE |
| Ga0335077_107666462 | 3300033158 | Soil | MAEMTIAPVATHGFFVDGRWQEDGDIVEIRAPYDNSLI |
| Ga0326727_109368002 | 3300033405 | Peat Soil | MAEMTVAPVATHGFFLDGKWLEEGDIVDVRAPYDGALIAHVHQG |
| Ga0310810_107700162 | 3300033412 | Soil | MAEMTIAPVATHGFFVDGRWQQEGDIVEIRSPYDGTLVARVAQG |
| Ga0370515_0391273_1_138 | 3300034163 | Untreated Peat Soil | MAELTIAPVATHGFFIDGRWLEDGDLVEVRSPYDGTLIARVKQARR |
| ⦗Top⦘ |