| Basic Information | |
|---|---|
| Family ID | F028262 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 192 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTLKSALQDLKETTLAAVSGLLGKLAYLASLRRAQGRYEHWGMEL |
| Number of Associated Samples | 165 |
| Number of Associated Scaffolds | 192 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 85.94 % |
| % of genes near scaffold ends (potentially truncated) | 97.40 % |
| % of genes from short scaffolds (< 2000 bps) | 91.67 % |
| Associated GOLD sequencing projects | 161 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.562 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.875 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.479 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.375 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.05% β-sheet: 0.00% Coil/Unstructured: 47.95% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 192 Family Scaffolds |
|---|---|---|
| PF13620 | CarboxypepD_reg | 4.17 |
| PF00196 | GerE | 0.52 |
| PF01888 | CbiD | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 192 Family Scaffolds |
|---|---|---|---|
| COG1903 | Cobalt-precorrin-5B methyltransferase | Coenzyme transport and metabolism [H] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.56 % |
| Unclassified | root | N/A | 23.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573000|GPBTN7E01BS2N9 | Not Available | 514 | Open in IMG/M |
| 3300001131|JGI12631J13338_1026894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100988687 | Not Available | 726 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10332610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 618 | Open in IMG/M |
| 3300004080|Ga0062385_10448175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300004080|Ga0062385_10741868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300004082|Ga0062384_100427210 | Not Available | 860 | Open in IMG/M |
| 3300004091|Ga0062387_100823017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300004091|Ga0062387_101509943 | Not Available | 539 | Open in IMG/M |
| 3300004103|Ga0058903_1000947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1958 | Open in IMG/M |
| 3300004118|Ga0058886_1368714 | Not Available | 791 | Open in IMG/M |
| 3300004136|Ga0058889_1335970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 504 | Open in IMG/M |
| 3300004152|Ga0062386_100244108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1422 | Open in IMG/M |
| 3300004477|Ga0068971_1294763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300004612|Ga0068961_1248120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300004616|Ga0068930_1338152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300004631|Ga0058899_10050964 | Not Available | 525 | Open in IMG/M |
| 3300004635|Ga0062388_101229498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300005176|Ga0066679_10731565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300005435|Ga0070714_101380548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300005526|Ga0073909_10130105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1029 | Open in IMG/M |
| 3300005542|Ga0070732_10830475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 564 | Open in IMG/M |
| 3300006052|Ga0075029_101088735 | Not Available | 555 | Open in IMG/M |
| 3300006086|Ga0075019_10791806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300006102|Ga0075015_100497375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300006162|Ga0075030_100343913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1190 | Open in IMG/M |
| 3300006174|Ga0075014_100058126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1686 | Open in IMG/M |
| 3300006954|Ga0079219_11741416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 580 | Open in IMG/M |
| 3300007265|Ga0099794_10251476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300009088|Ga0099830_11740411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300009143|Ga0099792_10519274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300009143|Ga0099792_11075845 | Not Available | 541 | Open in IMG/M |
| 3300009521|Ga0116222_1211541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
| 3300009521|Ga0116222_1387101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300009628|Ga0116125_1038225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1206 | Open in IMG/M |
| 3300009698|Ga0116216_10905535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 528 | Open in IMG/M |
| 3300009759|Ga0116101_1136916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 592 | Open in IMG/M |
| 3300009764|Ga0116134_1104213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1025 | Open in IMG/M |
| 3300010343|Ga0074044_10310942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1036 | Open in IMG/M |
| 3300010361|Ga0126378_10525362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1298 | Open in IMG/M |
| 3300010396|Ga0134126_11460067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300011063|Ga0138537_1124875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300011075|Ga0138555_1099703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 569 | Open in IMG/M |
| 3300011076|Ga0138574_1082533 | Not Available | 530 | Open in IMG/M |
| 3300011120|Ga0150983_12193282 | Not Available | 841 | Open in IMG/M |
| 3300011120|Ga0150983_14164461 | Not Available | 547 | Open in IMG/M |
| 3300011120|Ga0150983_15163771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 552 | Open in IMG/M |
| 3300012189|Ga0137388_11793330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 546 | Open in IMG/M |
| 3300012199|Ga0137383_10630291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300012206|Ga0137380_11219222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300012354|Ga0137366_10238502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1351 | Open in IMG/M |
| 3300012362|Ga0137361_10140147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2151 | Open in IMG/M |
| 3300012469|Ga0150984_114454814 | Not Available | 566 | Open in IMG/M |
| 3300012924|Ga0137413_10333377 | Not Available | 1071 | Open in IMG/M |
| 3300012929|Ga0137404_10406342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1201 | Open in IMG/M |
| 3300013105|Ga0157369_11123308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
| 3300014159|Ga0181530_10648259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 513 | Open in IMG/M |
| 3300014168|Ga0181534_10714996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 586 | Open in IMG/M |
| 3300017823|Ga0187818_10504864 | Not Available | 543 | Open in IMG/M |
| 3300017928|Ga0187806_1174603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
| 3300017930|Ga0187825_10296519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 602 | Open in IMG/M |
| 3300017942|Ga0187808_10263264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300017961|Ga0187778_10181882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1335 | Open in IMG/M |
| 3300017970|Ga0187783_10191815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1502 | Open in IMG/M |
| 3300017973|Ga0187780_10216881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1336 | Open in IMG/M |
| 3300017995|Ga0187816_10029062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2229 | Open in IMG/M |
| 3300018001|Ga0187815_10441307 | Not Available | 556 | Open in IMG/M |
| 3300018006|Ga0187804_10037943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1843 | Open in IMG/M |
| 3300018038|Ga0187855_10545128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300018043|Ga0187887_10758842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300018046|Ga0187851_10348210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
| 3300018047|Ga0187859_10117786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1400 | Open in IMG/M |
| 3300018086|Ga0187769_10239272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1349 | Open in IMG/M |
| 3300018088|Ga0187771_10024626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4529 | Open in IMG/M |
| 3300018088|Ga0187771_11523606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 567 | Open in IMG/M |
| 3300018088|Ga0187771_11828301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 516 | Open in IMG/M |
| 3300018431|Ga0066655_11430152 | Not Available | 504 | Open in IMG/M |
| 3300019161|Ga0184602_121790 | Not Available | 1054 | Open in IMG/M |
| 3300019188|Ga0184599_127296 | Not Available | 760 | Open in IMG/M |
| 3300019240|Ga0181510_1463896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300019258|Ga0181504_1266813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300019268|Ga0181514_1230611 | Not Available | 518 | Open in IMG/M |
| 3300019890|Ga0193728_1159768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
| 3300020580|Ga0210403_10820781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
| 3300020581|Ga0210399_11449730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 534 | Open in IMG/M |
| 3300020582|Ga0210395_11031743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300021046|Ga0215015_10500954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1827 | Open in IMG/M |
| 3300021170|Ga0210400_10236695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1490 | Open in IMG/M |
| 3300021171|Ga0210405_10668772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 804 | Open in IMG/M |
| 3300021181|Ga0210388_10704178 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
| 3300021181|Ga0210388_10919212 | Not Available | 753 | Open in IMG/M |
| 3300021401|Ga0210393_11511049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 534 | Open in IMG/M |
| 3300021406|Ga0210386_11196442 | Not Available | 643 | Open in IMG/M |
| 3300021420|Ga0210394_10850452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300021420|Ga0210394_11829631 | Not Available | 505 | Open in IMG/M |
| 3300021433|Ga0210391_10460877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
| 3300021433|Ga0210391_11380281 | Not Available | 542 | Open in IMG/M |
| 3300021474|Ga0210390_10101099 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2406 | Open in IMG/M |
| 3300021474|Ga0210390_11116685 | Not Available | 640 | Open in IMG/M |
| 3300021475|Ga0210392_11461892 | Not Available | 511 | Open in IMG/M |
| 3300021477|Ga0210398_10693385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300021478|Ga0210402_10266336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1583 | Open in IMG/M |
| 3300021478|Ga0210402_11074788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300021478|Ga0210402_11142984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300021560|Ga0126371_10520224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1338 | Open in IMG/M |
| 3300022502|Ga0242646_1019196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300022504|Ga0242642_1072297 | Not Available | 569 | Open in IMG/M |
| 3300022505|Ga0242647_1047295 | Not Available | 503 | Open in IMG/M |
| 3300022507|Ga0222729_1024649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 732 | Open in IMG/M |
| 3300022508|Ga0222728_1002116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2044 | Open in IMG/M |
| 3300022508|Ga0222728_1007451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1345 | Open in IMG/M |
| 3300022523|Ga0242663_1027461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 899 | Open in IMG/M |
| 3300022529|Ga0242668_1124358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 546 | Open in IMG/M |
| 3300022531|Ga0242660_1135171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300022531|Ga0242660_1256548 | Not Available | 501 | Open in IMG/M |
| 3300022533|Ga0242662_10205307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300022708|Ga0242670_1082986 | Not Available | 505 | Open in IMG/M |
| 3300022709|Ga0222756_1065584 | Not Available | 570 | Open in IMG/M |
| 3300022712|Ga0242653_1107849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 516 | Open in IMG/M |
| 3300022714|Ga0242671_1058842 | Not Available | 656 | Open in IMG/M |
| 3300022715|Ga0242678_1013740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 905 | Open in IMG/M |
| 3300022720|Ga0242672_1085070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300022724|Ga0242665_10106644 | Not Available | 838 | Open in IMG/M |
| 3300022724|Ga0242665_10150866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300022873|Ga0224550_1020380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300023012|Ga0228597_104331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300023250|Ga0224544_1011549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1194 | Open in IMG/M |
| 3300025612|Ga0208691_1152889 | Not Available | 520 | Open in IMG/M |
| 3300025905|Ga0207685_10043931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1687 | Open in IMG/M |
| 3300025906|Ga0207699_11079519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 594 | Open in IMG/M |
| 3300025915|Ga0207693_10029935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4296 | Open in IMG/M |
| 3300025939|Ga0207665_10078019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2274 | Open in IMG/M |
| 3300026294|Ga0209839_10025515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2280 | Open in IMG/M |
| 3300026489|Ga0257160_1070062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 619 | Open in IMG/M |
| 3300026551|Ga0209648_10336931 | Not Available | 1049 | Open in IMG/M |
| 3300027047|Ga0208730_1045029 | Not Available | 519 | Open in IMG/M |
| 3300027168|Ga0208239_1002910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1343 | Open in IMG/M |
| 3300027371|Ga0209418_1023118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1051 | Open in IMG/M |
| 3300027545|Ga0209008_1075182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300027567|Ga0209115_1015605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1656 | Open in IMG/M |
| 3300027568|Ga0208042_1013652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2119 | Open in IMG/M |
| 3300027667|Ga0209009_1082961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300027826|Ga0209060_10197248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 928 | Open in IMG/M |
| 3300027867|Ga0209167_10077447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1671 | Open in IMG/M |
| 3300027867|Ga0209167_10108692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1425 | Open in IMG/M |
| 3300027879|Ga0209169_10427457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300027889|Ga0209380_10215344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1128 | Open in IMG/M |
| 3300027908|Ga0209006_10759735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
| 3300027986|Ga0209168_10396868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300028776|Ga0302303_10075441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1266 | Open in IMG/M |
| 3300028863|Ga0302218_10178030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300029701|Ga0222748_1097836 | Not Available | 568 | Open in IMG/M |
| 3300029907|Ga0311329_10846081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300029939|Ga0311328_10216875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1468 | Open in IMG/M |
| 3300030054|Ga0302182_10000014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 129849 | Open in IMG/M |
| 3300030617|Ga0311356_11475247 | Not Available | 616 | Open in IMG/M |
| 3300030659|Ga0316363_10008702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6244 | Open in IMG/M |
| 3300030746|Ga0302312_10053955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1768 | Open in IMG/M |
| 3300030763|Ga0265763_1046531 | Not Available | 536 | Open in IMG/M |
| 3300030874|Ga0265742_1028366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 503 | Open in IMG/M |
| 3300030888|Ga0265769_122397 | Not Available | 509 | Open in IMG/M |
| 3300031057|Ga0170834_109585187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2240 | Open in IMG/M |
| 3300031122|Ga0170822_11035357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1047 | Open in IMG/M |
| 3300031231|Ga0170824_103098757 | Not Available | 573 | Open in IMG/M |
| 3300031231|Ga0170824_113495905 | Not Available | 558 | Open in IMG/M |
| 3300031231|Ga0170824_119486555 | Not Available | 550 | Open in IMG/M |
| 3300031231|Ga0170824_128166518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
| 3300031446|Ga0170820_16362790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1273 | Open in IMG/M |
| 3300031446|Ga0170820_16378534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 927 | Open in IMG/M |
| 3300031446|Ga0170820_16693403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 638 | Open in IMG/M |
| 3300031474|Ga0170818_106914739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 942 | Open in IMG/M |
| 3300031718|Ga0307474_10124539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1936 | Open in IMG/M |
| 3300031754|Ga0307475_10721212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300031823|Ga0307478_10074069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2582 | Open in IMG/M |
| 3300031823|Ga0307478_10078268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2517 | Open in IMG/M |
| 3300031823|Ga0307478_10169267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1744 | Open in IMG/M |
| 3300031823|Ga0307478_11379004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 585 | Open in IMG/M |
| 3300031942|Ga0310916_10271596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1432 | Open in IMG/M |
| 3300032072|Ga0326631_114235 | Not Available | 555 | Open in IMG/M |
| 3300032180|Ga0307471_102730763 | Not Available | 626 | Open in IMG/M |
| 3300032261|Ga0306920_101006871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1213 | Open in IMG/M |
| 3300032783|Ga0335079_12045463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 551 | Open in IMG/M |
| 3300032828|Ga0335080_10992960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 855 | Open in IMG/M |
| 3300032893|Ga0335069_10349976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1745 | Open in IMG/M |
| 3300032893|Ga0335069_10586224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1281 | Open in IMG/M |
| 3300032954|Ga0335083_10133402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2376 | Open in IMG/M |
| 3300033004|Ga0335084_11770224 | Not Available | 606 | Open in IMG/M |
| 3300033134|Ga0335073_10342866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1773 | Open in IMG/M |
| 3300033402|Ga0326728_10116235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3106 | Open in IMG/M |
| 3300033818|Ga0334804_150192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300033977|Ga0314861_0134468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1224 | Open in IMG/M |
| 3300034163|Ga0370515_0143632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1024 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.73% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.73% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 5.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.17% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.65% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.65% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.65% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.65% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.12% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.60% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.60% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.08% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.56% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.04% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.04% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.04% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.04% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.04% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.52% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.52% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.52% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.52% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.52% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.52% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.52% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.52% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.52% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 3300001131 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004103 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF242 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004118 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF208 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004136 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF214 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004477 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004612 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004616 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 15 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011063 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 15 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011075 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011076 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019161 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZE2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022502 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022505 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300023012 | Spruce litter microbial communities from Bohemian Forest, Czech Republic - CLU4 | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027168 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030874 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032072 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI2 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033818 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-M | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N55_04349040 | 2189573000 | Grass Soil | MTLKSALQDVKETTLGAISGMLAKLVYLASLRRGHGRYQH |
| JGI12631J13338_10268942 | 3300001131 | Forest Soil | MTLKSALQDLRDTTLAAVSGLLAKLAYLGSVKREGGYRHWG |
| JGIcombinedJ26739_1009886871 | 3300002245 | Forest Soil | MTLKSALQDLRETTLAAVSGLLAKLAYLGSLRRQEGGYLHWGMSL |
| JGIcombinedJ51221_103326103 | 3300003505 | Forest Soil | MTLKSALQDLKETTLAAVSGLLGKLVYLASLRRTQGRYEHWGMELVHGPESSK |
| Ga0062385_104481753 | 3300004080 | Bog Forest Soil | MTLKSALQDLRETTLAAVSGLLAKLAYLGSLRREGGYLHWGMSLVHGEEA |
| Ga0062385_107418683 | 3300004080 | Bog Forest Soil | MTLKSALQDLRETTLDAVSGLLAKLAYLGSLRRREGGYLHWGMSLV |
| Ga0062384_1004272101 | 3300004082 | Bog Forest Soil | MTLKSALQDLRETTLGAVSGLLAKLAYLGSLRRREGGYLHWGMSLVHGE |
| Ga0062387_1008230171 | 3300004091 | Bog Forest Soil | MTLKSALQDLRETTLAAISGLLAKLSYFASLRRSEGGYSHWGMSLLHG |
| Ga0062387_1015099431 | 3300004091 | Bog Forest Soil | MTLKSALQDLRETTLAAVAGLLAKLSYLASLRSSHGGYQHWGLEAVH |
| Ga0058903_10009471 | 3300004103 | Forest Soil | MSLKSALQDIKETTLSAVSGWLGKLTYLASLRGGQGRYQHWGMECV |
| Ga0058886_13687141 | 3300004118 | Forest Soil | MTLKSALQDVRETTLAAVSGLLGKLLYLASLRQEEGAYQHWG |
| Ga0058889_13359702 | 3300004136 | Forest Soil | MSLKSALQDIKETTLSAVSGWLGKLTYLASLRRGQGRYQHWGMECVHG |
| Ga0062386_1002441081 | 3300004152 | Bog Forest Soil | MTLKSALQDFRETTLAAVSGLLAKLAYLASLRRREGGYQHWGMS |
| Ga0068971_12947633 | 3300004477 | Peatlands Soil | MTLKSALQDLKETTLAAVSGLLGKLAYLSSLRRGQGRYEHW |
| Ga0068961_12481203 | 3300004612 | Peatlands Soil | MTLRSALQDVKETTLAAVTGRLGKLTYLASLRRPRGGYEH |
| Ga0068930_13381521 | 3300004616 | Peatlands Soil | MTLKSALQDVKETTLAAVTGLLGKLAYLASLRRAQGRYEH |
| Ga0058899_100509642 | 3300004631 | Forest Soil | MTLKSALQDLRETTLTAISGLLAKLAYLGSLRRREGGYLHWGM |
| Ga0062388_1012294982 | 3300004635 | Bog Forest Soil | MTLKSALQDLRETTLAAISGLLAKLAYLGSLRRSEGGYLHWGMSLVHGEDA |
| Ga0066679_107315651 | 3300005176 | Soil | MTLKSALQDVKETTLAAVSGLLGRLAYLASLRRGQDGYQHWGMSLVH |
| Ga0070714_1013805482 | 3300005435 | Agricultural Soil | MTLKSALQDVKETTLSAISGLLGKLSYLASLRRHGRYNHWGMQMVH |
| Ga0073909_101301051 | 3300005526 | Surface Soil | MPLKSALQDVKETTLSAVAGLLGKLAYLASLRRRHGKYEHWGIECVYGPE |
| Ga0070732_108304752 | 3300005542 | Surface Soil | MTLKSALQDVKETTLAAVSGLLGKLAYLASLRRAKGRYEHWGLEFV |
| Ga0075029_1010887351 | 3300006052 | Watersheds | MTLRSALEDVRQTTLAAVSGLLGKLAYLASLRGQEGHYEHWGMKTVYG |
| Ga0075019_107918061 | 3300006086 | Watersheds | MTLKSALQDVKETTLAAVSGLLGKLAYLASLRHAR |
| Ga0075015_1004973753 | 3300006102 | Watersheds | MTLRSALQDVKETTLAAVTGRLGKLTYLASLRRPRGGYE |
| Ga0075030_1003439131 | 3300006162 | Watersheds | MTLKSALQDVKETTLAAVSGLLGKLAYLASLRRSHGRYEHWGMQL |
| Ga0075014_1000581261 | 3300006174 | Watersheds | MTLKSALQDVKETTLAAVSGLLGKLAYLASLRRAIGRY |
| Ga0079219_117414161 | 3300006954 | Agricultural Soil | MTLKSALQDVKETTLTAVSGLLGKLAYLASLRRSQGRYEHWGMEVVHG |
| Ga0099794_102514761 | 3300007265 | Vadose Zone Soil | MTLKSALQDVRETTLAAVSGLMGKLAYLASLRKNPGGYQHWGMSLVHGPE |
| Ga0099830_117404112 | 3300009088 | Vadose Zone Soil | MTLKSALQDLRESTLAAVSGLLAKLAYLASLRDREGGYRHWGMSLVH |
| Ga0099792_105192741 | 3300009143 | Vadose Zone Soil | MTLKSAFQDLRETTLAAVSGLLAKLAYLASLRRPEGGYRHWGLS |
| Ga0099792_110758452 | 3300009143 | Vadose Zone Soil | MTLKSALQDVKETTLAAVSGLLGKLAYLASLRRGRGEYQHWGMSLVH |
| Ga0116222_12115413 | 3300009521 | Peatlands Soil | MTLKSALQDLRETTLAAVSGLLAKLAYLGSLRRREGGYLHWGMALV |
| Ga0116222_13871011 | 3300009521 | Peatlands Soil | MTLKSALQDLRETTLAAVSGLLAKLAYLGSLRRREGGYRHWGM |
| Ga0116125_10382253 | 3300009628 | Peatland | MTLKSALQDVKETTLAAVSGLLGKLVYLASLRRAQGRYEHWGMELVHGPES |
| Ga0116216_109055351 | 3300009698 | Peatlands Soil | MTLKSALQDVKETTLAAVSGLFGKLAYLASLRHARGRYEHWGMELVHGPEG |
| Ga0116101_11369162 | 3300009759 | Peatland | MTLKSALQDVRETTLAAVSGLLGKLFYLACLRREDGGYQHWGMARIHGP |
| Ga0116134_11042132 | 3300009764 | Peatland | MTLKSALQDLRETTLAAVSGLLAKLAYLGSLRRREGGYKHWGLSLIYGQ |
| Ga0074044_103109421 | 3300010343 | Bog Forest Soil | MTLRSALQDLRETTLAAISGLLAKLSYLASLRNRE |
| Ga0126378_105253621 | 3300010361 | Tropical Forest Soil | MSLKSAVQDIKETTLSAVSGLLGKLAYLASLRRGHNA |
| Ga0134126_114600672 | 3300010396 | Terrestrial Soil | MTLKSALQDVKETTLSAVAGLLGKLAYLASLRRKGRYAHW |
| Ga0138537_11248752 | 3300011063 | Peatlands Soil | MTLKSALQDVKETTLAAVTGLLGKLAYLASLRRAQGRYE |
| Ga0138555_10997032 | 3300011075 | Peatlands Soil | MTLKSALQDLKETTLAAVSGLLGKLVYLASLRRAQGRYEHWGMELVHGPESS |
| Ga0138574_10825331 | 3300011076 | Peatlands Soil | MTLKSALQDVKETTLAAVSGLLGKLVYLASLRRAQGR |
| Ga0150983_121932823 | 3300011120 | Forest Soil | MTLKSALQDVKETTLAAVSGLLGKLVYLASLRRAQGRYQ |
| Ga0150983_141644611 | 3300011120 | Forest Soil | MTLKSALQDLRETTLAAVSGLLAKLTYLASLRRREGGYLHWGMSLVHGEEA |
| Ga0150983_151637711 | 3300011120 | Forest Soil | MTLKSALQDVKETTLAAISGLLGKLAYLASLRRPQGRYEHWGMETVH |
| Ga0137388_117933301 | 3300012189 | Vadose Zone Soil | MTLKSALQDIKETTLAAVSGLLGKLVYLASLLRAQGRYEHWRMELHHGPD |
| Ga0137383_106302911 | 3300012199 | Vadose Zone Soil | MTLKSALQDVKETTLAAVSGLLGKLDYLASLRRAQGRYEHWG |
| Ga0137380_112192222 | 3300012206 | Vadose Zone Soil | MTLKSALQDIKETTLAAVSGLLGKLVYLASLRRAQGRYEHWG |
| Ga0137366_102385021 | 3300012354 | Vadose Zone Soil | MTLKSALQDLKETTLAAVSGMLGKLTYLASLRRVHGRYEHWGME |
| Ga0137361_101401471 | 3300012362 | Vadose Zone Soil | MTLKSALQDLRETTLAAVSGLLAKLAYLASLRDRE |
| Ga0150984_1144548141 | 3300012469 | Avena Fatua Rhizosphere | MTLKSALQDVKETTLSAVAGLLGKLAYLASLRRKGRYAHWGME |
| Ga0137413_103333772 | 3300012924 | Vadose Zone Soil | MTFKSALQDLRETTLAAVSGLFAKLEYLASLRRREGGQ |
| Ga0137404_104063422 | 3300012929 | Vadose Zone Soil | MTLKSALQDVKETTLAAVSGLLGKLAYLASLRRAQGR |
| Ga0157369_111233081 | 3300013105 | Corn Rhizosphere | MTLKSAIQDVKDTTLSAVSGLLGKLAYLASLRHKLGKYQH |
| Ga0181530_106482591 | 3300014159 | Bog | MTLKSTLFDVKETTLAAVSGRLGKLGYLASLRRAQGRYQHWGME |
| Ga0181534_107149961 | 3300014168 | Bog | MTLKSALQDVKETTLAAISGLLGKLAYLASLRRAQGRYEHWGMELVHGPE |
| Ga0187818_105048641 | 3300017823 | Freshwater Sediment | MTLKSALRDLKETTLDAVSGLLGKLAYLASLRREHGRYEQWG |
| Ga0187806_11746031 | 3300017928 | Freshwater Sediment | MSLKSALQDIKETTLSAVSGWLGKLAYLASLRGGQGRYQHWGMESVHGMES |
| Ga0187825_102965192 | 3300017930 | Freshwater Sediment | MSLKSALQDIKETTLSAVSGWLGKLAYLASLRGGQGRYEHWGMESIHGPE |
| Ga0187808_102632642 | 3300017942 | Freshwater Sediment | MTLRSALQDVKETTLAAVAGRLGKLTYLASLRRPRGGYEHWG |
| Ga0187778_101818821 | 3300017961 | Tropical Peatland | MTLNSALDDLKETTLSAISGMLGKLAYLASLRRAQGRYAHWGMETV |
| Ga0187783_101918151 | 3300017970 | Tropical Peatland | MTLKSALQDLRETTLAAISGLLAKLAYLGSLRRRDGAGYRHWGMSLVHGEDA |
| Ga0187780_102168811 | 3300017973 | Tropical Peatland | MTLRSALQDVKETTLTAVSGLLGKLSYLGSLRRDRGRYQHWGMEFV |
| Ga0187816_100290625 | 3300017995 | Freshwater Sediment | MTLKSALQDVKETTLTAVSGLLGKLAYLASLRRHGRYQ |
| Ga0187815_104413071 | 3300018001 | Freshwater Sediment | MTLRSALQDVKETTLAAVAGRLGKLTYLASLRRPRGGYEHWGMEAVTAWNPPSAL |
| Ga0187804_100379433 | 3300018006 | Freshwater Sediment | MTLKSALQDVKESTLAAVSGLLGKLAYLASLRREHGRYEHWGMESVYGQES |
| Ga0187855_105451281 | 3300018038 | Peatland | MTLKSALQDVKETTLAAVSGLLGKLAYLASLRRPQGR |
| Ga0187887_107588422 | 3300018043 | Peatland | MTLKSALQDVKETTLAAISGLLGKLAYLASLRRPQG |
| Ga0187851_103482101 | 3300018046 | Peatland | MTLKSALQDVKETTLAAVSGLLGKLAYLASLRRPQGRYEHW |
| Ga0187859_101177861 | 3300018047 | Peatland | MTLKSALQDVKETTLAAVAGRLGKLVYLASLRRAQGRYEHWGMELVHGPE |
| Ga0187769_102392723 | 3300018086 | Tropical Peatland | MALKSALDDVRETTLASVSGLLGKLRYLASLRRTQGRYQHWGM |
| Ga0187771_100246261 | 3300018088 | Tropical Peatland | MTLRSALEDVRETTLAAVQGTLARLHYLASLRSGESSDYRHWGLARVYG |
| Ga0187771_115236061 | 3300018088 | Tropical Peatland | MTLKSALQDLKENTLAAVRGLLAKLAYLASLRRNQGRYEHWGMESVH |
| Ga0187771_118283011 | 3300018088 | Tropical Peatland | MTLKSALQDVKETTLAAIAGLLGKLGYLASLRRAQGRYEHWGMEAVH |
| Ga0066655_114301521 | 3300018431 | Grasslands Soil | MTLKSALQDVRETTLAAVSGLLGKLAYLASLRKTPSGYQ |
| Ga0184602_1217903 | 3300019161 | Soil | MTLKSALQDVRETTLAAVSGLLGKLLYLASLRQEEGAYQHW |
| Ga0184599_1272963 | 3300019188 | Soil | MTLKSALQDVRETTLAAVSGLLGKLLYLASLRQEEGAYQ |
| Ga0181510_14638962 | 3300019240 | Peatland | MTLKSALQDVRETTLAAVSGLLGKLFYLASLRREDGGYQHWGMARV |
| Ga0181504_12668131 | 3300019258 | Peatland | MTLKSALQDVKETTLAAVSGLLGKLVYLASLRRGQGRYEHWGMEMV |
| Ga0181514_12306111 | 3300019268 | Peatland | MTLKSALQDLRETTLAAVSGLLAKLAYLGSLRRREGG |
| Ga0193728_11597682 | 3300019890 | Soil | MTLKSALQDLRETTLAAVSGLLAKLAYLGSLRRREGGYLH |
| Ga0210403_108207813 | 3300020580 | Soil | MTLKSALQDVKETTLAAVSGLLGKLVYLASLRRAQGRYEHWGMELVHG |
| Ga0210399_114497301 | 3300020581 | Soil | MTLKSALQDLKETTLAAVSGLLGKLVYLASLRRAQGRYEHWGMELVHGPES |
| Ga0210395_110317432 | 3300020582 | Soil | MTLKSALQDVKETTLAAVSGLLGKLAYLASLRRVQGRYQHWGME |
| Ga0215015_105009541 | 3300021046 | Soil | MTLKSALQDVKETTLAAVSGLLGKLAYLASLRRGQDGYQHWGMSLMHLSLIHI |
| Ga0210400_102366951 | 3300021170 | Soil | MTLKSALQDVKETTLAAISGLLGKLAYLASLRRPQGRYEHWGME |
| Ga0210405_106687723 | 3300021171 | Soil | MTLKSALQDVKETTLAAVSGLLGKLVYLASLRRAQGRYEHWGMELVH |
| Ga0210388_107041782 | 3300021181 | Soil | MTLKSALQDVKETTLAAVSGLMGKLVYLASLRRAHGRYEHWG |
| Ga0210388_109192123 | 3300021181 | Soil | MTLKSALQDVRETTLAAVSGLLGKLFYLASLRREDGGYQHWGM |
| Ga0210393_115110491 | 3300021401 | Soil | MTLKSALQDLKETTLAAVSGLLGKLVYLASLRRAQGRYEHWG |
| Ga0210386_111964421 | 3300021406 | Soil | MTLRSALQDLRETTLAAVSGILAKLAYIASLRRREGGYKHWGLSLIHGEEPSERA |
| Ga0210394_108504523 | 3300021420 | Soil | MTLKSALQDVRETTLAAVSGLLGKLLYLASLRLEPGEYQHWGLAR |
| Ga0210394_118296311 | 3300021420 | Soil | MTLKSALQDLRETTLAAVSGLLAKLSYLASLRRSEGGYMHWGMSQLHGEEA |
| Ga0210391_104608771 | 3300021433 | Soil | MTLKSALQDIRETTLAAVSGLLAKLAYLGSLRRREGGYL |
| Ga0210391_113802812 | 3300021433 | Soil | MTLKSAVQDLRETTLVAVSGLLAKLAYLGSLRRKEGG |
| Ga0210390_101010991 | 3300021474 | Soil | MTLKSALQDVKETTLAAIRGLLGKLTYLASLRGATGR |
| Ga0210390_111166853 | 3300021474 | Soil | MTLKSALQDFKETTLAAVSGLLGQLTYLASLRGKQ |
| Ga0210392_114618922 | 3300021475 | Soil | MTLKSALQDLRETTLAAVSGLLAKLSYLASLRRSEGGYMHWGMSQLHGEEASD |
| Ga0210398_106933851 | 3300021477 | Soil | MTLKSALQDVRETTLAAVSGLLGKLFYLASLRREDGGY |
| Ga0210402_102663361 | 3300021478 | Soil | MTLKSALQDLKGTTLAAISGLLGKLAYLGSLRRAQGRYQHWGMEILHG |
| Ga0210402_110747882 | 3300021478 | Soil | MTLKSALQDLRETTLAAISGLLAKLAYLGSLRRREGGYLHWGMSLVH |
| Ga0210402_111429841 | 3300021478 | Soil | MTLKSALQDLRETTLAAVSGLLAKLAYLASLRRREGGYQHW |
| Ga0126371_105202242 | 3300021560 | Tropical Forest Soil | QDIKETTLSAVAGSLGKLSYLASLRQGQGRYQHWGMEAVHGVESS |
| Ga0242646_10191962 | 3300022502 | Soil | MTLKSALQDFKETTLAAVSGLLGKLVYLASLRREQGKY |
| Ga0242642_10722972 | 3300022504 | Soil | MTLKSALQDVKETTLAAVSGLLGKLAYVASLRRTQGRYQ |
| Ga0242647_10472951 | 3300022505 | Soil | MTLKSALQDLRETTLAAVSGLLAKLAYLGSLRRREGGYLHWGMSLVHGEES |
| Ga0222729_10246491 | 3300022507 | Soil | MTLKSALQDVKETTLAAVSGLLGKLAYLASLRRGQGRYEHWGMEQVHGPDST |
| Ga0222728_10021163 | 3300022508 | Soil | MTLKSALQDLKETTLAAVSGLLGKLVYLASLRRAQGRYEHWGMEL |
| Ga0222728_10074511 | 3300022508 | Soil | MTLKSALQDVKETTLAAVSGLLGKLVYLASLRRSQGHYEHWGMEL |
| Ga0242663_10274613 | 3300022523 | Soil | MTLKSALQDVRETTLAAVSGLLGKLLYLASLRREDGAYQHWGMGRV |
| Ga0242668_11243582 | 3300022529 | Soil | MTLKSALQDVKETTLAAVAGLLGKLAYLASLRRAQGRYEHWGMELV |
| Ga0242660_11351711 | 3300022531 | Soil | MTLKSALQDVKETTLAAVTGLLGKLAYLASLRRAQGR |
| Ga0242660_12565482 | 3300022531 | Soil | MTLKSALQDVRETTLAAVSGLLGKLLYLASLRLEHGEYQH |
| Ga0242662_102053071 | 3300022533 | Soil | MTLKSALQDLKGTTLAAISGLLGKLAYLGSLRRAQGRYQHWGMEV |
| Ga0242670_10829861 | 3300022708 | Soil | MSLKSALQDIKETTLSAVSGWLGKLTYLASLRCGQGRYQHW |
| Ga0222756_10655842 | 3300022709 | Soil | MTLKSALQDVKETTLAAIRGLLGKLTYLASLRGAT |
| Ga0242653_11078491 | 3300022712 | Soil | MTLKSALQDVKETTLAAVSGLLGKLAYLASLRRAEGRYEHWGIKAVHG |
| Ga0242671_10588421 | 3300022714 | Soil | MTLKSALQDVKETTLAAVSGLMGKLVYLASLRRAHGRYELRRQPDL |
| Ga0242678_10137402 | 3300022715 | Soil | MTLKSALQDVKETTLAAVSGLLGKLAYLASLRHARGRYEHWGMEL |
| Ga0242672_10850701 | 3300022720 | Soil | MTLKSALQDVKETTLAAISGMLAKLVYLASLGRAQGRY |
| Ga0242665_101066442 | 3300022724 | Soil | MTLKSALQDVKETTLAAVSGLLGKLAYLASLRRTQGRYE |
| Ga0242665_101508661 | 3300022724 | Soil | MTLKSALQDLRETTLAAVSGLLARLAYLGSLRRREG |
| Ga0224550_10203802 | 3300022873 | Soil | MTLKSALQDLRETTLAAISGLLAKLAYLGSLRRREGGYLHWGM |
| Ga0228597_1043312 | 3300023012 | Plant Litter | MTLKSALQDLRETTLAAVSGLLAKLAYLGSLRRREGMY |
| Ga0224544_10115491 | 3300023250 | Soil | MTLKSALQDVRETTLAAVSGLLAKLTYLASLRRREGGYLHWGMSLVH |
| Ga0208691_11528891 | 3300025612 | Peatland | MSLKSALQDLRETTLAAVSGLLAKLAYLGSLRRSEGGYL |
| Ga0207685_100439313 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLKSALQDVKETTLAAVSGLLGKLAYVASLRRAQGRYEH |
| Ga0207699_110795191 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLRSALQDVKETTLSAISGLLARLAYLGSLRRAHGHYDHWGMELVHGR |
| Ga0207693_100299351 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLRSALQDVKETTLSAISGLLARLAYLGSLRRAHGHYDHWGM |
| Ga0207665_100780191 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLKSALQDIKETTLSAVSGLLGKLAYLASLRGGQG |
| Ga0209839_100255154 | 3300026294 | Soil | MTLKSALQDVEETTLAAVSGLLGKLAYLASLRRGQGRY |
| Ga0257160_10700622 | 3300026489 | Soil | MTLKSALQDIKETTLAAVSGLLGKLVYLASLRRAHGRYEHWGMELVHG |
| Ga0209648_103369313 | 3300026551 | Grasslands Soil | MTLKSALQDLRETTLAAVSGLLAKLAYLASLRRRE |
| Ga0208730_10450291 | 3300027047 | Forest Soil | MSLKSALQDIKETTLSAVSGWLGKLTYLASLRRGQGRYQ |
| Ga0208239_10029101 | 3300027168 | Forest Soil | MTLKSALQDLKETTLAAVSGLLGKLVYLASLRRAQGRYEHWGMELVHGP |
| Ga0209418_10231181 | 3300027371 | Forest Soil | MTLKSALQDVKETTLAAVTGLLGKLAYLASLRRAQGRYV |
| Ga0209008_10751822 | 3300027545 | Forest Soil | MTLKSALQDLRETTLAAVSGLLAKLAYLGSLRRQEGGYLH |
| Ga0209115_10156051 | 3300027567 | Forest Soil | MTLKSALQDVRETTLAAVSGLLGKLFYLASLRREDGGYQHW |
| Ga0208042_10136524 | 3300027568 | Peatlands Soil | MTLKSALQDLKETTLAAVSGLLGKLAYLSSLRRGQGRYEHWGMEAV |
| Ga0209009_10829611 | 3300027667 | Forest Soil | MTLKSALQDLRETTLAAISGLLAKLAYLASLRRREGGYLHWGMSLIHGE |
| Ga0209060_101972482 | 3300027826 | Surface Soil | MTLKSALQDLKDTTLAAVNGLLAKLSYLASLRRGQGRYEHWGL |
| Ga0209167_100774471 | 3300027867 | Surface Soil | MTLKSALQDVKETTLAAITGLLGKLSYLASLRRAGGRYEHWGLEVVHGTE |
| Ga0209167_101086922 | 3300027867 | Surface Soil | MTLKSALQDLRESTLAAVAGLFAKLAYLGSLRRREGGY |
| Ga0209169_104274572 | 3300027879 | Soil | MTLKSALQDVKETTLAAISGLLGKLAYLASLRRPQGRYEHWGMETV |
| Ga0209380_102153441 | 3300027889 | Soil | MTLKSALQDVRETTLAAVSGLLGKLFYLASLRREDGGYQ |
| Ga0209006_107597351 | 3300027908 | Forest Soil | MTLKSALQDVKETTLAAVSGLLAKLKYLASLRRSPGGYEHWGMQSVHGA |
| Ga0209168_103968682 | 3300027986 | Surface Soil | MTLKSAFQDLKETTLAAVSGLFGKLAYLGSLRRAHGKYEHWGLV |
| Ga0302303_100754413 | 3300028776 | Palsa | MTLKSALQDLRETTLAAISGLLAKLAYLGSLRRREGGYLH |
| Ga0302218_101780303 | 3300028863 | Palsa | MKLKSALQDLRETTLGAVSGLLAKLAYLASLRRPEGV |
| Ga0222748_10978361 | 3300029701 | Soil | MTLKSALQDIRETTLAAVSGLLAKLAYLGSLRRREGGYLHWGMSLVHG |
| Ga0311329_108460811 | 3300029907 | Bog | MTLKSAIQDLRETTLAAVSGLLAKLAYLGSLRRREGGYGHWG |
| Ga0311328_102168754 | 3300029939 | Bog | MTLKSALQDLRETTLAAISGLLAKLAYLGSLRRREGGGYQHWGMTLLHGEESSER |
| Ga0302182_1000001464 | 3300030054 | Palsa | MTLKSALQDLRETTLAAVAGLLAKLAYLGSLRRREGGYMHWGLSLVYG |
| Ga0311356_114752471 | 3300030617 | Palsa | MTLKSALQDLRETTLAAVRGVLARLAYLGSLRGGESGYQHW |
| Ga0316363_100087025 | 3300030659 | Peatlands Soil | MTLKSALQDVKETTLAAVSGLLGKLVYLASLRRAQGRY |
| Ga0302312_100539554 | 3300030746 | Palsa | MTLKSALQDLRETTLAAVAGLLAKLAYLGSLRRREGGYMH |
| Ga0265763_10465311 | 3300030763 | Soil | MTLKSALQDLRETTLTAISGLLAKLAYLGSLRRREGGYLHWGMTLV |
| Ga0265742_10283661 | 3300030874 | Soil | MTLKSALQDFKETTLAAVSGLLGKLVYLASLRREQGKYEH |
| Ga0265769_1223971 | 3300030888 | Soil | MTLKSALQDLRETTLAAVSGLLAKLAYLGSLRRSEGGYRHWGMSLVHGEDS |
| Ga0170834_1095851875 | 3300031057 | Forest Soil | MTLKSALQDLRETTLAAVTGLLAKLAYLASLRRREGGYLHW |
| Ga0170822_110353572 | 3300031122 | Forest Soil | MSLKSALQDIKETTLSAVSGWLGKLTYLASLRCGQGRYQHWGMECVHGME |
| Ga0170824_1030987572 | 3300031231 | Forest Soil | MTLKSALQDVKETTLAAVSGLLGKLDYLASLRRAQG |
| Ga0170824_1134959052 | 3300031231 | Forest Soil | MTLKSALQDVRETTLAAVSGLLGKLAYLASLRKRPGGYQHWGMELIHGP |
| Ga0170824_1194865551 | 3300031231 | Forest Soil | MTLKSALQDVKETTLAAVSGLLGKLAYLGSLRRTQGRY |
| Ga0170824_1281665183 | 3300031231 | Forest Soil | MTLKSALQDVKETTLAAVSGLLGKLSYLASLRRAQGRYE |
| Ga0170820_163627901 | 3300031446 | Forest Soil | MTLKSALQDLKETTLAAVSGLLGKLAYLASLRRAQGRYEHWGMEL |
| Ga0170820_163785341 | 3300031446 | Forest Soil | MTLKSALQDVKETTLAAVSGLLGKLSYLASLRRAQGRYEH |
| Ga0170820_166934032 | 3300031446 | Forest Soil | MTLKSALQDLKETTLAAVSGLLGKLAYMASLRRGEGRYEHWGMR |
| Ga0170818_1069147391 | 3300031474 | Forest Soil | MTLKSALQDVKETTLAAVSGLLGKLSYLASLRRAQGRYEHW |
| Ga0307474_101245391 | 3300031718 | Hardwood Forest Soil | MTFKSALQDLRETTLVAVSGVLARLAYLASLRRRDGGYS |
| Ga0307475_107212121 | 3300031754 | Hardwood Forest Soil | MTLKSALQDVRETTLAAVAGRLGKLLYLGSLRREH |
| Ga0307478_100740691 | 3300031823 | Hardwood Forest Soil | MTIKSALQDLRETTLAAVAGLLAKLAYLGSLRRREGGYKHWGL |
| Ga0307478_100782685 | 3300031823 | Hardwood Forest Soil | VTLKSALQDLRETTLAAVSGLLAKLAYLGSLHRREGGYMHWGMSLVHGEE |
| Ga0307478_101692674 | 3300031823 | Hardwood Forest Soil | MTLKSAVQDLRETTLAAVAGLLAKLAYLGSLRRREGGYKHWGLSLIHG |
| Ga0307478_113790041 | 3300031823 | Hardwood Forest Soil | MTLKSALQDVKETTLAAVSGLLAKLVYLASLRRAQGRYEHWGMELLH |
| Ga0310916_102715961 | 3300031942 | Soil | MSLKSALQDIKETTLSAVSGMLGKLTYLASLRAGQGRYEHWGMETVHG |
| Ga0326631_1142353 | 3300032072 | Soil | MTLKSALQDLRETTLAAISGLLAKLAYLASLRRREGGYLHWGMSLVHG |
| Ga0307471_1027307633 | 3300032180 | Hardwood Forest Soil | MTLKSALQDLRETTLAAVNGLLAKLAYLASLRGGEGGYRHWGLSL |
| Ga0306920_1010068711 | 3300032261 | Soil | MSLKSALQDIKETTLSAVSGMLGKLTYLASLRAGQGRYEHWGMETVH |
| Ga0335079_120454631 | 3300032783 | Soil | MTLKSAIQDVKETTLSAVSGLLAKLFYLASLRRAQGRYHHWGMESVHG |
| Ga0335080_109929602 | 3300032828 | Soil | MTLKSALQDVRETTLAAVSGLLGKLSYLASLRRAEGGYE |
| Ga0335069_103499761 | 3300032893 | Soil | MTLKSALEDLRQTTLPAISGLLGKLAYIASLRRAPKGYSHWGMEAVYGKD |
| Ga0335069_105862242 | 3300032893 | Soil | MTLKSALQDVKETTLSAISGLLARLAYLGSLRRTHGHYNHWGMELVH |
| Ga0335083_101334021 | 3300032954 | Soil | MTLKSALQDLKETTLAAVSGLLGKLAYLASLRRSQGRYE |
| Ga0335084_117702241 | 3300033004 | Soil | LFGIRNKKMALRSALQDVKETTLSAINGLLARLAYVGSLRRAHGKYEHWGMEL |
| Ga0335073_103428663 | 3300033134 | Soil | MTLKSALQDVRETTLAAVSGLLAKLGYLASLRRKDGSYQHWGVSL |
| Ga0326728_101162354 | 3300033402 | Peat Soil | MTLKSALLDVKETTLAAVSGLLGKLGYLASLRRVQGRYQH |
| Ga0334804_150192_1_132 | 3300033818 | Soil | MTLKSAVQDLRDTTLAAVSGLLAKLAYLGSLRRREGGYGHWGMQ |
| Ga0314861_0134468_1_150 | 3300033977 | Peatland | MMLKSALRDLKDTTLAAVSGLLGKLGYLASLRRAEGHYEHWGMEAVYGPE |
| Ga0370515_0143632_1_126 | 3300034163 | Untreated Peat Soil | MTLKSALQDLRETTLAAVAGLLAKLAYLGSLRRREGGYMHWG |
| ⦗Top⦘ |