| Basic Information | |
|---|---|
| Family ID | F028107 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 192 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MRQSGAETLVTEEPDALIAHVRVCGGAGWVTTGSTRKQ |
| Number of Associated Samples | 155 |
| Number of Associated Scaffolds | 192 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 34.38 % |
| % of genes near scaffold ends (potentially truncated) | 95.83 % |
| % of genes from short scaffolds (< 2000 bps) | 84.38 % |
| Associated GOLD sequencing projects | 146 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.16 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.521 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (13.542 % of family members) |
| Environment Ontology (ENVO) | Unclassified (16.146 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (34.375 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 192 Family Scaffolds |
|---|---|---|
| PF00078 | RVT_1 | 53.12 |
| PF13586 | DDE_Tnp_1_2 | 0.52 |
| PF13470 | PIN_3 | 0.52 |
| PF13340 | DUF4096 | 0.52 |
| PF00239 | Resolvase | 0.52 |
| PF04392 | ABC_sub_bind | 0.52 |
| PF01609 | DDE_Tnp_1 | 0.52 |
| PF01436 | NHL | 0.52 |
| PF03400 | DDE_Tnp_IS1 | 0.52 |
| PF13518 | HTH_28 | 0.52 |
| PF08388 | GIIM | 0.52 |
| PF00378 | ECH_1 | 0.52 |
| PF13610 | DDE_Tnp_IS240 | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 192 Family Scaffolds |
|---|---|---|---|
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.52 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.52 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.52 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.52 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.52 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.52 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.52 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.52 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.52 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.52 % |
| All Organisms | root | All Organisms | 49.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_101509623 | Not Available | 693 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1073522 | Not Available | 519 | Open in IMG/M |
| 3300000787|JGI11643J11755_11727676 | Not Available | 1173 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10081126 | Not Available | 693 | Open in IMG/M |
| 3300000858|JGI10213J12805_10040304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 1633 | Open in IMG/M |
| 3300000858|JGI10213J12805_10349999 | Not Available | 988 | Open in IMG/M |
| 3300000955|JGI1027J12803_108913533 | Not Available | 751 | Open in IMG/M |
| 3300001752|JGI2173J19968_10022630 | Not Available | 2186 | Open in IMG/M |
| 3300001753|JGI2171J19970_10031715 | Not Available | 2204 | Open in IMG/M |
| 3300002558|JGI25385J37094_10043379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 1538 | Open in IMG/M |
| 3300002562|JGI25382J37095_10029602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 2147 | Open in IMG/M |
| 3300002908|JGI25382J43887_10246487 | Not Available | 824 | Open in IMG/M |
| 3300003373|JGI25407J50210_10085122 | Not Available | 784 | Open in IMG/M |
| 3300004268|Ga0066398_10016367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 1185 | Open in IMG/M |
| 3300004281|Ga0066397_10081850 | Not Available | 646 | Open in IMG/M |
| 3300004463|Ga0063356_102889410 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300005166|Ga0066674_10190982 | Not Available | 974 | Open in IMG/M |
| 3300005167|Ga0066672_10487592 | Not Available | 802 | Open in IMG/M |
| 3300005174|Ga0066680_10681082 | Not Available | 634 | Open in IMG/M |
| 3300005177|Ga0066690_10457057 | Not Available | 864 | Open in IMG/M |
| 3300005177|Ga0066690_10777445 | Not Available | 625 | Open in IMG/M |
| 3300005180|Ga0066685_10305565 | Not Available | 1102 | Open in IMG/M |
| 3300005180|Ga0066685_10331597 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1055 | Open in IMG/M |
| 3300005180|Ga0066685_10821386 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300005181|Ga0066678_10182431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfonema → Desulfonema limicola | 1332 | Open in IMG/M |
| 3300005181|Ga0066678_10794833 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300005294|Ga0065705_10015971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2123 | Open in IMG/M |
| 3300005338|Ga0068868_100748404 | Not Available | 878 | Open in IMG/M |
| 3300005353|Ga0070669_101399955 | Not Available | 607 | Open in IMG/M |
| 3300005440|Ga0070705_100016216 | All Organisms → cellular organisms → Bacteria | 3869 | Open in IMG/M |
| 3300005441|Ga0070700_100098721 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1920 | Open in IMG/M |
| 3300005441|Ga0070700_101137892 | Not Available | 649 | Open in IMG/M |
| 3300005445|Ga0070708_100450237 | Not Available | 1214 | Open in IMG/M |
| 3300005446|Ga0066686_10691373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 689 | Open in IMG/M |
| 3300005471|Ga0070698_100205366 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1905 | Open in IMG/M |
| 3300005530|Ga0070679_101746221 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300005540|Ga0066697_10651083 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300005552|Ga0066701_10709724 | Not Available | 604 | Open in IMG/M |
| 3300005552|Ga0066701_10937587 | Not Available | 512 | Open in IMG/M |
| 3300005556|Ga0066707_10131025 | All Organisms → cellular organisms → Bacteria | 1573 | Open in IMG/M |
| 3300005559|Ga0066700_10253688 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1230 | Open in IMG/M |
| 3300005564|Ga0070664_100135050 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2169 | Open in IMG/M |
| 3300005612|Ga0070723_10731963 | Not Available | 503 | Open in IMG/M |
| 3300005618|Ga0068864_100291026 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1527 | Open in IMG/M |
| 3300005764|Ga0066903_102308220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer → Ktedonobacter racemifer DSM 44963 | 1039 | Open in IMG/M |
| 3300005764|Ga0066903_102614584 | Not Available | 978 | Open in IMG/M |
| 3300005764|Ga0066903_106341500 | Not Available | 617 | Open in IMG/M |
| 3300005842|Ga0068858_101783582 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300005937|Ga0081455_11063214 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300005981|Ga0081538_10277279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 624 | Open in IMG/M |
| 3300006049|Ga0075417_10284573 | Not Available | 799 | Open in IMG/M |
| 3300006844|Ga0075428_100312608 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1689 | Open in IMG/M |
| 3300006844|Ga0075428_101198318 | Not Available | 800 | Open in IMG/M |
| 3300006844|Ga0075428_102376064 | Not Available | 545 | Open in IMG/M |
| 3300006845|Ga0075421_100971496 | Not Available | 964 | Open in IMG/M |
| 3300006846|Ga0075430_100109204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 2307 | Open in IMG/M |
| 3300006846|Ga0075430_100183945 | Not Available | 1737 | Open in IMG/M |
| 3300006847|Ga0075431_100884051 | Not Available | 864 | Open in IMG/M |
| 3300006847|Ga0075431_101820659 | Not Available | 565 | Open in IMG/M |
| 3300006853|Ga0075420_101225695 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Kerfeldbacteria → Candidatus Kerfeldbacteria bacterium CG_4_10_14_0_8_um_filter_42_10 | 645 | Open in IMG/M |
| 3300006854|Ga0075425_101085666 | Not Available | 912 | Open in IMG/M |
| 3300006854|Ga0075425_102983740 | Not Available | 518 | Open in IMG/M |
| 3300006871|Ga0075434_100703990 | Not Available | 1028 | Open in IMG/M |
| 3300006871|Ga0075434_101311161 | Not Available | 735 | Open in IMG/M |
| 3300006903|Ga0075426_11117733 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300006904|Ga0075424_101265462 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300006969|Ga0075419_10345924 | Not Available | 1010 | Open in IMG/M |
| 3300007076|Ga0075435_100555969 | Not Available | 994 | Open in IMG/M |
| 3300007076|Ga0075435_101047339 | Not Available | 713 | Open in IMG/M |
| 3300009038|Ga0099829_10053528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 2999 | Open in IMG/M |
| 3300009038|Ga0099829_11198845 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300009093|Ga0105240_10332002 | All Organisms → cellular organisms → Bacteria | 1730 | Open in IMG/M |
| 3300009094|Ga0111539_10786684 | Not Available | 1107 | Open in IMG/M |
| 3300009100|Ga0075418_12010109 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300009137|Ga0066709_104317940 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300009147|Ga0114129_12687979 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300009147|Ga0114129_13205940 | Not Available | 532 | Open in IMG/M |
| 3300009444|Ga0114945_10078934 | Not Available | 1827 | Open in IMG/M |
| 3300009444|Ga0114945_10251191 | Not Available | 1034 | Open in IMG/M |
| 3300009792|Ga0126374_11807913 | Not Available | 511 | Open in IMG/M |
| 3300009802|Ga0105073_1042994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 574 | Open in IMG/M |
| 3300009804|Ga0105063_1007174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 1115 | Open in IMG/M |
| 3300009808|Ga0105071_1099332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 527 | Open in IMG/M |
| 3300009810|Ga0105088_1068384 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300009814|Ga0105082_1002062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 2385 | Open in IMG/M |
| 3300009818|Ga0105072_1005031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfonema → Desulfonema limicola | 2219 | Open in IMG/M |
| 3300009822|Ga0105066_1091161 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300009822|Ga0105066_1173580 | Not Available | 502 | Open in IMG/M |
| 3300009837|Ga0105058_1145268 | Not Available | 574 | Open in IMG/M |
| 3300010043|Ga0126380_11244528 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300010046|Ga0126384_10394937 | Not Available | 1166 | Open in IMG/M |
| 3300010047|Ga0126382_12392679 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300010358|Ga0126370_10559123 | Not Available | 979 | Open in IMG/M |
| 3300010359|Ga0126376_12549496 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300010360|Ga0126372_10401230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 1251 | Open in IMG/M |
| 3300010392|Ga0118731_101286372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 720 | Open in IMG/M |
| 3300010398|Ga0126383_10916139 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 963 | Open in IMG/M |
| 3300010413|Ga0136851_10740782 | Not Available | 965 | Open in IMG/M |
| 3300010430|Ga0118733_104883574 | Not Available | 711 | Open in IMG/M |
| 3300011118|Ga0114922_10438967 | Not Available | 1082 | Open in IMG/M |
| 3300012189|Ga0137388_11937332 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300012205|Ga0137362_11018763 | Not Available | 705 | Open in IMG/M |
| 3300012354|Ga0137366_10905346 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300012362|Ga0137361_10289999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 1497 | Open in IMG/M |
| 3300012362|Ga0137361_10385052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfonema → Desulfonema limicola | 1288 | Open in IMG/M |
| 3300012362|Ga0137361_10972787 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300012362|Ga0137361_11603341 | Not Available | 572 | Open in IMG/M |
| 3300012405|Ga0134041_1206164 | Not Available | 505 | Open in IMG/M |
| 3300012948|Ga0126375_10419010 | Not Available | 974 | Open in IMG/M |
| 3300012948|Ga0126375_10871088 | Not Available | 721 | Open in IMG/M |
| 3300012971|Ga0126369_10122538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 2397 | Open in IMG/M |
| 3300013306|Ga0163162_13272319 | Not Available | 519 | Open in IMG/M |
| 3300014487|Ga0182000_10363051 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300015052|Ga0137411_1161658 | Not Available | 1805 | Open in IMG/M |
| 3300015245|Ga0137409_10810218 | Not Available | 771 | Open in IMG/M |
| 3300016371|Ga0182034_10074856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 2337 | Open in IMG/M |
| 3300016422|Ga0182039_10808639 | Not Available | 832 | Open in IMG/M |
| 3300017997|Ga0184610_1023910 | Not Available | 1668 | Open in IMG/M |
| 3300017997|Ga0184610_1193783 | Not Available | 678 | Open in IMG/M |
| 3300018052|Ga0184638_1183970 | Not Available | 741 | Open in IMG/M |
| 3300018052|Ga0184638_1273041 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300018078|Ga0184612_10534575 | Not Available | 566 | Open in IMG/M |
| 3300018433|Ga0066667_10225363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1400 | Open in IMG/M |
| 3300018433|Ga0066667_10343573 | Not Available | 1183 | Open in IMG/M |
| 3300018433|Ga0066667_10421070 | Not Available | 1084 | Open in IMG/M |
| 3300018433|Ga0066667_12031592 | Not Available | 529 | Open in IMG/M |
| 3300018466|Ga0190268_12365052 | Not Available | 503 | Open in IMG/M |
| 3300019789|Ga0137408_1300052 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300019885|Ga0193747_1118703 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300021051|Ga0206224_1001669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 2181 | Open in IMG/M |
| 3300021560|Ga0126371_10319287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1683 | Open in IMG/M |
| 3300022563|Ga0212128_10123834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 1668 | Open in IMG/M |
| (restricted) 3300022938|Ga0233409_10006479 | Not Available | 2631 | Open in IMG/M |
| (restricted) 3300023089|Ga0233408_10001141 | Not Available | 2193 | Open in IMG/M |
| 3300025165|Ga0209108_10013975 | All Organisms → cellular organisms → Bacteria | 4538 | Open in IMG/M |
| 3300025910|Ga0207684_10801319 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 796 | Open in IMG/M |
| 3300025945|Ga0207679_10113271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 2145 | Open in IMG/M |
| 3300025945|Ga0207679_11181230 | Not Available | 702 | Open in IMG/M |
| 3300026315|Ga0209686_1136772 | Not Available | 779 | Open in IMG/M |
| 3300026324|Ga0209470_1245762 | Not Available | 721 | Open in IMG/M |
| 3300026325|Ga0209152_10460023 | Not Available | 515 | Open in IMG/M |
| 3300026340|Ga0257162_1026061 | Not Available | 712 | Open in IMG/M |
| 3300026535|Ga0256867_10106235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1079 | Open in IMG/M |
| 3300026540|Ga0209376_1286218 | Not Available | 666 | Open in IMG/M |
| 3300026547|Ga0209156_10387275 | Not Available | 588 | Open in IMG/M |
| 3300026552|Ga0209577_10505185 | Not Available | 801 | Open in IMG/M |
| 3300027032|Ga0209877_1009746 | Not Available | 848 | Open in IMG/M |
| 3300027068|Ga0209898_1005940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1434 | Open in IMG/M |
| 3300027169|Ga0209897_1068366 | Not Available | 526 | Open in IMG/M |
| 3300027277|Ga0209846_1017331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 1191 | Open in IMG/M |
| 3300027324|Ga0209845_1005294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 2222 | Open in IMG/M |
| 3300027324|Ga0209845_1005302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 2221 | Open in IMG/M |
| 3300027561|Ga0209887_1026607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 1352 | Open in IMG/M |
| 3300027561|Ga0209887_1098298 | Not Available | 593 | Open in IMG/M |
| 3300027643|Ga0209076_1112143 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300027835|Ga0209515_10086270 | Not Available | 2168 | Open in IMG/M |
| 3300027882|Ga0209590_10240127 | Not Available | 1154 | Open in IMG/M |
| 3300027882|Ga0209590_10630706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 689 | Open in IMG/M |
| 3300027888|Ga0209635_10745041 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300027909|Ga0209382_10061404 | Not Available | 4456 | Open in IMG/M |
| 3300027909|Ga0209382_10214924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 2197 | Open in IMG/M |
| 3300027909|Ga0209382_10309812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 1779 | Open in IMG/M |
| 3300027947|Ga0209868_1012138 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300028792|Ga0307504_10144143 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300028828|Ga0307312_11009781 | Not Available | 551 | Open in IMG/M |
| 3300030540|Ga0247649_1002709 | Not Available | 980 | Open in IMG/M |
| 3300030600|Ga0247659_1011999 | Not Available | 1002 | Open in IMG/M |
| 3300031229|Ga0299913_10209023 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1932 | Open in IMG/M |
| 3300031564|Ga0318573_10551810 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300031771|Ga0318546_10073906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 2183 | Open in IMG/M |
| 3300031805|Ga0318497_10050327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 2147 | Open in IMG/M |
| 3300031820|Ga0307473_10299031 | Not Available | 1012 | Open in IMG/M |
| 3300031845|Ga0318511_10125116 | Not Available | 1110 | Open in IMG/M |
| 3300031880|Ga0318544_10020670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 2207 | Open in IMG/M |
| 3300031894|Ga0318522_10264976 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300031912|Ga0306921_10165860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 2586 | Open in IMG/M |
| 3300031942|Ga0310916_10113094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 2197 | Open in IMG/M |
| 3300031945|Ga0310913_10078598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 2199 | Open in IMG/M |
| 3300031946|Ga0310910_10565228 | Not Available | 902 | Open in IMG/M |
| 3300031947|Ga0310909_10087769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 2478 | Open in IMG/M |
| 3300031954|Ga0306926_10172030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 2686 | Open in IMG/M |
| 3300031954|Ga0306926_10495955 | Not Available | 1501 | Open in IMG/M |
| 3300031965|Ga0326597_10442145 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
| 3300032001|Ga0306922_11603261 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300032013|Ga0310906_10599444 | Not Available | 759 | Open in IMG/M |
| 3300032041|Ga0318549_10584226 | Not Available | 501 | Open in IMG/M |
| 3300032042|Ga0318545_10029969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Teredinibacter → Teredinibacter franksiae | 1778 | Open in IMG/M |
| 3300032180|Ga0307471_103744160 | Not Available | 538 | Open in IMG/M |
| 3300032180|Ga0307471_103748395 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300032262|Ga0316194_10984841 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300033289|Ga0310914_10462206 | Not Available | 1149 | Open in IMG/M |
| 3300033551|Ga0247830_10753157 | Not Available | 774 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 13.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.02% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 9.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.25% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.12% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.12% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.60% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 1.56% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 1.56% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.56% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.04% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.04% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.04% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.04% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.04% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.04% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.52% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.52% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.52% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 0.52% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.52% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.52% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.52% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.52% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.52% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001752 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 | Environmental | Open in IMG/M |
| 3300001753 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-3-24_28 | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009802 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 | Environmental | Open in IMG/M |
| 3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300021051 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300022938 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MG | Environmental | Open in IMG/M |
| 3300023089 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_11_MG | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026340 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A | Environmental | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027032 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027068 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027169 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027947 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030540 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030600 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb12 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032262 | Coastal sediment microbial communities from Maine, United States - Cross River sediment 1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1015096231 | 3300000559 | Soil | MQGSTVMRQSGAETLVTEEPYELIAHVRDCGGAGGVTTGSTRKPTPNSLV |
| AF_2010_repII_A01DRAFT_10735222 | 3300000580 | Forest Soil | MRQSCADALATEEPDALIAHVRVCGGAGRVTVGSTRKGVIR |
| JGI11643J11755_117276761 | 3300000787 | Soil | MVLQGSTVMRRSGAETPVTEEPYXLIAHVRDCGGAGWATTGSTR |
| AF_2010_repII_A001DRAFT_100811261 | 3300000793 | Forest Soil | MRQSCADALATEEPDALIAHVRVCGGAGRVTVGSTRKRVIC |
| JGI10213J12805_100403041 | 3300000858 | Soil | MRQSGAETLVTEEPYALIAHVRVCGGAGWATAGSTRKLTGNSV |
| JGI10213J12805_103499991 | 3300000858 | Soil | LQGSKVMHQSCADALVPEEPDELIAHVRVCGGAGWVTTGSTRKLSA |
| JGI1027J12803_1089135332 | 3300000955 | Soil | IGMQGSKVMHQSHAGTLAPEEPDELIAHVRVCGGAGWVTTGSTRKG* |
| JGI2173J19968_100226303 | 3300001752 | Marine Sediment | MRQSCAKTLVTEEPDEGNLHVRLCGGSTWVTGASTR |
| JGI2171J19970_100317151 | 3300001753 | Marine Sediment | MRQSCAKTLVTEEPDEGNLHVRLCGGSTWVTGASTRTIRI |
| JGI25385J37094_100433792 | 3300002558 | Grasslands Soil | MQGSKVMHQSHAGTLAPEEPDELIAHVRVCGGAGWVTTGSTRKPTPTAFAR |
| JGI25382J37095_100296023 | 3300002562 | Grasslands Soil | MQGSKVMHQSHAGTLAPEEPDELIAHVRVCGGAGWVTTGSTRKPTPSSLRS |
| JGI25382J43887_102464871 | 3300002908 | Grasslands Soil | MQGSKVMHQSHAGTLAPEEPDELIAHVRVCGGAGWVTTGSTRKPTP |
| JGI25407J50210_100851221 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MRQSGAEALVTEEPYAVIAHVRDCGGAGRATTGSTRKRTAKTL |
| Ga0066398_100163672 | 3300004268 | Tropical Forest Soil | MQGSTVMRQSSAEALVTEEPYALIAHVRVCGGAGWVTTGSTR |
| Ga0066397_100818501 | 3300004281 | Tropical Forest Soil | MQGSKVMHQSRAGALTPEEPDELIAHVRVCGGAGWVTTGSTRKPT |
| Ga0063356_1028894102 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MQGSKVMHQSRAGTLAPEEPDELIAHVRVCGGAGWVTTGSTRKPT |
| Ga0066674_101909822 | 3300005166 | Soil | MRQSCADTLATEEPDELITHVRVCGGAGWVTIGSTRKPTASS |
| Ga0066672_104875921 | 3300005167 | Soil | MQGSKVMHQSHAGTLAPEEPDELIAHVRVCGGAGWVTTGSTRKPTPTASARASLW |
| Ga0066680_106810821 | 3300005174 | Soil | MQGSKVMHQSGAETLVTEEPYALIAHVRVCGGAGWVTTGSTRKPTP |
| Ga0066690_104570571 | 3300005177 | Soil | MQGSKVMHQSHAGTLAPEEPDELIAHVRVCGGAGWVTTGSTRKPTASSFGSAPLI* |
| Ga0066690_107774452 | 3300005177 | Soil | MQGSTVMRQSGAETLVTEEPDAFIAHVRVCGGAGWVTTGSTRK |
| Ga0066685_103055652 | 3300005180 | Soil | MQGSKVMHQSHAGTLAPEEPDELIAHVRVCGGAGWVTTGSTRKP |
| Ga0066685_103315972 | 3300005180 | Soil | MQGSTVMRQSGAATLATEEPDAFIAHVRVCGGAGWVTTGSTRKATAYSRRA* |
| Ga0066685_108213861 | 3300005180 | Soil | MWLCRAAKVMHQSGAETLVTEEPYALIAHVRVCGGAGWVTTGSTRKPTPNS |
| Ga0066678_101824313 | 3300005181 | Soil | MRQSGAETLVTEEPYAFIAHVRVCGGADWVTIGSTRKPTPTA |
| Ga0066678_107948332 | 3300005181 | Soil | MQGSTVMRQRSAETLAPEEPYALIAHVRVCGGAGWATTGSTR |
| Ga0065705_100159711 | 3300005294 | Switchgrass Rhizosphere | MHQSQAGTLAPEEPDEFIAHVRVCGGAGWVTTGSTRKATG |
| Ga0068868_1007484041 | 3300005338 | Miscanthus Rhizosphere | MQGSKVMHQSRAGTLTPEEPDELIAHVRVCGGAGWVTTGSTRK |
| Ga0070669_1013999551 | 3300005353 | Switchgrass Rhizosphere | MRQSCADTLATEEPDALITHVRVCGGAGWVTIGSTRKPTPYSVRCAPAS |
| Ga0070705_1000162165 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MQGSKVMHQSRAGTLTPEEPDELIAHVRVCGGAGWVTTGSTR |
| Ga0070700_1000987213 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MQGSTVMRQSSAEALVTEEPYALIAHVRVCGGAGWVTIGSTRQP |
| Ga0070700_1011378921 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MQGSTVMRQSRADTLVTEEPDALIAHVRVCGGAGWVTTGSTRKATANSLVSLV |
| Ga0070708_1004502372 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MQGSTVMRQRCAETLAPEEPYALIAHVRVCGGAGWVTTGSTRKPT |
| Ga0066686_106913731 | 3300005446 | Soil | MRQRGVETLITEEPDDLIGHVRICGGAGWVTAGSTRKWDAAPVAVL |
| Ga0070698_1002053661 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MQGSTVMRQSSAEALVTEEPYALIAHVRVCGGAGWVTTGSTRKPT |
| Ga0070679_1017462211 | 3300005530 | Corn Rhizosphere | MQGSKVMHQSRAGTLTPEEPDELIAHVRVCGGAGWVTTGSTRKS |
| Ga0066697_106510832 | 3300005540 | Soil | MQGSTGMRQRDTETLVTEEPDAFMAHVRVCGGAGWVTTGSTR |
| Ga0066701_107097241 | 3300005552 | Soil | MCQRRAKTLATEEPDALIAHVRVCGGAGWVTTGSTR |
| Ga0066701_109375872 | 3300005552 | Soil | MRQRGVETLITEEPDDLIGHVRICGGAGWVTAGSTRN |
| Ga0066707_101310251 | 3300005556 | Soil | MRQRGVETLITEEPDDLIGHVRICGGAGWVTAGSTRK |
| Ga0066700_102536881 | 3300005559 | Soil | MRQSGAETLVTEEPYELIAHVRVCGGAGWVTTGSTRK |
| Ga0070664_1001350503 | 3300005564 | Corn Rhizosphere | MQGSTVMRQSSAEALVTEEPYALIAHVRVCGGAGWVTTGSTRKPC |
| Ga0070723_107319631 | 3300005612 | Marine Sediment | MRQSCAETLITEEPDELIAHVRICGEDGWVTAVFTRRM |
| Ga0068864_1002910262 | 3300005618 | Switchgrass Rhizosphere | MQGSKVMHQSRAGTLTPEEPDELIAHVRVCGGAGWVTTGSTRK* |
| Ga0066903_1023082201 | 3300005764 | Tropical Forest Soil | KVMHQSRAGTLTPEEPDELIAHVRVCGGAGWVTTGSTRK* |
| Ga0066903_1026145842 | 3300005764 | Tropical Forest Soil | MHQSRAGTLTPEEPDELIAHVRVCGGAGWVTTGSTR |
| Ga0066903_1063415001 | 3300005764 | Tropical Forest Soil | SKVMHQSRAGTLTPEEPDELIAHVRVCGGAGWVTTGSTRNQ* |
| Ga0068858_1017835822 | 3300005842 | Switchgrass Rhizosphere | MQGSTVMRQSSAEALVTEEPYALIAHVRVCGGAGWVTTGSTRK |
| Ga0081455_110632142 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MAMQGSKVMHQSRAGTLAPEEPDELIAHGRVCGGAGWVT |
| Ga0081538_102772791 | 3300005981 | Tabebuia Heterophylla Rhizosphere | EALVTEEPYALIAHVRVCGGAGWVTTGSTRKPRPPS* |
| Ga0075417_102845732 | 3300006049 | Populus Rhizosphere | MRQSCAETLVTEEPDELIAHVRVCGGAEWVTTGSTRKPTP |
| Ga0075428_1003126082 | 3300006844 | Populus Rhizosphere | MQGSKVMRQRHAETLAPEEPNELIAHVRVCGGAEWVTTGSTRKPTPNSLVSL* |
| Ga0075428_1011983181 | 3300006844 | Populus Rhizosphere | MWLCRAAKVMHQSGAETLVTEEPYALIAHVRVCGGAGWATAGSTR |
| Ga0075428_1023760641 | 3300006844 | Populus Rhizosphere | MRQSCAETLVTEEPDELIAHVRVCGGAGWVTIGSTRKP |
| Ga0075421_1009714961 | 3300006845 | Populus Rhizosphere | LAVLGSTVMRQSGAETLVTEEPDALIAHVRVCGGA |
| Ga0075430_1001092044 | 3300006846 | Populus Rhizosphere | MQGSTVMRQSRADTLVTEEPDALIAHVRVCGGAGWVTTGSTRKAT |
| Ga0075430_1001839451 | 3300006846 | Populus Rhizosphere | MQGSKVMHQSRAGTLAPEEPDELIAHVRVCGGAGWVTTGSTR |
| Ga0075431_1008840511 | 3300006847 | Populus Rhizosphere | MQGSKVMRQRHAETLAPEEPDEFIAHVRVCGGAGWVTTGSTRKPTP |
| Ga0075431_1018206592 | 3300006847 | Populus Rhizosphere | MQGSKVMRQSGAETLGTEEPYELIAHVRDCGGAGWATTGSTRKPTPYS |
| Ga0075420_1012256952 | 3300006853 | Populus Rhizosphere | GSKVMRQRGAETLVTEEPDAFIAHVRVCGGAGWVTTGSTRKG* |
| Ga0075425_1010856661 | 3300006854 | Populus Rhizosphere | MQGSTGLRQSRAATLVTEEPDAFIAPVRVCGGAGWVTAGSTR |
| Ga0075425_1029837401 | 3300006854 | Populus Rhizosphere | MRQSCADALATEEPDALIAHVRVCGRAGWVTTGSTR |
| Ga0075434_1007039902 | 3300006871 | Populus Rhizosphere | MRQRGAETLVTEEPDALIAHVRVCGGAGWVTTGSTRKPT |
| Ga0075434_1013111611 | 3300006871 | Populus Rhizosphere | MRGSTVMRQSRAETLVTEEPYAFIAHVRVCGGAGWVTIGSTR |
| Ga0075426_111177331 | 3300006903 | Populus Rhizosphere | MRQSCADTLATEEPDELIAHVRVCGGAGWVTIGSTR |
| Ga0075424_1012654622 | 3300006904 | Populus Rhizosphere | MQGSTVMRQSSAEALVTEEPYAFIAHVRVCGGAGWVTTYASS* |
| Ga0075419_103459242 | 3300006969 | Populus Rhizosphere | MRQSCAETLVTEEPDELIAHVRVCGGAGWVTIGPTRK |
| Ga0075435_1005559692 | 3300007076 | Populus Rhizosphere | MRQSCADTLATEEPDELIAHVRVCGGAGWVTIGST |
| Ga0075435_1010473392 | 3300007076 | Populus Rhizosphere | MRQRGAETLVTEEPDALIAHVRVCGGAGWVTTGSTRKP |
| Ga0099829_100535285 | 3300009038 | Vadose Zone Soil | MRQSGAATLATEEPEAFIAHVRVCGGAGWVTTGSTRKA |
| Ga0099829_111988452 | 3300009038 | Vadose Zone Soil | MQGSTVMRQRGAKTLVTEEPYAFIAHVRVCGGAGWVTAGSTRK |
| Ga0105240_103320021 | 3300009093 | Corn Rhizosphere | MQGSTVMRQSRADTLVTEEPDAFIAHVRVCGGAGWVTTGSTRKLTAYSLRCA |
| Ga0111539_107866841 | 3300009094 | Populus Rhizosphere | MQGSTVMHQSHAGTLAPEEPDELIAHVRVCGGAGWVTTGSTRK |
| Ga0075418_120101092 | 3300009100 | Populus Rhizosphere | MQGSKVMHQSRAGTLAPEEPDELIAHVRVCGGAGWVTTGSTRKP |
| Ga0066709_1043179401 | 3300009137 | Grasslands Soil | MRQRGAEALVTEEPYALIAHVRVCGGAGWVTTGSTRKP |
| Ga0114129_126879792 | 3300009147 | Populus Rhizosphere | MRQSCADTLATEEPDELITHVRVCGGAGWVTIGSTRKPTPNSLCFAP |
| Ga0114129_132059402 | 3300009147 | Populus Rhizosphere | MQGSTVMRQRRAETLVTEEPYALIAHVRVCGGAGWATAG |
| Ga0114945_100789342 | 3300009444 | Thermal Springs | MQGSTVMRQSGTETLVTEEPYAFIAYVRVCGWAGRATT |
| Ga0114945_102511912 | 3300009444 | Thermal Springs | MRQSSAETLVTEEPYELIAHVRICGGAGRVTAGPTRKPTR |
| Ga0126374_118079131 | 3300009792 | Tropical Forest Soil | MQGSPGMRQSSAAALGTEEPSAFIAHVRVCGGAGWVTTGSTRK |
| Ga0105073_10429942 | 3300009802 | Groundwater Sand | MRQRGVETLMTEEPDDLIGHVRICGGAGWATAGSTRNRI |
| Ga0105063_10071741 | 3300009804 | Groundwater Sand | MRQRGVETLITEEPDDLIGHVRICGGAGRATAGSTRNWTPA |
| Ga0105071_10993322 | 3300009808 | Groundwater Sand | MRQRDVETLITEEPDALIAHVRVCGGAGWATAGSTRN |
| Ga0105088_10683841 | 3300009810 | Groundwater Sand | MRQRDVETLITEEPDALIAHVRVCGGAGWATAGSTRNV |
| Ga0105082_10020621 | 3300009814 | Groundwater Sand | MRQRGAETLITEEPDALIAHVRVCGGAGWATAGSTRNRIAAR |
| Ga0105072_10050311 | 3300009818 | Groundwater Sand | MRQSGTKTLVTEEPYALIAHVRVCGGAGWVTTGSTRKPTPYSLRS |
| Ga0105066_10911611 | 3300009822 | Groundwater Sand | MRQRGAETLITEEPDALIAHVRVCGGAGWATAGSTRNVTAA |
| Ga0105066_11735801 | 3300009822 | Groundwater Sand | MRQSGAETLVTEEPYALIAHVRVCGGAGWVTTGSTRKRNPYSIWVDTEGQQL |
| Ga0105058_11452681 | 3300009837 | Groundwater Sand | MRQSCADTLATEEPDELITHVRVCGGAGWVTIGSTRKPTPNSLR |
| Ga0126380_112445282 | 3300010043 | Tropical Forest Soil | MQGSKVMHQSRAGALTPEEPDELIAHVRVCGGAGWV |
| Ga0126384_103949372 | 3300010046 | Tropical Forest Soil | MQGSTVMRQRHAETLAPEEPDELIAHVRVCGGAGWVTTGSTRKPTP |
| Ga0126382_123926792 | 3300010047 | Tropical Forest Soil | MRQSGAETLVTEEPYELIAHVRICGGAGWVTTGSTR |
| Ga0126370_105591231 | 3300010358 | Tropical Forest Soil | MQGSTVMRQSSAEVLVTEEPYAFIAHVGVCGGAGGVTTGSTRKH |
| Ga0126376_125494961 | 3300010359 | Tropical Forest Soil | MRQSGAETLVTEEPYELMAHVRTCGGAGWVTTGSTRKP |
| Ga0126372_104012302 | 3300010360 | Tropical Forest Soil | MQGSTVMRQSSAETLVTEEPYALIAHVRVCGGAGWVTTGSTRKPT |
| Ga0118731_1012863721 | 3300010392 | Marine | VMRQSGVDTLIIEEPDDQIGHVRICGGDGSVMAVSTRKLTDY* |
| Ga0126383_109161392 | 3300010398 | Tropical Forest Soil | MQGSTVMRQRHAEPLAPEEPDELIAHVRVCGGAGWVT |
| Ga0136851_107407822 | 3300010413 | Mangrove Sediment | MRQSCAEALVTEEPDERMVHVRICGGAGRVTAGSTRKMAHEGFVGP |
| Ga0118733_1048835741 | 3300010430 | Marine Sediment | MRQRSAESLITEEPDELIAHVRICGEDGWVTAVFTRRM |
| Ga0114922_104389671 | 3300011118 | Deep Subsurface | SKVMRQSCAKTLVTEEPDEGNLHVRLCGGSTWVTGASTRSVINR* |
| Ga0137388_119373321 | 3300012189 | Vadose Zone Soil | MRQRSAETLAPEEPYAFIAHVRVCGGAGWVTTGSTRKLTAHSAG |
| Ga0137362_110187631 | 3300012205 | Vadose Zone Soil | MQGSKVMHQSHAGTLAPEEPDELIAHVRVCGGAGWVTTGSTRKRT |
| Ga0137366_109053461 | 3300012354 | Vadose Zone Soil | MRQSGAETLVTEEPYELIAHVRVCGGAGWVTTGSTRKPNHG |
| Ga0137361_102899991 | 3300012362 | Vadose Zone Soil | MRQSGAETLVTEEPYELIAHVRVCGGAGWVTTGSTRKP |
| Ga0137361_103850523 | 3300012362 | Vadose Zone Soil | MQGSTVMRQSGAATLATEEPDALIAHVRVCGGAGWVT |
| Ga0137361_109727871 | 3300012362 | Vadose Zone Soil | MRQSCADTLATEEPDELITHVRVCGGAGWVTIGSTRKLTAHSAGFLGGAWLFVCG |
| Ga0137361_116033411 | 3300012362 | Vadose Zone Soil | SGAETLVTEEPYELIAHVRVCGGAGWVTTGSTRKP* |
| Ga0134041_12061641 | 3300012405 | Grasslands Soil | MQGSTVMRQSGAATLATEEPDAFIAHVRVCGGAGWVTTGSTRTLVVKGIMV |
| Ga0126375_104190101 | 3300012948 | Tropical Forest Soil | MRQSGAETLVAEEPYELIAHVRICGGAGWVTTGSTRKPE |
| Ga0126375_108710881 | 3300012948 | Tropical Forest Soil | MQGSIVMRQRHAETLAPEEPDELIAHVRVCGGAGWVTTGSTRKPTPTAY |
| Ga0126369_101225384 | 3300012971 | Tropical Forest Soil | MQGSTVMRQSSAETLVTEEPYALIAHVRVCGGAGWVTTGSTRK* |
| Ga0163162_132723191 | 3300013306 | Switchgrass Rhizosphere | MQGSTVMRQSSAEALVTEEPYALIAHVRVCGGAGWVTIGSTRKA |
| Ga0182000_103630512 | 3300014487 | Soil | MQGSTVMDQSRAGTLTPEEPDELIAHVRVCGGAGWVTTGSTRK |
| Ga0137411_11616583 | 3300015052 | Vadose Zone Soil | MRQSCAETLATEEPDELIAHVRVCGGAGWVTIGSTRKPTPRS |
| Ga0137409_108102182 | 3300015245 | Vadose Zone Soil | MRQSGAEALVTEEPYAFIAHVRVCGGAGWVTTGSTRKLAGKTLAFGNT |
| Ga0182034_100748564 | 3300016371 | Soil | MRQSGAETLVTEEPYALIAHVRVCGGAGWVTIGSTR |
| Ga0182039_108086392 | 3300016422 | Soil | MQGSKVMHQSRAGTLTPEEPDELIAHVRVCGGAGWVTTGSTRKRGKTPVL |
| Ga0184610_10239103 | 3300017997 | Groundwater Sediment | MQGSTVMRQRSAETLAPEEPYALIAHVRVCGGAGGVTTGSTRKATGHSAGFFPAR |
| Ga0184610_11937831 | 3300017997 | Groundwater Sediment | MQGSTVMRQRGAETLVTEEPYALIAHVRVCGGAGWVTTGSTR |
| Ga0184638_11839701 | 3300018052 | Groundwater Sediment | MQGSTVMRQSGAATLATEEPDAFIAHVRVCGGAGWVTTGS |
| Ga0184638_12730411 | 3300018052 | Groundwater Sediment | MQGSKVMHQSRAGTLAPEEPDELIAHVRVCGGAGWVTTGSTRK |
| Ga0184612_105345751 | 3300018078 | Groundwater Sediment | VMCQRRAKTLATEEPDAFIAHVRVCGGAGWVTTGSTRNVAAEKASI |
| Ga0066667_102253633 | 3300018433 | Grasslands Soil | MQGSTVMRQSGAATLATEEPDAFIAHVRVCGGAGWVTTGSTR |
| Ga0066667_103435733 | 3300018433 | Grasslands Soil | MRQSGAETLVTEEPYELIAHVRVCGGAGWVTTGSTRKSILQYEKW |
| Ga0066667_104210702 | 3300018433 | Grasslands Soil | MQGSKVMHQSHAGTLAPEEPDALIAHVRVCGGAGCVTTGS |
| Ga0066667_120315922 | 3300018433 | Grasslands Soil | MQGSTVMRQSGAETLVTEEPDAFIAHVRVCGGAGWVTTGSTR |
| Ga0190268_123650522 | 3300018466 | Soil | MQGSKVMHQSRAGTLAPEEPDELIAHVRVCGGAGWVTTGSTRKRVTA |
| Ga0137408_13000521 | 3300019789 | Vadose Zone Soil | MRQSGAETLVTEEPYELIAHVRVCGGAGWVTTGLTTGSTRK |
| Ga0193747_11187031 | 3300019885 | Soil | MRQSCADTLATEEPDELIAHVRVCGGAGWVTIGSTRKPTPTASARA |
| Ga0206224_10016691 | 3300021051 | Deep Subsurface Sediment | MRQRDVATLITEEPDALIAHVRVCGGAGWATTGSTRKQ |
| Ga0126371_103192873 | 3300021560 | Tropical Forest Soil | MQGSKVMHQSRAGTLTPEEPDELIAHVRVCGGAGWVTTGST |
| Ga0212128_101238341 | 3300022563 | Thermal Springs | MRQSGAETLVTEEPYAFIAHVRVCGGAGWVTTGSTRKLTAHSLGSVAGEGLY |
| (restricted) Ga0233409_100064793 | 3300022938 | Seawater | MRQRCAESLITEEPDELIAHVRICGEDGWVTAVFTRRM |
| (restricted) Ga0233408_100011411 | 3300023089 | Seawater | MRQRCAESLITEEPDELIAHVRICGEDGWVTAVFTRRMSSTFCS |
| Ga0209108_100139751 | 3300025165 | Soil | MRQRDVETLITEEPDALIAHVRVCGGAGWVTTGSTRHALLF |
| Ga0207684_108013191 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MQGSTVMRQRRAETLVTEEPYALIAHVRVCGGASRVTAGSTRKTDGESE |
| Ga0207679_101132713 | 3300025945 | Corn Rhizosphere | MQGSTVMRQSSAEALVTEEPYALIAHVRVCGGAGWV |
| Ga0207679_111812301 | 3300025945 | Corn Rhizosphere | MQGSTVMRQSRAETLVTEEPDALIAHVRVCGGAGWVTTGSTRKATAASV |
| Ga0209686_11367722 | 3300026315 | Soil | VMRQSGAATLATEEPDAFIAHVRVCGGAGWVTTGFTRKVSPRTV |
| Ga0209470_12457622 | 3300026324 | Soil | MRQSGAETLVTEEPYELIAHVRVCGGAGWVTTGSTRKPTN |
| Ga0209152_104600232 | 3300026325 | Soil | TLVTEEPYELIAHVRVCGGAGWVTTGSTRKSILQYEKWL |
| Ga0257162_10260612 | 3300026340 | Soil | MQGSTVMRQRRAETLVTEEPYAFIAHVRVCGGAGRVTAGSTRKR |
| Ga0256867_101062353 | 3300026535 | Soil | MRQSGADTLGTEEPYEFIAHVRDGGGAGGVTTGSTRKR |
| Ga0209376_12862182 | 3300026540 | Soil | VMRQSGAATLATEEPDAFIAHVRVCGGAGWVTTGS |
| Ga0209156_103872751 | 3300026547 | Soil | MQGSTVMRQSGAATLATEEPDAFIAHVRVCGGAGWVTTG |
| Ga0209577_105051851 | 3300026552 | Soil | MQGSTVMRQSGAATLATEEPDAFIAHVRVCGGAGWVTTGSTRKL |
| Ga0209877_10097462 | 3300027032 | Groundwater Sand | MRQRGVETLMTEEPDDLIGHVRICGGAGWATAGSTRNLTA |
| Ga0209898_10059401 | 3300027068 | Groundwater Sand | MRQSCADTLATEEPDELITHVRVCGGAGWVTIGSTRKLTA |
| Ga0209897_10683661 | 3300027169 | Groundwater Sand | MRQSCADTLATEEPDELITHVRVCGGAGWVTIGSTRKPT |
| Ga0209846_10173311 | 3300027277 | Groundwater Sand | MRQRDVETLITEEPDALIAHVRVCGGAGWATAGSTRNR |
| Ga0209845_10052942 | 3300027324 | Groundwater Sand | MRQRGAETLITEEPDALIAHVRVCGGAGWATAGSTRNRIA |
| Ga0209845_10053021 | 3300027324 | Groundwater Sand | MRQRDVETLITEEPDALIAHVRVCGGAGWATAGSTRNRIA |
| Ga0209887_10266071 | 3300027561 | Groundwater Sand | MRQRDVETLITEEPDALIAHVRVCGGAGWATAGSTRNRIAAR |
| Ga0209887_10982981 | 3300027561 | Groundwater Sand | MRQSCADTLATEEPDELITHVRVCGGAGWVTIGSTRKPTPNSLRSC |
| Ga0209076_11121431 | 3300027643 | Vadose Zone Soil | MRQSGAETLVTEEPYELIAHVRVCGGAGWVTTGSTRKPIKQQNL |
| Ga0209515_100862703 | 3300027835 | Groundwater | MRQRGVETLITEEPDDLIGHVRICGGAGWATAGSTRKQM |
| Ga0209590_102401272 | 3300027882 | Vadose Zone Soil | MQGSTVMRQRSAETLAPEEPYALIAHVRVCGGAGWATTG |
| Ga0209590_106307061 | 3300027882 | Vadose Zone Soil | MRQSGAETLVTEDPYAFIAHVRVCGGAGWVTTGSTRKL |
| Ga0209635_107450412 | 3300027888 | Marine Sediment | MRQSCAKTLVTEEPDEGNLHVRLCGGSTWVTGASTRTEI |
| Ga0209382_100614041 | 3300027909 | Populus Rhizosphere | VLRPSRAETLVTEELYAFIAPVRVCGGAGWVTAGSTRKPTPNSWSDVG |
| Ga0209382_102149241 | 3300027909 | Populus Rhizosphere | MRQRGAETLVTEEPDALIAHVRVCGGAGWVTTGSTRKPTANSVRYAP |
| Ga0209382_103098121 | 3300027909 | Populus Rhizosphere | MRQSCAETLVTEEPDELIAHVRVCGGAGWVTIGPTRKLT |
| Ga0209868_10121381 | 3300027947 | Groundwater Sand | MQGSKVMHQSRAGTLAPEEPDEFIAHVRVCGGAGWVTTGSTRKPTPTAGA |
| Ga0307504_101441432 | 3300028792 | Soil | VQGSIVMCQRRAKTLATEEPDALIAHVRVCGGAGWVTTGSTRKATPN |
| Ga0307312_110097811 | 3300028828 | Soil | MRQSGAETLVTEEPYALIAHVRVCGGAGWVTTGSTRKPTPYSLRFA |
| Ga0247649_10027092 | 3300030540 | Soil | MRQSGAETLVTEEPDALIAHVRVCGGAGWVTTGSTRKQ |
| Ga0247659_10119992 | 3300030600 | Soil | MRQSGAETLVTEEPDALIAHVRVCGGAGWVTIGSTRKPTQERN |
| Ga0299913_102090235 | 3300031229 | Soil | MRQSGADTLGTEEPYEFIAHVRDGGGAGGVTTGSTRKRTAPSAG |
| Ga0318573_105518102 | 3300031564 | Soil | MRQSGAETLVTEEPYALIAHVRVCGGAGWVTIGSTRNSS |
| Ga0318546_100739061 | 3300031771 | Soil | MRQSGAETLVTEEPYALIAHVRVCGGAGWVTIGSTRKS |
| Ga0318497_100503273 | 3300031805 | Soil | MRQSGAETLVTEEPYALIAHVRVCGGAGWVTIGSTRNSSAIDVNR |
| Ga0307473_102990311 | 3300031820 | Hardwood Forest Soil | MRQSGAETLVTEEPYELIAHVRVCGGAGWVTTGSTRKRVC |
| Ga0318511_101251162 | 3300031845 | Soil | MRQSGAETLVTEEPYALIAHVRVCGGAGWVTIGSTRNRQAIRNTI |
| Ga0318544_100206704 | 3300031880 | Soil | MRQSGAETLVTEEPYALIAHVRVCGGAGWVTIGSTRKRLFGVMGA |
| Ga0318522_102649762 | 3300031894 | Soil | MRQSGAETLVTEEPYALIAHVRVCGGAGWVTIGSTRKKAK |
| Ga0306921_101658601 | 3300031912 | Soil | MRQSGAETLVTEEPYALIAHVRVCGGAGWVTIGSTRKPT |
| Ga0310916_101130941 | 3300031942 | Soil | MRQSGAETLVTEEPYALIAHVRVCGGAGWVTIGSTWKPTASS |
| Ga0310913_100785984 | 3300031945 | Soil | MRQSGAETLVTEEPYALIAHVRVCGGAGWVTIGSTRKPTASSVRS |
| Ga0310910_105652281 | 3300031946 | Soil | MRQSCVDALATEEPDALIAHVRVCGGAGRVTVGSTRKRVI |
| Ga0310909_100877694 | 3300031947 | Soil | MRQSGAETLVTEEPYALIAHVRVCGGAGWVTIGSTRKPTP |
| Ga0306926_101720301 | 3300031954 | Soil | MRQSGAETLVTEEPYALIAHVRVCGGAGWVTIGSTRNSSAIEVNRR |
| Ga0306926_104959552 | 3300031954 | Soil | MRQSCADALAPEEPDAFIAHVRVCGGAGRVTVGSTRKRVIRDI |
| Ga0326597_104421453 | 3300031965 | Soil | MRQSRAETLVTEEPYEFIAHVRICGGAGRVTAGPTRKPT |
| Ga0306922_116032611 | 3300032001 | Soil | MQGSKVMHQSRAGTLAPAEPDAFIAHVRGCGGAGWVTTGSTR |
| Ga0310906_105994441 | 3300032013 | Soil | MQGSTVMRQSRADTLVTEEPDALIAHVRVCGGAGWVTTGSTRK |
| Ga0318549_105842261 | 3300032041 | Soil | MRQSGAETLVTEEPYALIAHVRVCGGAGWVTIGSTRKTVSWEEVQ |
| Ga0318545_100299692 | 3300032042 | Soil | MRQSGAETLVTEEPYALIAHVRVCGGAGWVTIGSTRKPTASSVR |
| Ga0307471_1037441602 | 3300032180 | Hardwood Forest Soil | MRQSCADTLATEEPDELIAHVRVCGGAGWVTIGSTRKPT |
| Ga0307471_1037483952 | 3300032180 | Hardwood Forest Soil | MQGSKVMHQSHAGTLAPEEPDEFIAHVRVCGGAGWVTTGSTRKPTPYS |
| Ga0316194_109848412 | 3300032262 | Sediment | VAILVTEEPDDRIGHVRICGGDGSAMAVSTRTWPTTS |
| Ga0310914_104622061 | 3300033289 | Soil | MQGSKVMHQSRAGTLTPEEPDELIAHVRVCGGAGWVTTGS |
| Ga0247830_107531571 | 3300033551 | Soil | MRQSCADALATEEPDALIAHVRVCRGAGRVTVGST |
| ⦗Top⦘ |