| Basic Information | |
|---|---|
| Family ID | F028084 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 192 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MKKLILILPLFLLISCSEPNLDSRELPTKYPETPTMGSADDVTKELYKK |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 192 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 17.19 % |
| % of genes near scaffold ends (potentially truncated) | 16.15 % |
| % of genes from short scaffolds (< 2000 bps) | 52.08 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.854 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (35.938 % of family members) |
| Environment Ontology (ENVO) | Unclassified (85.938 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (90.104 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 31.17% β-sheet: 0.00% Coil/Unstructured: 68.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 192 Family Scaffolds |
|---|---|---|
| PF16754 | Pesticin | 27.08 |
| PF13306 | LRR_5 | 4.69 |
| PF13385 | Laminin_G_3 | 4.17 |
| PF02732 | ERCC4 | 2.08 |
| PF02562 | PhoH | 1.56 |
| PF04542 | Sigma70_r2 | 1.56 |
| PF01391 | Collagen | 1.56 |
| PF08443 | RimK | 1.56 |
| PF04488 | Gly_transf_sug | 1.04 |
| PF00085 | Thioredoxin | 0.52 |
| PF13540 | RCC1_2 | 0.52 |
| PF10528 | GLEYA | 0.52 |
| PF13469 | Sulfotransfer_3 | 0.52 |
| PF13884 | Peptidase_S74 | 0.52 |
| PF16778 | Phage_tail_APC | 0.52 |
| PF03796 | DnaB_C | 0.52 |
| PF13224 | DUF4032 | 0.52 |
| PF00535 | Glycos_transf_2 | 0.52 |
| PF13489 | Methyltransf_23 | 0.52 |
| PF05100 | Phage_tail_L | 0.52 |
| PF14464 | Prok-JAB | 0.52 |
| PF02511 | Thy1 | 0.52 |
| PF08843 | AbiEii | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 192 Family Scaffolds |
|---|---|---|---|
| COG1948 | ERCC4-type crossover junction endonuclease | Replication, recombination and repair [L] | 2.08 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.56 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.56 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.56 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 1.56 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 1.56 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.56 |
| COG3774 | Mannosyltransferase OCH1 or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 1.04 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.52 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.52 |
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.52 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.52 |
| COG4672 | Phage tail protein | Mobilome: prophages, transposons [X] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.38 % |
| Unclassified | root | N/A | 40.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000736|JGI12547J11936_1010069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2470 | Open in IMG/M |
| 3300000736|JGI12547J11936_1017564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1754 | Open in IMG/M |
| 3300000736|JGI12547J11936_1027218 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300002835|B570J40625_100002742 | Not Available | 32960 | Open in IMG/M |
| 3300003277|JGI25908J49247_10079930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 807 | Open in IMG/M |
| 3300003490|JGI25926J51410_1064647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 613 | Open in IMG/M |
| 3300003491|JGI25924J51412_1000253 | Not Available | 8022 | Open in IMG/M |
| 3300004125|Ga0066182_10002974 | Not Available | 2902 | Open in IMG/M |
| 3300004790|Ga0007758_11193297 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 528 | Open in IMG/M |
| 3300005580|Ga0049083_10001038 | All Organisms → cellular organisms → Bacteria | 10401 | Open in IMG/M |
| 3300005582|Ga0049080_10138395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 819 | Open in IMG/M |
| 3300005583|Ga0049085_10053834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1444 | Open in IMG/M |
| 3300005583|Ga0049085_10122180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 889 | Open in IMG/M |
| 3300005583|Ga0049085_10129099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 861 | Open in IMG/M |
| 3300007735|Ga0104988_10800 | Not Available | 30263 | Open in IMG/M |
| 3300007735|Ga0104988_10969 | Not Available | 51044 | Open in IMG/M |
| 3300007960|Ga0099850_1054743 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300008072|Ga0110929_1154749 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300008258|Ga0114840_1041881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 733 | Open in IMG/M |
| 3300008953|Ga0104241_1000220 | Not Available | 4699 | Open in IMG/M |
| 3300008962|Ga0104242_1022223 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300008962|Ga0104242_1057245 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300008962|Ga0104242_1083363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales | 531 | Open in IMG/M |
| 3300009068|Ga0114973_10000219 | Not Available | 41460 | Open in IMG/M |
| 3300009068|Ga0114973_10000240 | Not Available | 39915 | Open in IMG/M |
| 3300009068|Ga0114973_10047796 | All Organisms → cellular organisms → Bacteria | 2533 | Open in IMG/M |
| 3300009068|Ga0114973_10215114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1046 | Open in IMG/M |
| 3300009151|Ga0114962_10372658 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300009151|Ga0114962_10615492 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300009152|Ga0114980_10000097 | Not Available | 56583 | Open in IMG/M |
| 3300009152|Ga0114980_10015841 | All Organisms → cellular organisms → Bacteria | 4753 | Open in IMG/M |
| 3300009154|Ga0114963_10000473 | Not Available | 26652 | Open in IMG/M |
| 3300009154|Ga0114963_10162157 | Not Available | 1319 | Open in IMG/M |
| 3300009154|Ga0114963_10388653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 759 | Open in IMG/M |
| 3300009155|Ga0114968_10000455 | Not Available | 30576 | Open in IMG/M |
| 3300009155|Ga0114968_10006414 | Not Available | 8665 | Open in IMG/M |
| 3300009155|Ga0114968_10118023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1604 | Open in IMG/M |
| 3300009155|Ga0114968_10544964 | Not Available | 619 | Open in IMG/M |
| 3300009159|Ga0114978_10006427 | Not Available | 9324 | Open in IMG/M |
| 3300009159|Ga0114978_10474296 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 738 | Open in IMG/M |
| 3300009161|Ga0114966_10280006 | Not Available | 1017 | Open in IMG/M |
| 3300009161|Ga0114966_10285463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1004 | Open in IMG/M |
| 3300009180|Ga0114979_10013031 | Not Available | 5374 | Open in IMG/M |
| 3300009180|Ga0114979_10040416 | Not Available | 2942 | Open in IMG/M |
| 3300009180|Ga0114979_10208866 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300009182|Ga0114959_10369211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 706 | Open in IMG/M |
| 3300009184|Ga0114976_10319530 | Not Available | 827 | Open in IMG/M |
| 3300009184|Ga0114976_10422896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 695 | Open in IMG/M |
| 3300009684|Ga0114958_10017220 | Not Available | 4269 | Open in IMG/M |
| 3300010158|Ga0114960_10480254 | Not Available | 599 | Open in IMG/M |
| 3300010318|Ga0136656_1097254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1034 | Open in IMG/M |
| 3300010318|Ga0136656_1317398 | Not Available | 504 | Open in IMG/M |
| 3300010334|Ga0136644_10013157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 5709 | Open in IMG/M |
| 3300010334|Ga0136644_10512061 | Not Available | 668 | Open in IMG/M |
| 3300010354|Ga0129333_10221052 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
| 3300010885|Ga0133913_11199583 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1946 | Open in IMG/M |
| 3300010885|Ga0133913_12552914 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1242 | Open in IMG/M |
| 3300010885|Ga0133913_13530619 | Not Available | 1018 | Open in IMG/M |
| 3300011011|Ga0139556_1044640 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300011995|Ga0153800_1025939 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300012000|Ga0119951_1073488 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300013006|Ga0164294_10000854 | Not Available | 28978 | Open in IMG/M |
| 3300013006|Ga0164294_10001006 | Not Available | 26616 | Open in IMG/M |
| 3300013006|Ga0164294_10001641 | Not Available | 20613 | Open in IMG/M |
| 3300013006|Ga0164294_10004779 | Not Available | 11733 | Open in IMG/M |
| 3300013006|Ga0164294_10028512 | Not Available | 4489 | Open in IMG/M |
| 3300013014|Ga0164295_11578401 | Not Available | 509 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10006111 | All Organisms → cellular organisms → Bacteria | 14294 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10074145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2521 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10229763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1176 | Open in IMG/M |
| (restricted) 3300013130|Ga0172363_10487856 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10000307 | Not Available | 79230 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10053977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3424 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10511133 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10036895 | Not Available | 5042 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10355947 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| (restricted) 3300013133|Ga0172362_11108311 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10170490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1733 | Open in IMG/M |
| 3300013372|Ga0177922_10927582 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2345 | Open in IMG/M |
| 3300013372|Ga0177922_11236574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 596 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10119597 | Not Available | 1824 | Open in IMG/M |
| 3300014819|Ga0119954_1020934 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1314 | Open in IMG/M |
| 3300014819|Ga0119954_1029810 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1027 | Open in IMG/M |
| 3300017701|Ga0181364_1046096 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300017722|Ga0181347_1202019 | Not Available | 522 | Open in IMG/M |
| 3300017723|Ga0181362_1000743 | All Organisms → cellular organisms → Bacteria | 6653 | Open in IMG/M |
| 3300017736|Ga0181365_1064717 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 905 | Open in IMG/M |
| 3300017761|Ga0181356_1004180 | Not Available | 5901 | Open in IMG/M |
| 3300017761|Ga0181356_1114872 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 864 | Open in IMG/M |
| 3300017774|Ga0181358_1175941 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300017777|Ga0181357_1244309 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300017788|Ga0169931_10526157 | Not Available | 825 | Open in IMG/M |
| 3300018868|Ga0187844_10262384 | Not Available | 727 | Open in IMG/M |
| 3300019784|Ga0181359_1000332 | Not Available | 10147 | Open in IMG/M |
| 3300019784|Ga0181359_1002536 | All Organisms → cellular organisms → Bacteria | 5331 | Open in IMG/M |
| 3300019784|Ga0181359_1005296 | All Organisms → cellular organisms → Bacteria | 4191 | Open in IMG/M |
| 3300019784|Ga0181359_1013951 | All Organisms → cellular organisms → Bacteria | 2939 | Open in IMG/M |
| 3300019784|Ga0181359_1014139 | All Organisms → cellular organisms → Bacteria | 2923 | Open in IMG/M |
| 3300019784|Ga0181359_1020750 | All Organisms → cellular organisms → Bacteria | 2487 | Open in IMG/M |
| 3300019784|Ga0181359_1022298 | All Organisms → cellular organisms → Bacteria | 2406 | Open in IMG/M |
| 3300019784|Ga0181359_1028263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2157 | Open in IMG/M |
| 3300019784|Ga0181359_1044240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1724 | Open in IMG/M |
| 3300019784|Ga0181359_1096597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1088 | Open in IMG/M |
| 3300020141|Ga0211732_1052582 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300020179|Ga0194134_10063571 | All Organisms → cellular organisms → Bacteria | 1958 | Open in IMG/M |
| 3300020183|Ga0194115_10004253 | Not Available | 15572 | Open in IMG/M |
| 3300020183|Ga0194115_10027110 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 4188 | Open in IMG/M |
| 3300020196|Ga0194124_10022204 | All Organisms → cellular organisms → Bacteria | 4465 | Open in IMG/M |
| 3300020498|Ga0208050_1018180 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300022190|Ga0181354_1002488 | All Organisms → cellular organisms → Bacteria | 4355 | Open in IMG/M |
| 3300022190|Ga0181354_1245323 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300022752|Ga0214917_10000098 | Not Available | 95984 | Open in IMG/M |
| 3300022752|Ga0214917_10000638 | Not Available | 45532 | Open in IMG/M |
| 3300022752|Ga0214917_10000952 | Not Available | 37889 | Open in IMG/M |
| 3300022752|Ga0214917_10002004 | Not Available | 25416 | Open in IMG/M |
| 3300022752|Ga0214917_10004813 | Not Available | 14788 | Open in IMG/M |
| 3300022752|Ga0214917_10006246 | Not Available | 12440 | Open in IMG/M |
| 3300022752|Ga0214917_10007031 | Not Available | 11501 | Open in IMG/M |
| 3300022752|Ga0214917_10168132 | Not Available | 1130 | Open in IMG/M |
| 3300022752|Ga0214917_10185497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1046 | Open in IMG/M |
| 3300022752|Ga0214917_10200456 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 985 | Open in IMG/M |
| 3300022752|Ga0214917_10374208 | Not Available | 599 | Open in IMG/M |
| 3300023174|Ga0214921_10000280 | Not Available | 100571 | Open in IMG/M |
| 3300023174|Ga0214921_10000476 | All Organisms → cellular organisms → Bacteria | 74471 | Open in IMG/M |
| 3300023174|Ga0214921_10001634 | Not Available | 37678 | Open in IMG/M |
| 3300023174|Ga0214921_10003985 | Not Available | 22186 | Open in IMG/M |
| 3300023174|Ga0214921_10004343 | Not Available | 20908 | Open in IMG/M |
| 3300023174|Ga0214921_10009778 | Not Available | 12033 | Open in IMG/M |
| 3300023174|Ga0214921_10011575 | Not Available | 10694 | Open in IMG/M |
| 3300023174|Ga0214921_10016445 | Not Available | 8321 | Open in IMG/M |
| 3300023174|Ga0214921_10021342 | All Organisms → cellular organisms → Bacteria | 6881 | Open in IMG/M |
| 3300023174|Ga0214921_10080213 | Not Available | 2587 | Open in IMG/M |
| 3300023174|Ga0214921_10086756 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2434 | Open in IMG/M |
| 3300023174|Ga0214921_10092782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2312 | Open in IMG/M |
| 3300023174|Ga0214921_10114251 | Not Available | 1967 | Open in IMG/M |
| 3300023174|Ga0214921_10153648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1554 | Open in IMG/M |
| 3300023179|Ga0214923_10001440 | Not Available | 33787 | Open in IMG/M |
| 3300023179|Ga0214923_10003471 | Not Available | 19756 | Open in IMG/M |
| 3300023179|Ga0214923_10003752 | Not Available | 18833 | Open in IMG/M |
| 3300023179|Ga0214923_10013062 | All Organisms → cellular organisms → Bacteria | 8116 | Open in IMG/M |
| 3300023179|Ga0214923_10046325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3373 | Open in IMG/M |
| 3300023179|Ga0214923_10148926 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1467 | Open in IMG/M |
| 3300023179|Ga0214923_10207336 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1148 | Open in IMG/M |
| 3300023179|Ga0214923_10359211 | Not Available | 764 | Open in IMG/M |
| 3300027581|Ga0209651_1004373 | All Organisms → cellular organisms → Bacteria | 4876 | Open in IMG/M |
| 3300027608|Ga0208974_1039359 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1394 | Open in IMG/M |
| 3300027621|Ga0208951_1001615 | All Organisms → cellular organisms → Bacteria | 9733 | Open in IMG/M |
| 3300027627|Ga0208942_1111716 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300027712|Ga0209499_1000585 | Not Available | 26937 | Open in IMG/M |
| 3300027712|Ga0209499_1022711 | Not Available | 2880 | Open in IMG/M |
| 3300027720|Ga0209617_10000116 | Not Available | 30454 | Open in IMG/M |
| 3300027720|Ga0209617_10000701 | Not Available | 15165 | Open in IMG/M |
| 3300027720|Ga0209617_10000717 | Not Available | 15071 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1009098 | Not Available | 9766 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1021560 | All Organisms → cellular organisms → Bacteria | 4747 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1106995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1326 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1156599 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 975 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1020715 | Not Available | 4864 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1080940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1528 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1124408 | Not Available | 1084 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1166874 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 862 | Open in IMG/M |
| 3300027732|Ga0209442_1156802 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 873 | Open in IMG/M |
| 3300027734|Ga0209087_1275218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 611 | Open in IMG/M |
| 3300027741|Ga0209085_1000564 | Not Available | 26741 | Open in IMG/M |
| 3300027747|Ga0209189_1044056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2200 | Open in IMG/M |
| 3300027754|Ga0209596_1001446 | All Organisms → cellular organisms → Bacteria | 20466 | Open in IMG/M |
| 3300027754|Ga0209596_1397646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 517 | Open in IMG/M |
| 3300027760|Ga0209598_10071669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1708 | Open in IMG/M |
| 3300027760|Ga0209598_10397621 | Not Available | 505 | Open in IMG/M |
| 3300027763|Ga0209088_10000011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 188747 | Open in IMG/M |
| 3300027763|Ga0209088_10041499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2270 | Open in IMG/M |
| 3300027963|Ga0209400_1110420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1261 | Open in IMG/M |
| 3300027971|Ga0209401_1001011 | Not Available | 18840 | Open in IMG/M |
| 3300027973|Ga0209298_10000048 | Not Available | 67188 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1060456 | Not Available | 1939 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1204171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 744 | Open in IMG/M |
| (restricted) 3300028581|Ga0247840_10210507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1084 | Open in IMG/M |
| 3300032092|Ga0315905_10008106 | All Organisms → cellular organisms → Bacteria | 10614 | Open in IMG/M |
| 3300032092|Ga0315905_10616120 | Not Available | 978 | Open in IMG/M |
| 3300032092|Ga0315905_11478173 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 535 | Open in IMG/M |
| 3300032093|Ga0315902_11034911 | Not Available | 612 | Open in IMG/M |
| 3300033233|Ga0334722_10991038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 592 | Open in IMG/M |
| 3300033978|Ga0334977_0220354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 945 | Open in IMG/M |
| 3300033980|Ga0334981_0415003 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300034019|Ga0334998_0368688 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300034066|Ga0335019_0532828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 697 | Open in IMG/M |
| 3300034073|Ga0310130_0007342 | All Organisms → cellular organisms → Bacteria | 4109 | Open in IMG/M |
| 3300034106|Ga0335036_0002436 | Not Available | 16187 | Open in IMG/M |
| 3300034106|Ga0335036_0059564 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2893 | Open in IMG/M |
| 3300034106|Ga0335036_0083329 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2377 | Open in IMG/M |
| 3300034106|Ga0335036_0261286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1167 | Open in IMG/M |
| 3300034106|Ga0335036_0281025 | Not Available | 1114 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 35.94% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 23.96% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 14.06% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.81% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.17% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 3.12% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.08% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.08% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.08% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.04% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.52% |
| Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.52% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.52% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300004125 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
| 3300004790 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008072 | Microbial Communities in Water bodies, Singapore - Site MA | Environmental | Open in IMG/M |
| 3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
| 3300008953 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4 | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
| 3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300018868 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12547J11936_10100692 | 3300000736 | Freshwater And Sediment | VKKYLLLLPLFLLVSCSEQNLDSRELPTKYPETPTMGSADDVSKELYKK* |
| JGI12547J11936_10175645 | 3300000736 | Freshwater And Sediment | VKKLILILPLFLLISCSEPNYESRELPTKYPETPTMGSADDVTKELYKK* |
| JGI12547J11936_10272183 | 3300000736 | Freshwater And Sediment | MKKLLLILPLFLLISCSEPNTNSRELPTKYPETPTMGSAEDVSKELYNK* |
| B570J40625_10000274241 | 3300002835 | Freshwater | VKKLILILPLLFLVSCSEPNFDSRELPTKYPETPTMGSANDVSKELYKK* |
| JGI25908J49247_100799302 | 3300003277 | Freshwater Lake | MKKLLLILPLFLLISCSESNYESRELPTKYPETPTMGSADDVSKELYKK* |
| JGI25926J51410_10646472 | 3300003490 | Freshwater Lake | MKKLILILPLVLLMSCSEPNFDSRELPTKYPETPTMGSADDVIKELYKK* |
| JGI25924J51412_10002538 | 3300003491 | Freshwater Lake | IISVIGIMKKLILILPLVLLMSCSEPNFDSRELPTKYPETPTMGSADDVIKELYKK* |
| Ga0066182_100029745 | 3300004125 | Freshwater Lake | MKKLLLILPLFLLISCSEPNLDSRELPTKYPETPTMGSANDVSRELYKK* |
| Ga0007758_111932972 | 3300004790 | Freshwater Lake | LVLLMSCSEPNFDSRELPTKYPETPTMGSADDVIKELYKK* |
| Ga0049083_100010389 | 3300005580 | Freshwater Lentic | MRKLLLILPLFLLISCSEPNLDSRELPTKYPEIPTMGSADDVSKELYKR* |
| Ga0049080_101383952 | 3300005582 | Freshwater Lentic | VKKLILILPLLLIGCSEPNTDSRELPTKYPETPTMGSADDVTKELYKK* |
| Ga0049085_100538343 | 3300005583 | Freshwater Lentic | MRKLLLILPLFLLISCSEQNTDSRELPTKYPETPTMGSADDVSKELYKK* |
| Ga0049085_101221801 | 3300005583 | Freshwater Lentic | MRKLLLILPLFLLISCSEPNLDSRELPTKYPETPTMGSADDVSKELY |
| Ga0049085_101290992 | 3300005583 | Freshwater Lentic | MKKLLLILPLFLLISCSEPNLDTRELPTKYPETPTMGSADDASKELYKK* |
| Ga0104988_1080028 | 3300007735 | Freshwater | VKKLILILPLLLIGCSEPNIDSRELPTKYPETPTMGSADDVTKELYKK* |
| Ga0104988_1096978 | 3300007735 | Freshwater | MVKYIVLSLLFILTSCSDSSYQSRELPTKYPDTATMGSAADATEELKKK* |
| Ga0099850_10547431 | 3300007960 | Aqueous | MKLLIILPLFLLISCSDNNYESRELPTKYPDTATHGSAYDISEELNKN |
| Ga0110929_11547492 | 3300008072 | Water Bodies | MRILFLSLFLLAGCSDNNYNSRELPTKYPESATMGSAEDATRGTLEP* |
| Ga0114840_10418812 | 3300008258 | Freshwater, Plankton | MKKLILIFPLFLLISCSEPNLDSRELPTKYPETPTMGSADDVSKELYKK* |
| Ga0104241_10002205 | 3300008953 | Freshwater | MKKLILILPLFLLISCSEPNLDSRELPTKYPETPTMGSADDVTKELYNK* |
| Ga0104242_10222232 | 3300008962 | Freshwater | MKKLILILPLLLLISCSEPNLDSRELPTKYPETPTMGSADDATKELYKK* |
| Ga0104242_10572451 | 3300008962 | Freshwater | MRLILILPLFLLVSCSEPNYESRELPTKYPDTPTSGSAYDVTEELNKK* |
| Ga0104242_10833631 | 3300008962 | Freshwater | MNKLVLILPLFLLIGCSEPDYSSRELPTKYPETPTSGAAYDATEELYNK* |
| Ga0114973_1000021922 | 3300009068 | Freshwater Lake | MRKLVLILPLLFLVSCSEPNLESNELPTKYPETPTSGSAYNATEALYGNKK* |
| Ga0114973_1000024039 | 3300009068 | Freshwater Lake | MRKLILILILPLFLLISCSEPNLDSRELPTKYPETPTMGSADDVTKELYKK* |
| Ga0114973_100477964 | 3300009068 | Freshwater Lake | MKKLILIFPLFLLISCSEPNLDSRELPTKYPETPTMGSADDVTKELYKK* |
| Ga0114973_102151142 | 3300009068 | Freshwater Lake | MKKLILILILPLFLFISCSESNYESRELPTKYPETPTMGSADDVSKELYKK* |
| Ga0114962_103726581 | 3300009151 | Freshwater Lake | MKKLLLILPLFLLISCSEPNLDSRELPTKYPETPTMGSADDVTKELYKK* |
| Ga0114962_106154922 | 3300009151 | Freshwater Lake | MKKLLLVLPLFLLISCSEQNLDSRELPTKYPETPTMGSADDVSKELYKK* |
| Ga0114980_1000009732 | 3300009152 | Freshwater Lake | MKKLILILPLFLLISCSEPNYESRELPTKYPETPTMGSADDVTKELYKK* |
| Ga0114980_100158413 | 3300009152 | Freshwater Lake | VKKLILILPIFLLISCSEPNLDSRELPTKYPETPTMGSADDVTKELYKK* |
| Ga0114963_1000047312 | 3300009154 | Freshwater Lake | VKKLLLIFPLFLLISCSEPNLDSRELPTKYPETPTMGSADDVSKELYKK* |
| Ga0114963_101621572 | 3300009154 | Freshwater Lake | MKKLILILPLLFLISCSEPNYESRELSTKYPETPTSGSAYDVTEELYGKKK* |
| Ga0114963_103886532 | 3300009154 | Freshwater Lake | MKKLVLILPLLLILNGCSEQNYESRELPTKYPETPTMGSADDVTKELYKK* |
| Ga0114968_1000045524 | 3300009155 | Freshwater Lake | MKKLLLILPLFLLISCSEPNLDSRELPTKYPETPTMGSADDISKELYKK* |
| Ga0114968_100064148 | 3300009155 | Freshwater Lake | MRKLILILPLFLLISCSEPNFDSRELPTKYPETPTMGSADDVSKELYKK* |
| Ga0114968_101180232 | 3300009155 | Freshwater Lake | MKKLILIFPVFLLISCSEPNLDSRELPTKYPETPTMGSADDVTKELYKK* |
| Ga0114968_105449641 | 3300009155 | Freshwater Lake | MKKLLLILPLFLLISCSEPNLDSRELPTKYPETPTMGSADDITKELYKK* |
| Ga0114978_100064276 | 3300009159 | Freshwater Lake | MKKLILILPLFLLISCSEQNIDSRELPTKYPETPTMGSADDVSKELYKK* |
| Ga0114978_104742962 | 3300009159 | Freshwater Lake | MKKLILILPLFLLISCSEPTYESRELPTKYPETPTMGSADDVTKELYKK* |
| Ga0114966_102800062 | 3300009161 | Freshwater Lake | MKKLILILPLFLLISCSEPNLDSRELPTKYPETPTMGSADDVTKELYKK* |
| Ga0114966_102854632 | 3300009161 | Freshwater Lake | MRKLLLILPLFLLISCSEPNLDSRELPTKYPETPTMGSADDVSKELYKK* |
| Ga0114979_100130312 | 3300009180 | Freshwater Lake | MKKLILILPLLLIGCSEPNFDSRELPTKYPETPTMGSADDITKELYKK* |
| Ga0114979_100404162 | 3300009180 | Freshwater Lake | MKKLLLILPLFLLISCSEQNFESRELPTKYPETPTMGNADDATKGTLNP* |
| Ga0114979_102088662 | 3300009180 | Freshwater Lake | MKKLVLILPLLLILNGCSEQSYESRELPTKYPETPTMGSADDVTKELYKK* |
| Ga0114959_103692112 | 3300009182 | Freshwater Lake | MKKLLLVLPLFLLISCSEQNLDSRELPTKYPETPTMGSADDVSKELY |
| Ga0114976_103195302 | 3300009184 | Freshwater Lake | VKKLILILPLILLISCSEPNYESRELPTKYPETPTMGSADDVTKELYKK* |
| Ga0114976_104228962 | 3300009184 | Freshwater Lake | MKKLILILPLFLLISCSEPTYESRELPTKYPETPTMGSADDVSKELYKK* |
| Ga0114958_100172206 | 3300009684 | Freshwater Lake | PLFLLISCSEPNLDSRELPTKYPETPTMGSADDVSKELQKK* |
| Ga0114960_104802541 | 3300010158 | Freshwater Lake | IFPLFLLISCSEPNLDSRELPTKYPETPTMGSADDVSKELYKK* |
| Ga0136656_10972543 | 3300010318 | Freshwater To Marine Saline Gradient | VKRLILILPLFLLISCSEPNYESRELPTKYPDTPTSGSAYDATKELYGDK* |
| Ga0136656_13173982 | 3300010318 | Freshwater To Marine Saline Gradient | MRLILILSLILLAGCTENKYQSRELPTKYPETPTSSAAYDITEELYKK* |
| Ga0136644_100131573 | 3300010334 | Freshwater Lake | MKKLLLILPLLFILNGCSEPNLESKELPTKYPETPTMGSADDVTKELYKK* |
| Ga0136644_105120612 | 3300010334 | Freshwater Lake | MKKLLLILPLFLLISCSEPNLDSRELPTKYPETPTMGSADDVSKELQKK* |
| Ga0129333_102210523 | 3300010354 | Freshwater To Marine Saline Gradient | MKLLIILPLFLLISCSEPNYESRELPTKYPDTPTSGSAHDITEELYKSNLN |
| Ga0133913_111995831 | 3300010885 | Freshwater Lake | RILKSVIVIMKKLILIFPLFLLISCSEPNLDSRELPTKYPETPTMGSADDVTKELYKK* |
| Ga0133913_125529142 | 3300010885 | Freshwater Lake | MKKLLLILPLFLLVSCSEPNYESRELPTKYPETPTMGSADDVTKELYKK* |
| Ga0133913_135306192 | 3300010885 | Freshwater Lake | MKKLILILPLLFLISCSEPNYESRELSTKYPETPTSGSAYDVTEELYGNKK* |
| Ga0139556_10446402 | 3300011011 | Freshwater | MRKLVLILPLLFLVSCSEPNLESDELPTKYPETPTSGSAYDATEALY |
| Ga0153800_10259391 | 3300011995 | Freshwater | MRKLLLILPLLLIGCSEPNFDSRELPTKYPETPTMGSADDVAKELYKK* |
| Ga0119951_10734882 | 3300012000 | Freshwater | MRKLVLLLPLLFLISCSEPNYESRELPTKYPDTPTSGAAYDATEELYKK* |
| Ga0164294_1000085410 | 3300013006 | Freshwater | MKKLLLILPLFLLISCSEPNLDSRELPTKYPETPTMGNAADAATGKLNP* |
| Ga0164294_1000100611 | 3300013006 | Freshwater | MKKFILFLPLLLLISCSEPNLDSRELPTKYPETPTMGSAEDVSKELYKK* |
| Ga0164294_100016413 | 3300013006 | Freshwater | MKKLVLILPLLLILNGCSEQSYESRELPTKYPEIPTMGSADDATKELYKK* |
| Ga0164294_1000477910 | 3300013006 | Freshwater | MNKLILILPLFLLISCSEQNLDSRELPTKYPETPTMGSADDVSKELYKK* |
| Ga0164294_100285122 | 3300013006 | Freshwater | MKKLILILPLFLLVSCSEPNYESRELPTKYPETPTMGSADDVSKELYKK* |
| Ga0164295_115784012 | 3300013014 | Freshwater | MKKLILILPLFLLISCSEPNYESRELPTKYPETPTMGSADDVSKELYKK* |
| (restricted) Ga0172367_1000611116 | 3300013126 | Freshwater | VKKFILLLPLFLLISCSESTYESRELPTKYSESATMGSAEDANRGTLEP* |
| (restricted) Ga0172367_100741452 | 3300013126 | Freshwater | VNKFILLLPLFLLVSCSESTYESRELPTKYPDTPTSGAAYDATEELYKK* |
| (restricted) Ga0172366_102297631 | 3300013128 | Sediment | MKKLILILPLFLLVSCSESNYESRELPTKYPDTPTSGAAYDVTEE |
| (restricted) Ga0172363_104878562 | 3300013130 | Sediment | VKKFILILPLFLLVSCSEPNYESRELPSKYPDTPTSGAAYDATEELYKK* |
| (restricted) Ga0172373_1000030779 | 3300013131 | Freshwater | VKKFILILPLFLLVSCSEPIYESRELPTKYSESATMGSAEDANRGTLEP* |
| (restricted) Ga0172373_100539773 | 3300013131 | Freshwater | VNKFILLLPLFLLVSCSEPNYESRELPSKYPETPTSGAAYDITEELYKK* |
| (restricted) Ga0172373_105111332 | 3300013131 | Freshwater | VNKFILLLPLFLLVSCSEPNYESRELPSKYPDTPTSGAAYDATEELYKK* |
| (restricted) Ga0172372_100368952 | 3300013132 | Freshwater | VKRLILILPLFLLISCSEPNYKSRELPTKYPDTPTSGAAHDVTEELYKNN* |
| (restricted) Ga0172372_103559471 | 3300013132 | Freshwater | IYFVKKLILILPLFLLVSCSEPNYESRELPSKYPDTPTSGAAYDVTEELYKK* |
| (restricted) Ga0172362_111083111 | 3300013133 | Sediment | MKKLILILPLFLLVSCSEPTYESRELPTKYPDTPTSGSAYDVTEKLYKK* |
| (restricted) Ga0172375_101704902 | 3300013137 | Freshwater | VKKFILILPLFLLVSCSEPIYESRELPTKDSESATMVSSEDTNRGTLEP* |
| Ga0177922_109275824 | 3300013372 | Freshwater | VIDFVKKYLLLLPLFLLVSCSEQNLDSRELPTKYPETPTMGSADDVSKELYKK* |
| Ga0177922_112365742 | 3300013372 | Freshwater | VKKIILILPLLLLISCSEPNFDSRELPTKYPETPTMGSADDVSKELYKK* |
| (restricted) Ga0172376_101195973 | 3300014720 | Freshwater | VKKFILILPLFLLISCSEPTYESRELPTKYPDTPTSGSAYDVTEELYKK* |
| Ga0119954_10209343 | 3300014819 | Freshwater | MKKLILILPFFLLISCSEPNNQSRELPTKYPDSATMGSAEDATKGYNP* |
| Ga0119954_10298101 | 3300014819 | Freshwater | AIMRRLILILPLFLLISCSEPNYESRELPTKYPDTPTSGSAYDATKELYGDK* |
| Ga0181364_10460962 | 3300017701 | Freshwater Lake | MKKLLLILPLFLLVSCSEPNYESRELPTKYPETPTMGSADDVSKELYKK |
| Ga0181347_12020192 | 3300017722 | Freshwater Lake | LISCSEPNLDSRELPTKYPETPTMGSADDVSKELYKK |
| Ga0181362_10007436 | 3300017723 | Freshwater Lake | MKKLLLILPLFLLISCSESNYESRELPTKYPETPTMGSADDVSKELYKKXI |
| Ga0181365_10647172 | 3300017736 | Freshwater Lake | MKKLILILPLFLLISCSEPNLDSRELPTKYPETPTMGSADDVSKELYKK |
| Ga0181356_10041808 | 3300017761 | Freshwater Lake | MRKLLLILPLLLIGCSEPNFDSRELPTKYPETPTMGSADDVAKELYKK |
| Ga0181356_11148721 | 3300017761 | Freshwater Lake | ILPLVLLMSCSEPNFDSRELPTKYPETPTMGSADDVIKELYKK |
| Ga0181358_11759412 | 3300017774 | Freshwater Lake | MKKLLLILPLFLLVSCSEPNYESRELPTKYPETPTMGSADDISKELYKK |
| Ga0181357_12443092 | 3300017777 | Freshwater Lake | MKKLLLILPLFLLISCSESNLDSRELPTKYPETPTMGSADDISKELYKK |
| Ga0169931_105261572 | 3300017788 | Freshwater | VNKFILLLPLFLLVSCSEPNYESRELPSKYPDTPTSGAAYDATEELYKK |
| Ga0187844_102623842 | 3300018868 | Freshwater | MNKLILILPLFLLISCSEQNTDTRELPTKYPETPTMGSADDITKELYKK |
| Ga0181359_10003324 | 3300019784 | Freshwater Lake | MKKLILILPLVLLMSCSEPNFDSRELPTKYPETPTMGSADDVIKELYKK |
| Ga0181359_10025364 | 3300019784 | Freshwater Lake | MRKLILILPLLLIGCSEPNFDSRELPTKYPETPTMGSADDASRELYNK |
| Ga0181359_10052963 | 3300019784 | Freshwater Lake | MRKLILILPLLLIGCSEPNFDSRELPTKYPETPTMGSANDVTKELYKK |
| Ga0181359_10139513 | 3300019784 | Freshwater Lake | MRKLLLILPLITLISCSEPNLDSRELPTKYPETPTMGSADDASRELYNK |
| Ga0181359_10141393 | 3300019784 | Freshwater Lake | MKKLILIFPLFLLISCSEPNLDSRELPTKYPETPTMGSADDVTKELYKK |
| Ga0181359_10207503 | 3300019784 | Freshwater Lake | MKKLILILPLFLLISCSEPNFDSRELPTKYPETPTMGSADDISKELYKK |
| Ga0181359_10222983 | 3300019784 | Freshwater Lake | MKKLILILPLFLLISCSEPNLDSRELPTKYPETPTMGSADDISKELYKK |
| Ga0181359_10282633 | 3300019784 | Freshwater Lake | MKKLVLILPLLLILNGCSEQSYESRELPTKYPETPTMGSADDVTKELYKK |
| Ga0181359_10442402 | 3300019784 | Freshwater Lake | MRKLLLILPLFLLISCSEPNLDSRELPTKYPETPTMGSADDVTKELYKK |
| Ga0181359_10965973 | 3300019784 | Freshwater Lake | MKKLLLILPLFLLISCSESNYESRELPTKYPETPTMGSADDVSKELYKK |
| Ga0211732_10525822 | 3300020141 | Freshwater | VKKYLLLLPLFLLASCSEPTYESRELPTKYPESATMGSADDVTKELYKKXILK |
| Ga0194134_100635712 | 3300020179 | Freshwater Lake | VKNLNSVIFFVKKLILILPLFLLVSCSEPTYESRELPSKYPDTPTSGAAHDVTEELYKK |
| Ga0194115_100042534 | 3300020183 | Freshwater Lake | VKKLILILPLFLLVSCSEPNYESRELPTKYSESATMGSAEDANRGTLEP |
| Ga0194115_100271103 | 3300020183 | Freshwater Lake | VKKLILVLPLFLLVSCSEPTYQSIELPSKYPDTPTSGAAYDVTEELYKK |
| Ga0194124_100222045 | 3300020196 | Freshwater Lake | VKKLILVLPLKLLVSCSEPTYQSIELPSKYPDTPTSGAAYDVTEELYKK |
| Ga0208050_10181802 | 3300020498 | Freshwater | VKKLILILPLLFLVSCSEPNFDSRELPTKYPETPTMGSANDVSKELYKK |
| Ga0181354_10024885 | 3300022190 | Freshwater Lake | MKKLLLILPLFLLISCSEPNLDSRELPTKYPETPTMGSANDVSRELYKK |
| Ga0181354_12453231 | 3300022190 | Freshwater Lake | MKKLLLILPLFLLISCSEPNLDSRELPTKYPETPTMGSADDVSKELYKK |
| Ga0214917_1000009886 | 3300022752 | Freshwater | MKKLILILPLFLLISCSETNNQSRELPTKYPDSATMGSAEDATKGYIP |
| Ga0214917_1000063845 | 3300022752 | Freshwater | MRLILILPLFLLVSCSEPNYESRELPTKYPDTPTSGSAYDVTEELNKK |
| Ga0214917_1000095220 | 3300022752 | Freshwater | MKKLVLILPLLFLVSCSEPNYNSRELPTKYPDTPTSGSAYDVTEELYGHKK |
| Ga0214917_1000200411 | 3300022752 | Freshwater | MKKLILIFPLFLLISCSEQNLDSRELPTKYPETPTMGSADDVTKELYKK |
| Ga0214917_1000481315 | 3300022752 | Freshwater | VKKLILILPLILLISCSEPNYESRELPTKYPETPTMGSADDVTKELYKK |
| Ga0214917_100062468 | 3300022752 | Freshwater | MKKLILILPLLLLISCSEPNLDSRELPTKYPETPTMGSADDATKELYKK |
| Ga0214917_1000703112 | 3300022752 | Freshwater | VKYILLILLFTLTSCSDISQDSRELPTKYPETATMGSAADITEELNKK |
| Ga0214917_101681322 | 3300022752 | Freshwater | MRLLLLILPVFLLVSCSEPNYESRELPTKYPDTATSGAAYDATEELYKK |
| Ga0214917_101854973 | 3300022752 | Freshwater | MKKLVLILPLLLILNGCSEQNYESRELPTKYPETPTMGSADDVTKELYKK |
| Ga0214917_102004562 | 3300022752 | Freshwater | MRYLLILFLFLLTSCSEPKYESRELPTKYPEAPTMGSADDVTKELYKK |
| Ga0214917_103742082 | 3300022752 | Freshwater | VKRLILILPLFLLISCSEPNYESRELPTKYPDTPTSGSAYDATKELYGDK |
| Ga0214921_1000028076 | 3300023174 | Freshwater | MKKLILILPLLFLISCSEPNYESRELSTKYPETPTSGSAYDVTEELYGKKK |
| Ga0214921_1000047674 | 3300023174 | Freshwater | MKKIILILPLFLLISCSEQNFESRELPTKYPETPTMGNADDATKGTLNP |
| Ga0214921_1000163411 | 3300023174 | Freshwater | MKKLILIFPLFLLISCSEPNLDSRELPTKYPETPTMGSADDASRELYNK |
| Ga0214921_1000398520 | 3300023174 | Freshwater | VRKLILILPLLLIGCSEPNLDSRELPTKYPETPTMGSVDDITKELYKK |
| Ga0214921_100043438 | 3300023174 | Freshwater | MKKLVLILPLLLILNACSEQSYESRELPTKYPETPTMGSADDVTKELYKK |
| Ga0214921_100097789 | 3300023174 | Freshwater | MKKLLLILPLFFLISCSEPNLDSRELPTKYPETPTMGSADDISKELYKKE |
| Ga0214921_1001157511 | 3300023174 | Freshwater | MKKLILVLPLFLLVSCSEHNPDSRELPTKYPETPTMGSADDITKELYKK |
| Ga0214921_100164452 | 3300023174 | Freshwater | MKKLILIFPLFLLISCSEPNLDSRELPTKYPETPTMGSADDVAKELYKK |
| Ga0214921_100213423 | 3300023174 | Freshwater | MRKLILILPLFLLISCSEPNFDSRELPTKYPETPTMGSADDVSKELYKK |
| Ga0214921_100802132 | 3300023174 | Freshwater | MKKLLLILPLFLLISCSEQNLDSRELPTKYPETPTMGSADDITKELYKK |
| Ga0214921_100867563 | 3300023174 | Freshwater | VFMKKLLLILPLFLLISCSEPNLDSRELPTKYPETPTMGSADDVSKELYKK |
| Ga0214921_100927821 | 3300023174 | Freshwater | MKKLLLILPLFLLISCSEPNLDSRELPTKYPETPTMGSADDITKELYKK |
| Ga0214921_101142512 | 3300023174 | Freshwater | VKKLLLVLPLFLLISCSEQNLDSRELPTKYPETPTMGSADDITKELYKK |
| Ga0214921_101536483 | 3300023174 | Freshwater | MKKLLLILPLFLLISCSEQNSDSRELPTKYPETPTMGSADDVSKELYKK |
| Ga0214923_100014406 | 3300023179 | Freshwater | MRLFLIFPLFLLVSCSESNYDSRELQTKYPDTPTSGAAYDITEELNKK |
| Ga0214923_1000347117 | 3300023179 | Freshwater | MKKLILILPFFLLISCSEPNNQSRELPTKYPDSATMGSAEDATKGYNP |
| Ga0214923_1000375212 | 3300023179 | Freshwater | MKKLILILPLLLLISCSEPNLDSRELPTKYSETPTMGSADDVTKELYKK |
| Ga0214923_100130624 | 3300023179 | Freshwater | MDKCNTFMRYILILFLFTLTSCSDNNYQSRELPTKYPDSATMGSADDVTQELYKK |
| Ga0214923_100463253 | 3300023179 | Freshwater | MRKLVLILPLFLLISCSEQKYDSRELPTKYSDSATMGSADDVTKELYKK |
| Ga0214923_101489262 | 3300023179 | Freshwater | MKKLILILPLILLISCSESKYESRELPTKYPDSATMGSADDATKELYKK |
| Ga0214923_102073362 | 3300023179 | Freshwater | MKKLILILPLFLLISCSEPNLDTRELPTKYPETPTMGSADDVTKELYKK |
| Ga0214923_103592112 | 3300023179 | Freshwater | MKIFLILALSFIFISCSEHKYESRELPTKYSDSATMGSADDITKELYKK |
| Ga0209651_10043736 | 3300027581 | Freshwater Lake | MKKLLLILPLFLLISCSEPNLDSRELPTKYPETPTMGSANDVSKELYKK |
| Ga0208974_10393593 | 3300027608 | Freshwater Lentic | SCSEPNYESRELPTKYPETPTMGSADDVTKELYKK |
| Ga0208951_10016157 | 3300027621 | Freshwater Lentic | MRKLLLILPLFLLISCSEPNLDSRELPTKYPEIPTMGSADDVSKELYKR |
| Ga0208942_11117162 | 3300027627 | Freshwater Lentic | MKKLLLILPLFLLISCSEPNLDTRELPTKYPETPTMGSADDASKELYKK |
| Ga0209499_100058529 | 3300027712 | Freshwater Lake | MKKLLLILPLFLLISCSEPNLDSRELPTKYPETPTMGSADDVTKELYKK |
| Ga0209499_10227114 | 3300027712 | Freshwater Lake | FMKKLLLILPLFLLISCSEPNLDSRELPTKYPETPTMGSADDVSKELQKK |
| Ga0209617_1000011636 | 3300027720 | Freshwater And Sediment | VKKLILILPLFLLISCSEPNYESRELPTKYPETPTMGSADDVTKELYKK |
| Ga0209617_1000070111 | 3300027720 | Freshwater And Sediment | MKKLLLILPLFLLISCSEPNTNSRELPTKYPETPTMGSAEDVSKELYNK |
| Ga0209617_1000071711 | 3300027720 | Freshwater And Sediment | VKKYLLLLPLFLLVSCSEQNLDSRELPTKYPETPTMGSADDVSKELYKK |
| (restricted) Ga0247836_10090982 | 3300027728 | Freshwater | MKKLILILPLFLLISCSEQNLDSRELPTKYPDTPTSGSAYDVTEELYKK |
| (restricted) Ga0247836_10215604 | 3300027728 | Freshwater | MRKLILILPLFLLISCSEPNLDSRELPTKYPETPTMGSADDVYKELYKK |
| (restricted) Ga0247836_11069951 | 3300027728 | Freshwater | MKKLILVLPFLLLISCSEPNYESRELPTKYPETPTMGSANDISKELYKKE |
| (restricted) Ga0247836_11565993 | 3300027728 | Freshwater | MKKLLLILPLFLLISCSEPNLDNRELPTKYPETPTMGNAADAATGKLNP |
| (restricted) Ga0247833_10207154 | 3300027730 | Freshwater | MKKLLLILPLFLLISCSEPNLDSRELPTKYPEIPTMGSADDVSKELYKK |
| (restricted) Ga0247833_10809402 | 3300027730 | Freshwater | VKKLVLIIPLLLILNGCSEQAYESRELPTKYPETATMGSADDVTKELYKK |
| (restricted) Ga0247833_11244083 | 3300027730 | Freshwater | LVSCSEQTYESRELPSKYPETATMGSADDVSKELYKK |
| (restricted) Ga0247833_11668742 | 3300027730 | Freshwater | VKKLILILPLLLISCSEPNTDSRELPTKYPETPTMGSADDVTKELYKK |
| Ga0209442_11568022 | 3300027732 | Freshwater Lake | MKKLLLILPLFLLISCSEPNLDSRELPTKYPETPTMGSADDISKELYKK |
| Ga0209087_12752181 | 3300027734 | Freshwater Lake | MKKLILILPLFLLISCSEPTYESRELPTKYPETPTMGSADDV |
| Ga0209085_100056412 | 3300027741 | Freshwater Lake | VKKLLLIFPLFLLISCSEPNLDSRELPTKYPETPTMGSADDVSKELYKK |
| Ga0209189_10440563 | 3300027747 | Freshwater Lake | MKKLLLILPLLFILNGCSEPNLESKELPTKYPETPTMGSADDVTKELYKK |
| Ga0209596_100144612 | 3300027754 | Freshwater Lake | MKKLLLILPLFLLISCSEPNLDSRELPTKYPETPTMGSADDISKELYKKXILK |
| Ga0209596_13976461 | 3300027754 | Freshwater Lake | MRKLVLILPLLFLVSCSEPNLESNELPTKYPETPTSGSAYNATEALYGN |
| Ga0209598_100716692 | 3300027760 | Freshwater Lake | VLILPLLFLVSCSEPNLESNELPTKYPETPTSGSAYNATEALYGNKK |
| Ga0209598_103976211 | 3300027760 | Freshwater Lake | FLLISCSEPNLDSRELPTKYPETPTMGSADDVTKELYKK |
| Ga0209088_10000011191 | 3300027763 | Freshwater Lake | MKKLILILPLFLLISCSEQNIDSRELPTKYPETPTMGSADDVSKELYKK |
| Ga0209088_100414993 | 3300027763 | Freshwater Lake | VKKLILILPIFLLISCSEPNLDSRELPTKYPETPTMGSADDVTKELYKK |
| Ga0209400_11104203 | 3300027963 | Freshwater Lake | MKKLILIFPVFLLISCSEPNLDSRELPTKYPETPTMGSADDVTKELYKK |
| Ga0209401_100101112 | 3300027971 | Freshwater Lake | MRKLILILILPLFLLISCSEPNLDSRELPTKYPETPTMGSADDVTKELYKK |
| Ga0209298_1000004842 | 3300027973 | Freshwater Lake | MKKLILILPLFLLISCSEPNYESRELPTKYPETPTMGSADDVTKELYKK |
| (restricted) Ga0247834_10604561 | 3300027977 | Freshwater | LPLFLLVSCSEQTYESRELPSKYPETATMGSADDVSKELYKK |
| (restricted) Ga0247834_12041711 | 3300027977 | Freshwater | MKKLLLILPLFLLISCSEPNLDNRELPTKYPETPT |
| (restricted) Ga0247840_102105071 | 3300028581 | Freshwater | MKKLLLILPLFLLISCSEPNLDNRELPTKYPETPTMGNA |
| Ga0315905_100081068 | 3300032092 | Freshwater | MKKLILIFPLFLLISCSEPNLDSRELPTKYPETPTMGSADDVSKELYKKXILK |
| Ga0315905_106161201 | 3300032092 | Freshwater | KLVLKLPLLLILNGCSEQSYESRELPTKYPETPNMGSADDVTKELYKK |
| Ga0315905_114781732 | 3300032092 | Freshwater | NRAIISVIGIMKKLILILPLVLLMSCSEPNFDSRELPTKYPETPTMGSADDVIKELYKK |
| Ga0315902_110349112 | 3300032093 | Freshwater | MVKYIVLSLLFILTSCSDSSYQSRELPTKYPDTATMGSAADATEELKKK |
| Ga0334722_109910382 | 3300033233 | Sediment | MRKLLLILPLFLLISCSEQNLDSRELPTKYPETPTM |
| Ga0334977_0220354_776_925 | 3300033978 | Freshwater | VKKLILILPLFLLISCSEPNLDSRELPTKYPETPTMGSAEDASRELYNK |
| Ga0334981_0415003_3_143 | 3300033980 | Freshwater | MKKLVLILPLFLLISCSEPNYESRELPTKYPDTPTSGSAYDVTKELY |
| Ga0334998_0368688_307_453 | 3300034019 | Freshwater | MRLLLILPVFLLVSCSEPNYESRELPTKYPDTPTSGAAYDATEELYKK |
| Ga0335019_0532828_3_131 | 3300034066 | Freshwater | MKKLILILPLFLLISCSEPNLDSRELPTKYPETPTMGSAEDAS |
| Ga0310130_0007342_2942_3091 | 3300034073 | Fracking Water | MRLFLILPLFLLVSCSEPNYESRELPTKYPDTPTSGAAYDATKELYGDK |
| Ga0335036_0002436_8386_8535 | 3300034106 | Freshwater | MKKLVLLLPLLFLISCSEPNYESRELPTKYPDTPTSGAAYDATEELYKK |
| Ga0335036_0059564_2011_2166 | 3300034106 | Freshwater | MINMRLILILSLILLAGCTENNYQSRELPTKYPDTPTSGAAYDATEELYKK |
| Ga0335036_0083329_143_292 | 3300034106 | Freshwater | MRKLVLLLPLLFLTSCSEPNYESRELPTKYPDAPTSGAAYDATEELYKK |
| Ga0335036_0261286_590_736 | 3300034106 | Freshwater | MRLLLVLPLFLLVSCSEPNYESRELPTKYPDTPTSGSAYDATEELYKK |
| Ga0335036_0281025_104_253 | 3300034106 | Freshwater | VKRLILILPLFLLIGCSESNYESRELPTKYPDTPTSGSAYDVTEELYKK |
| ⦗Top⦘ |