| Basic Information | |
|---|---|
| Family ID | F027974 |
| Family Type | Metagenome |
| Number of Sequences | 193 |
| Average Sequence Length | 46 residues |
| Representative Sequence | PAGTHPEYGDLVRLTGLTSTGRAITLVAQVDRLPLALVDIEADPA |
| Number of Associated Samples | 131 |
| Number of Associated Scaffolds | 193 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.06 % |
| % of genes near scaffold ends (potentially truncated) | 96.37 % |
| % of genes from short scaffolds (< 2000 bps) | 84.97 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.891 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (25.907 % of family members) |
| Environment Ontology (ENVO) | Unclassified (59.585 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.176 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 34.25% Coil/Unstructured: 65.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 193 Family Scaffolds |
|---|---|---|
| PF03401 | TctC | 0.52 |
| PF00092 | VWA | 0.52 |
| PF00005 | ABC_tran | 0.52 |
| PF08281 | Sigma70_r4_2 | 0.52 |
| PF14534 | DUF4440 | 0.52 |
| PF01471 | PG_binding_1 | 0.52 |
| PF03466 | LysR_substrate | 0.52 |
| PF00082 | Peptidase_S8 | 0.52 |
| PF15902 | Sortilin-Vps10 | 0.52 |
| PF16980 | CitMHS_2 | 0.52 |
| PF01713 | Smr | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 193 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.89 % |
| Unclassified | root | N/A | 3.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002561|JGI25384J37096_10182349 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300002562|JGI25382J37095_10190019 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 626 | Open in IMG/M |
| 3300002562|JGI25382J37095_10228501 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 561 | Open in IMG/M |
| 3300002909|JGI25388J43891_1043738 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 679 | Open in IMG/M |
| 3300002915|JGI25387J43893_1008228 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300005166|Ga0066674_10043866 | All Organisms → cellular organisms → Bacteria | 2004 | Open in IMG/M |
| 3300005172|Ga0066683_10223607 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300005172|Ga0066683_10558852 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300005179|Ga0066684_10152386 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
| 3300005184|Ga0066671_10927320 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 551 | Open in IMG/M |
| 3300005184|Ga0066671_10944681 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 544 | Open in IMG/M |
| 3300005186|Ga0066676_10271538 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1113 | Open in IMG/M |
| 3300005187|Ga0066675_10436886 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300005437|Ga0070710_10986307 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 613 | Open in IMG/M |
| 3300005447|Ga0066689_10967782 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 524 | Open in IMG/M |
| 3300005450|Ga0066682_10290756 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1054 | Open in IMG/M |
| 3300005451|Ga0066681_10503809 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300005468|Ga0070707_101476888 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 646 | Open in IMG/M |
| 3300005518|Ga0070699_100994263 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300005536|Ga0070697_100029391 | All Organisms → cellular organisms → Bacteria | 4406 | Open in IMG/M |
| 3300005536|Ga0070697_101185073 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 681 | Open in IMG/M |
| 3300005545|Ga0070695_100304353 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300005552|Ga0066701_10039403 | All Organisms → cellular organisms → Bacteria | 2525 | Open in IMG/M |
| 3300005552|Ga0066701_10186632 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300005552|Ga0066701_10833115 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 548 | Open in IMG/M |
| 3300005553|Ga0066695_10842248 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300005555|Ga0066692_10152130 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1421 | Open in IMG/M |
| 3300005555|Ga0066692_10233367 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300005556|Ga0066707_10852823 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300005558|Ga0066698_10359846 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300005561|Ga0066699_10119653 | All Organisms → cellular organisms → Bacteria | 1762 | Open in IMG/M |
| 3300005561|Ga0066699_10676786 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300005566|Ga0066693_10496941 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 504 | Open in IMG/M |
| 3300005569|Ga0066705_10453406 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 804 | Open in IMG/M |
| 3300005574|Ga0066694_10031856 | All Organisms → cellular organisms → Bacteria | 2361 | Open in IMG/M |
| 3300005574|Ga0066694_10127392 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300005574|Ga0066694_10209652 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300005598|Ga0066706_10096355 | All Organisms → cellular organisms → Bacteria | 2137 | Open in IMG/M |
| 3300005598|Ga0066706_11202656 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300006031|Ga0066651_10244037 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300006031|Ga0066651_10509395 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 637 | Open in IMG/M |
| 3300006032|Ga0066696_10389239 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 909 | Open in IMG/M |
| 3300006032|Ga0066696_10530780 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300006046|Ga0066652_101993714 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 517 | Open in IMG/M |
| 3300006173|Ga0070716_100023890 | All Organisms → cellular organisms → Bacteria | 3249 | Open in IMG/M |
| 3300006791|Ga0066653_10571052 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300006794|Ga0066658_10197181 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300006794|Ga0066658_10597268 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 601 | Open in IMG/M |
| 3300006797|Ga0066659_10383904 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300006806|Ga0079220_11003889 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 663 | Open in IMG/M |
| 3300006852|Ga0075433_10194220 | Not Available | 1806 | Open in IMG/M |
| 3300006903|Ga0075426_10240776 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300007004|Ga0079218_10615110 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 996 | Open in IMG/M |
| 3300007258|Ga0099793_10528902 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 587 | Open in IMG/M |
| 3300009012|Ga0066710_102041970 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300009012|Ga0066710_102553727 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 737 | Open in IMG/M |
| 3300009012|Ga0066710_104457462 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 523 | Open in IMG/M |
| 3300009012|Ga0066710_104756576 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 508 | Open in IMG/M |
| 3300009088|Ga0099830_10127746 | All Organisms → cellular organisms → Bacteria | 1931 | Open in IMG/M |
| 3300009137|Ga0066709_100721690 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300009137|Ga0066709_100964433 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1246 | Open in IMG/M |
| 3300009143|Ga0099792_10929822 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300010303|Ga0134082_10267492 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300010304|Ga0134088_10152883 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300010320|Ga0134109_10014817 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2313 | Open in IMG/M |
| 3300010320|Ga0134109_10021153 | All Organisms → cellular organisms → Bacteria | 1997 | Open in IMG/M |
| 3300010320|Ga0134109_10349288 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 581 | Open in IMG/M |
| 3300010320|Ga0134109_10388099 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 556 | Open in IMG/M |
| 3300010322|Ga0134084_10327723 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 577 | Open in IMG/M |
| 3300010323|Ga0134086_10186920 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300010323|Ga0134086_10279946 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 642 | Open in IMG/M |
| 3300010323|Ga0134086_10462930 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 519 | Open in IMG/M |
| 3300010323|Ga0134086_10485631 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 509 | Open in IMG/M |
| 3300010326|Ga0134065_10015093 | All Organisms → cellular organisms → Bacteria | 2109 | Open in IMG/M |
| 3300010329|Ga0134111_10382096 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 600 | Open in IMG/M |
| 3300010329|Ga0134111_10556143 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 509 | Open in IMG/M |
| 3300010333|Ga0134080_10278068 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300010336|Ga0134071_10381021 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300010336|Ga0134071_10529298 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 611 | Open in IMG/M |
| 3300011271|Ga0137393_10356636 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1250 | Open in IMG/M |
| 3300012039|Ga0137421_1026491 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
| 3300012096|Ga0137389_10729393 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 851 | Open in IMG/M |
| 3300012199|Ga0137383_11174667 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 553 | Open in IMG/M |
| 3300012201|Ga0137365_10451731 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300012205|Ga0137362_10379731 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300012206|Ga0137380_11236834 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300012207|Ga0137381_11582485 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 546 | Open in IMG/M |
| 3300012209|Ga0137379_10423886 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300012209|Ga0137379_10947114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 766 | Open in IMG/M |
| 3300012211|Ga0137377_10052606 | All Organisms → cellular organisms → Bacteria | 3769 | Open in IMG/M |
| 3300012211|Ga0137377_10567869 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1072 | Open in IMG/M |
| 3300012211|Ga0137377_10988381 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 772 | Open in IMG/M |
| 3300012285|Ga0137370_10289141 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300012349|Ga0137387_10222580 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300012351|Ga0137386_10407686 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 979 | Open in IMG/M |
| 3300012351|Ga0137386_10499340 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300012355|Ga0137369_10170013 | All Organisms → cellular organisms → Bacteria | 1713 | Open in IMG/M |
| 3300012355|Ga0137369_10333154 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1114 | Open in IMG/M |
| 3300012356|Ga0137371_11276652 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 544 | Open in IMG/M |
| 3300012357|Ga0137384_11548048 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 513 | Open in IMG/M |
| 3300012359|Ga0137385_10540530 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 983 | Open in IMG/M |
| 3300012359|Ga0137385_11274928 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300012359|Ga0137385_11675626 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300012362|Ga0137361_10452559 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1179 | Open in IMG/M |
| 3300012362|Ga0137361_10615083 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 995 | Open in IMG/M |
| 3300012362|Ga0137361_11788857 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 533 | Open in IMG/M |
| 3300012363|Ga0137390_11829715 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300012685|Ga0137397_11326008 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 510 | Open in IMG/M |
| 3300012685|Ga0137397_11331280 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 509 | Open in IMG/M |
| 3300012917|Ga0137395_10316722 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1107 | Open in IMG/M |
| 3300012917|Ga0137395_10573719 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 814 | Open in IMG/M |
| 3300012918|Ga0137396_10466458 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300012923|Ga0137359_11181264 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 653 | Open in IMG/M |
| 3300012925|Ga0137419_10676404 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 835 | Open in IMG/M |
| 3300012925|Ga0137419_11703404 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300012927|Ga0137416_10741306 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 865 | Open in IMG/M |
| 3300012929|Ga0137404_11444601 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300012944|Ga0137410_10389415 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1121 | Open in IMG/M |
| 3300012944|Ga0137410_11020227 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 705 | Open in IMG/M |
| 3300012972|Ga0134077_10105410 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1095 | Open in IMG/M |
| 3300012972|Ga0134077_10190616 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 832 | Open in IMG/M |
| 3300012972|Ga0134077_10563240 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012976|Ga0134076_10134108 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300012976|Ga0134076_10200821 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 836 | Open in IMG/M |
| 3300012977|Ga0134087_10433921 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 647 | Open in IMG/M |
| 3300012977|Ga0134087_10463937 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300014150|Ga0134081_10011494 | All Organisms → cellular organisms → Bacteria | 2381 | Open in IMG/M |
| 3300014154|Ga0134075_10091869 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300014157|Ga0134078_10013192 | All Organisms → cellular organisms → Bacteria | 2472 | Open in IMG/M |
| 3300014157|Ga0134078_10273638 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 717 | Open in IMG/M |
| 3300014870|Ga0180080_1101239 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300015357|Ga0134072_10089507 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300015358|Ga0134089_10452508 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 556 | Open in IMG/M |
| 3300015372|Ga0132256_103060930 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 562 | Open in IMG/M |
| 3300017654|Ga0134069_1072913 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1099 | Open in IMG/M |
| 3300017654|Ga0134069_1126007 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 846 | Open in IMG/M |
| 3300017656|Ga0134112_10179619 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300017657|Ga0134074_1102978 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300017657|Ga0134074_1273758 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 611 | Open in IMG/M |
| 3300017659|Ga0134083_10108373 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300017659|Ga0134083_10323852 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300018028|Ga0184608_10383428 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 613 | Open in IMG/M |
| 3300018056|Ga0184623_10000686 | All Organisms → cellular organisms → Bacteria | 14461 | Open in IMG/M |
| 3300018056|Ga0184623_10123028 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1200 | Open in IMG/M |
| 3300018071|Ga0184618_10267104 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 725 | Open in IMG/M |
| 3300018076|Ga0184609_10023169 | All Organisms → cellular organisms → Bacteria | 2484 | Open in IMG/M |
| 3300018431|Ga0066655_10361975 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 954 | Open in IMG/M |
| 3300018431|Ga0066655_10994153 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 579 | Open in IMG/M |
| 3300018431|Ga0066655_11009559 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 575 | Open in IMG/M |
| 3300018433|Ga0066667_10991757 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 724 | Open in IMG/M |
| 3300018433|Ga0066667_11651964 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 573 | Open in IMG/M |
| 3300018433|Ga0066667_11762171 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 558 | Open in IMG/M |
| 3300018482|Ga0066669_10880612 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300020004|Ga0193755_1011451 | All Organisms → cellular organisms → Bacteria | 2900 | Open in IMG/M |
| 3300021073|Ga0210378_10009254 | All Organisms → cellular organisms → Bacteria | 4227 | Open in IMG/M |
| 3300024284|Ga0247671_1000083 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 31656 | Open in IMG/M |
| 3300024325|Ga0247678_1044840 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 709 | Open in IMG/M |
| 3300025922|Ga0207646_11855784 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300026297|Ga0209237_1156988 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 863 | Open in IMG/M |
| 3300026297|Ga0209237_1289577 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 503 | Open in IMG/M |
| 3300026298|Ga0209236_1206976 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 725 | Open in IMG/M |
| 3300026301|Ga0209238_1001113 | All Organisms → cellular organisms → Bacteria | 10242 | Open in IMG/M |
| 3300026301|Ga0209238_1143106 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 748 | Open in IMG/M |
| 3300026307|Ga0209469_1139352 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 544 | Open in IMG/M |
| 3300026310|Ga0209239_1118611 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300026310|Ga0209239_1119553 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300026310|Ga0209239_1153512 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300026310|Ga0209239_1165073 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300026310|Ga0209239_1370091 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 503 | Open in IMG/M |
| 3300026324|Ga0209470_1005214 | All Organisms → cellular organisms → Bacteria | 8544 | Open in IMG/M |
| 3300026328|Ga0209802_1134740 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1066 | Open in IMG/M |
| 3300026329|Ga0209375_1046878 | All Organisms → cellular organisms → Bacteria | 2183 | Open in IMG/M |
| 3300026329|Ga0209375_1182752 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 826 | Open in IMG/M |
| 3300026523|Ga0209808_1070801 | All Organisms → cellular organisms → Bacteria | 1525 | Open in IMG/M |
| 3300026524|Ga0209690_1297748 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300026536|Ga0209058_1063987 | All Organisms → cellular organisms → Bacteria | 2009 | Open in IMG/M |
| 3300026547|Ga0209156_10274415 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300026548|Ga0209161_10156093 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1313 | Open in IMG/M |
| 3300026548|Ga0209161_10423459 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300026557|Ga0179587_10342451 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 969 | Open in IMG/M |
| 3300027324|Ga0209845_1075608 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300027616|Ga0209106_1066057 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300027748|Ga0209689_1035891 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2899 | Open in IMG/M |
| 3300028536|Ga0137415_10080553 | All Organisms → cellular organisms → Bacteria | 3115 | Open in IMG/M |
| 3300031965|Ga0326597_10239264 | All Organisms → cellular organisms → Bacteria | 2101 | Open in IMG/M |
| 3300032180|Ga0307471_103681715 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300033407|Ga0214472_10178963 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2062 | Open in IMG/M |
| 3300033417|Ga0214471_10638483 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 841 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 25.91% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.32% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 19.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 14.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.15% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.07% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.04% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.04% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.04% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.04% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.52% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014870 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10D | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
| 3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25384J37096_101823492 | 3300002561 | Grasslands Soil | HPEYGELVRLTGLTSSGRAITLVAQVERLPLVVVDIEADA* |
| JGI25382J37095_101900192 | 3300002562 | Grasslands Soil | GGVGGITTQPAGSHPQYGELVRLAGLSSSGRTITLVAQVDRLPLVLVDIQADTA* |
| JGI25382J37095_102285012 | 3300002562 | Grasslands Soil | AGVTTQQPAGSHPEYGDLVRLTGLTSGGRAITLVAQVERLPLALVDIEVDAA* |
| JGI25388J43891_10437382 | 3300002909 | Grasslands Soil | QQPAGSHPEYGELVRLTGLTSSGRTITLVAQGDRLPLALVDIEADA* |
| JGI25387J43893_10082281 | 3300002915 | Grasslands Soil | PVGGATTPQPAGRHPEYGDLVRLTGLTSAGRAITLVARVDRLPLALVDIEADAA* |
| Ga0066674_100438661 | 3300005166 | Soil | GTHPEYGELVRLTGLTSAGRAVTLVARVDRLPLVLVDIEADR* |
| Ga0066683_102236072 | 3300005172 | Soil | GGVTTQQPAGSHPQYGDLVRLTGLTSSGRAITLVAQVDRLPLALVDIEVDAA* |
| Ga0066683_105588521 | 3300005172 | Soil | HPEYGDLVRLTGLTSTGRAITLVAQVDRLPLALVDIEADPK* |
| Ga0066684_101523862 | 3300005179 | Soil | AEYGELVKLTGLTSAGRAITLVAQVARLPLALVDIAVEAA* |
| Ga0066671_109273201 | 3300005184 | Soil | DVLTTRALPAGSHPEYGALVRLTGLTSSGRAITLVAQVERLPLALIDISVEAA* |
| Ga0066671_109446812 | 3300005184 | Soil | PAGRHPKYGDLVRLTGLTSAGRAITLVAQVERLPLALVDIEADA* |
| Ga0066676_102715381 | 3300005186 | Soil | VTTQPAGSHPQYGELVSLTGLSSSGRAITLVAQVDHLPLVLVDIQADTA* |
| Ga0066675_104368861 | 3300005187 | Soil | EPVGGVTTPPQPAGTHPEYGALVRLTGLTSTGRAIALVARVDRLPLVLVDIAVDAI* |
| Ga0070710_109863071 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | AGTHPQYGELVKLTGLTSAGRAISLVAQVTRLPMTLVDIAVDAV* |
| Ga0066689_109677822 | 3300005447 | Soil | HPEYGDLVRLTGLTSTGRAITLVAQVDRLPLALVDIEADPA* |
| Ga0066682_102907562 | 3300005450 | Soil | TQPAGSHPQYGELVSLTGLSSSGRAITLVAQVDHLPLVLVDIQADTA* |
| Ga0066681_105038092 | 3300005451 | Soil | HPKYGDLVRLTGLTSAGRAITLVAQVERLPLALVDIEADA* |
| Ga0070707_1014768881 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | TTAHPAGRHPKYGDLVRLTGLTSAGRAITLVAQVDRLPLALVDIEADA* |
| Ga0070699_1009942632 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | TPSQPAGTHPEYGDLVKLIGLTSAGRVITLVARVDRLPIVLVDIEVDAA* |
| Ga0070697_1000293915 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | THPQYGGLVRLTGLTSSGRAITLTAQVEHLPMALVDISVEAA* |
| Ga0070697_1011850731 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VPAGSHPQYGELVKLTGLTSAGRAISLVAQVTRLPMTLVDIAADTV* |
| Ga0070695_1003043531 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | GVTTQQPAGSHPEYGDLVRLTGLTSTGRVITLVAQVDRLPLALVDIEADPA* |
| Ga0066701_100394033 | 3300005552 | Soil | GVTTQQPAGSHPQYGDLVRLTGLTSSGRAITLVAQVDRLPLALVDIEAE* |
| Ga0066701_101866322 | 3300005552 | Soil | QPAGSHPEYGELVRLTGLTSAGRAITLVAQVEHLPLALVDIEADAA* |
| Ga0066701_108331152 | 3300005552 | Soil | TEQQPAGTHPEYGDLVRLTGLTSTGRAITLVAQVDRLPLALVDIEADPA* |
| Ga0066695_108422482 | 3300005553 | Soil | IGGVTTEQQPAGTHPEYGDLVRLTGLTSTGRAITLVAQVDRLPLALVDIEADPK* |
| Ga0066692_101521301 | 3300005555 | Soil | PEYGELVRLTGLSSSGRAITIVAQVGHLPLVLVDIQVDTA* |
| Ga0066692_102333671 | 3300005555 | Soil | QPAGSHPEYGELVRLTGLTSAGRAITLVAQVEHLPLALVDIEADAT* |
| Ga0066692_108418412 | 3300005555 | Soil | TPVRLSGMTSTGRVITLVAQVDRLPMVLVDIQAGTA* |
| Ga0066707_108528231 | 3300005556 | Soil | QPAGSHPKYGDLVRLIGRSSSGRAIALVAQVDRLPLFLADIEADAQ* |
| Ga0066698_103598462 | 3300005558 | Soil | QPAGSHPEYGELVRLTGLTSAGRAITLVAQVERRPLTLVDIEADAA* |
| Ga0066699_101196531 | 3300005561 | Soil | GDLVRLTGLTSAGRAITLVAQVERLPLALVDIEADA* |
| Ga0066699_106767862 | 3300005561 | Soil | KYGDLVRLTGLTSAGRAITLVAQVERLPLALVDIEADA* |
| Ga0066693_104969412 | 3300005566 | Soil | TTAHPAGRHPKYGDLVRLTGLTSAGRAITLVAQVERLPLALVDIEADA* |
| Ga0066705_104534062 | 3300005569 | Soil | EYGALVRLTGLTSSGRAITLVAQVERLPLALVDISVEAA* |
| Ga0066694_100318561 | 3300005574 | Soil | HPEYGELVRLTGLTSAGRAITLVAQVDHLPLVLVDIEADAA* |
| Ga0066694_101273922 | 3300005574 | Soil | HPEYGELVRLTGLTSAGRAITLVAQVDRRPLTLVDIEADAA* |
| Ga0066694_102096521 | 3300005574 | Soil | LVRLTGLTSAGRAITLVAQVDRLPLALVDIEADA* |
| Ga0066706_100963552 | 3300005598 | Soil | GLATPALPGGTHPEYGELVRLTGLTSAGRAVTLVARVDRLPLVLVDIEADR* |
| Ga0066706_112026561 | 3300005598 | Soil | EYGDLVRLTGLTSTGRAITLVAQLERLPLTLVDIAVDT* |
| Ga0066651_102440371 | 3300006031 | Soil | VKLTGLTSAGRAITLVAQVARLPLALVDLTVESA* |
| Ga0066651_105093951 | 3300006031 | Soil | QQPAGTHPEYGDLVRLTGLTSTGRAITLVAQVKRLPLALVDIEADPA* |
| Ga0066696_103892391 | 3300006032 | Soil | PLEPAGRHPEYGELVKLTGLTSAGRAITLVAQVERLPLALVDIAVEAA* |
| Ga0066696_105307802 | 3300006032 | Soil | AGRHPKYGDLVRLTGLTSAGRAITLVAQVDRLPLTLVDIEADA* |
| Ga0066652_1019937142 | 3300006046 | Soil | QYGELVRLTGMSSSGRAITLVAQVEHLPLVLVDIQVDTA* |
| Ga0070716_1000238901 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | ELVRLSGRSSSGRAIALVAQVDRLPLILVDIEADAE* |
| Ga0066653_105710522 | 3300006791 | Soil | GGVTIPQPAGGHPEYGELVRLTGLTSAGRAITLVARVDRLPLVLVDIEVEAA* |
| Ga0066658_101971811 | 3300006794 | Soil | THPEYGDLVRLTGLTSTGRAITLVAQVDRLPLALVDIEADPK* |
| Ga0066658_105972682 | 3300006794 | Soil | AARHPEYGDLVRLTGMSSTGRAITLVAQVEHLPLVLVDIQVDTA* |
| Ga0066659_103839041 | 3300006797 | Soil | PKYGDLVRLTGLTSAGRAITLVAQVDRLPLALVDIEADA* |
| Ga0079220_110038891 | 3300006806 | Agricultural Soil | GSHPQYGELVKLTGLTSAGRAISLVAQVSRRPMTLVDIAVDAV* |
| Ga0075433_101942202 | 3300006852 | Populus Rhizosphere | VRLTGIGSSGRAISLVAQVEHLPLVLVDIQVDTA* |
| Ga0075426_102407761 | 3300006903 | Populus Rhizosphere | PAGTHPEYGDLVRLTGLTSTGRTITLVAQVDRLPLALVDIEADPK* |
| Ga0079218_106151101 | 3300007004 | Agricultural Soil | SHADYGELVRLTGLTSSGRAITLVAQVGRRPLALVDISVESA* |
| Ga0099793_105289021 | 3300007258 | Vadose Zone Soil | EYGDLVRLTGLTSTGRAITLVAQVDRLPLALVDIEADPT* |
| Ga0066710_1020419701 | 3300009012 | Grasslands Soil | SHPEYGELVRLTGLTSSGRAITLVAQVERLPLVVVDIEADA |
| Ga0066710_1025537272 | 3300009012 | Grasslands Soil | GSLPQYGERVRLTGLSSSGRAITLVAQVEHLPLVLVDIQVDAA |
| Ga0066710_1044574621 | 3300009012 | Grasslands Soil | PAGSHPQYGELVRLTGLTSAGRAITLVAQVDRLPMALVDIEVDAA |
| Ga0066710_1047565761 | 3300009012 | Grasslands Soil | GVTTEQQPAGTHPEYGDLVRLTGLTSTGRAITLVAQVDRLPLALVDIEADPK |
| Ga0099830_101277461 | 3300009088 | Vadose Zone Soil | THQPAGSHPQYGELVRLSGVSSSGRAIALVAQVDRLPLFLADIEADAE* |
| Ga0066709_1007216902 | 3300009137 | Grasslands Soil | LQPAGSHPEYGELVRLTGLTSAGRAITLVAQVDRRPLTLVDIEADAA* |
| Ga0066709_1009644332 | 3300009137 | Grasslands Soil | GVPTQPAGSHPEYGELVRLTGLTSAGRAITLVAQVDRLPLTLVDITADAA* |
| Ga0099792_109298221 | 3300009143 | Vadose Zone Soil | AGSHPKYGELVRLSGRSSSGRAIALVAQVDRLPLFLADIEADAE* |
| Ga0134082_102674921 | 3300010303 | Grasslands Soil | PIGGATPPLAPAGGHPEYGELVKLTGLTSAGRAITLVAQVERLPLTLVDIAVEAA* |
| Ga0134088_101528832 | 3300010304 | Grasslands Soil | VTIPQPAGGHPEYGALVRLTGLTSSGRAITLVARVDRLPLVLVDIEVEAA* |
| Ga0134109_100148173 | 3300010320 | Grasslands Soil | HPQYGALVRVTGLTSSARAITLVAQVERLPMALVDISVEAA* |
| Ga0134109_100211532 | 3300010320 | Grasslands Soil | VRLTGISSSGRAITLVAQVEHLPLVLVDIQVDAT* |
| Ga0134109_103492882 | 3300010320 | Grasslands Soil | VPTQPAGSHPEYGELVRLTGLTSAGRAITLVAQVDRLPLTLVDITADAA* |
| Ga0134109_103880992 | 3300010320 | Grasslands Soil | THPEYGDLVRLTGLTSTGRAITLVAQVDRLPLALVDIEADPA* |
| Ga0134084_103277231 | 3300010322 | Grasslands Soil | YGDLVRLTGLTSTGRAITLVAQVDRLPLALVDIEADPA* |
| Ga0134086_101869201 | 3300010323 | Grasslands Soil | TEQQPAGTHPEYGDLVRLTGLTSTGRAITLVAQVDRLPLALVDIEADPK* |
| Ga0134086_102799461 | 3300010323 | Grasslands Soil | GELVRLTGLTSAGRAITLVAQVDRRPLTLVDIEADAA* |
| Ga0134086_104629301 | 3300010323 | Grasslands Soil | QYGELVRLTGLTSSGRTITLLAQVDRLPLVLVDIQADTG* |
| Ga0134086_104856312 | 3300010323 | Grasslands Soil | TEQQPAGTHPEYGDLVRLTGLTSTGRAITLVAQVKRLPLALVDIEADPA* |
| Ga0134065_100150931 | 3300010326 | Grasslands Soil | PLAPAGRHAEYGELVKLTGLTSAGRAITLVAQVERLPLALVDIAVEAA* |
| Ga0134111_103820961 | 3300010329 | Grasslands Soil | QPAGTHPEYGDLVRLTGLTSSGRTITLVAQVNRLPLALVDIEADPA* |
| Ga0134111_105561431 | 3300010329 | Grasslands Soil | SHPQYGELVRLTGLTSAGRAITLVAQVNRLPMALVDIAVDAA* |
| Ga0134080_102780682 | 3300010333 | Grasslands Soil | THPEYGALVRLTGLTSTGRAIALVARVDRLPLVLVDIAVDAI* |
| Ga0134071_103810212 | 3300010336 | Grasslands Soil | PQYGDLVRLTGLTSTGRAITLVAQVDRLPLALVDIEVDAG* |
| Ga0134071_105292981 | 3300010336 | Grasslands Soil | AGTHPQYGELVRLTGLTSSGRTITLVAQVDRLPLVLVDIQADTA* |
| Ga0137393_103566362 | 3300011271 | Vadose Zone Soil | GGGRVTTMQPAGSHAVYGALVRLTGLTSSGRAITLVAQVERLPLALVDISVEAA* |
| Ga0137421_10264912 | 3300012039 | Soil | APSQPAGTHPQYGELVRLTGLTSGGRVITLVAQVARLPLVLVGIQMDVL* |
| Ga0137389_107293931 | 3300012096 | Vadose Zone Soil | ITTPQPAGSHPQYGELVRLTGMSSSGRAITLVAQVEHLPLVLVDIQVDTA* |
| Ga0137383_111746672 | 3300012199 | Vadose Zone Soil | IGGVEGVTTQPAGSHPQYGELVSLTGLSSSGRAITLVAQVDRLPLVLVDIKADAT* |
| Ga0137365_104517311 | 3300012201 | Vadose Zone Soil | PVGGVTTVHPAGRHPKYGDLVRLTGLTSAGRAITLVAQVDRLPLTLVDIEADA* |
| Ga0137362_103797311 | 3300012205 | Vadose Zone Soil | QPAGSHPEYGDLVRLTGLTSTGRAITLVAQVDRLPLALVDIEADPT* |
| Ga0137380_112368342 | 3300012206 | Vadose Zone Soil | VRLTGLTSTGRAITLVAQVDRLPLALVDIEADPK* |
| Ga0137381_115824852 | 3300012207 | Vadose Zone Soil | GGVEGVTTQPAGSHPQYGELVSLTGLSSSGRAITLVAQVDRLPLVLVDIKADAT* |
| Ga0137379_104238861 | 3300012209 | Vadose Zone Soil | THQAAGSHPKYGELVRLNGVSSSGRAIALVAQVDRLPLFLADIEADAE* |
| Ga0137379_109471142 | 3300012209 | Vadose Zone Soil | VTPLQPAGSHPQYGELVRLTGLTSAGRGITLVAQVNRLPMALVDIAVDAA* |
| Ga0137377_100526061 | 3300012211 | Vadose Zone Soil | AGAHPEYGELVRLTGLSSSGRAITLVAQVDHLPLVLVDIQVDTA* |
| Ga0137377_105678692 | 3300012211 | Vadose Zone Soil | QYGALVRLTGLTSSARAITLVAQVERLPLALVDISVEAA* |
| Ga0137377_109883812 | 3300012211 | Vadose Zone Soil | DVITTQPVPAGTHPQYGALVRLTGLTSSARAITLVAQVERLPLALVDISVEAA* |
| Ga0137370_102891412 | 3300012285 | Vadose Zone Soil | VTTEQQPAGTHPEYGDLVRLTGLTSTGRAITLVAQVDRLPLALVDIEADPK* |
| Ga0137387_102225801 | 3300012349 | Vadose Zone Soil | GRRPLQPAASPPHSGELVRLTGLTSAGRAITLVAQVNRLPMALVDIAVDAA* |
| Ga0137386_104076861 | 3300012351 | Vadose Zone Soil | ITTQPVPAGTHPQYGALVRVTGLTSSARAITLVAQVERLPLALVDIAVESA* |
| Ga0137386_104993402 | 3300012351 | Vadose Zone Soil | LVRLSGVSSSGRAIALVAQVDRLPLFLADIEADAE* |
| Ga0137369_101700131 | 3300012355 | Vadose Zone Soil | GDLVRLTGLTSTGRAITLVAQAERLPLALVDIEADPA* |
| Ga0137369_103331541 | 3300012355 | Vadose Zone Soil | THQPAGSHPQYGELVRLTGMTSSGRAITLVAHVEHLPLVLVDIEADVT* |
| Ga0137371_112766521 | 3300012356 | Vadose Zone Soil | GSHPQYGELVSLTGLSSSGRAITLVAQVDRLPLVLVDIKADAT* |
| Ga0137384_115480481 | 3300012357 | Vadose Zone Soil | DSHPQYGALVRLTGMSSSGRAITLVAQVEHLPLVLVDIQVDTA* |
| Ga0137385_105405301 | 3300012359 | Vadose Zone Soil | AGSHPQYGELVRLTGLTSAGRAITLVAQVNRLPMALVDIAVDAA* |
| Ga0137385_112749281 | 3300012359 | Vadose Zone Soil | EPIGGVTAHQPAGSHPKYGDLVRLSGRSSSGRAIALVAQVDRLPLFLADIEADAE* |
| Ga0137385_116756262 | 3300012359 | Vadose Zone Soil | LVRLIGRSSSGRAIALVAQVDRLPLFLADIEADAQ* |
| Ga0137361_104525592 | 3300012362 | Vadose Zone Soil | AEYGALVRLTGLTSSGRAITLVAQVERLPMALVDISVEAA* |
| Ga0137361_106150832 | 3300012362 | Vadose Zone Soil | QPAGSHPEYGELVRLTGLTSAGRAITLVAQVDRLPLTLVDITADAA* |
| Ga0137361_117888572 | 3300012362 | Vadose Zone Soil | VITTQPVPAGTHPQYGALVRLTGLTSSGRAITLVAQVERLPMALVDISVEAA* |
| Ga0137390_118297151 | 3300012363 | Vadose Zone Soil | LVRLSGVSSSGRAIALVAQVDRLPLFLVDIEADAE* |
| Ga0137397_113260082 | 3300012685 | Vadose Zone Soil | GEGSATTPEPAGSHPQYGELVRLTGIGSSGRTITLVAQVERLPLLLVDIQVYAA* |
| Ga0137397_113312801 | 3300012685 | Vadose Zone Soil | PFGEGSATTPEPAGSHPQYGELVRLTGIGSSGRTITLVAQVDRLPLVLVDIQVDAT* |
| Ga0137395_103167221 | 3300012917 | Vadose Zone Soil | VEGVTTQPAGSHPQYGELVSLTGLSSSGRAITLVAQVDHLPLVLVDIKADTT* |
| Ga0137395_105737191 | 3300012917 | Vadose Zone Soil | HPQYGALVRLTGLTSSGRAITLVAQVERLPLALVDISVVAA* |
| Ga0137396_104664581 | 3300012918 | Vadose Zone Soil | QTAGSHPEYGDLVRLTGLTSTGRAITLVAQVERLPLVLVDIEVDAA* |
| Ga0137359_111812642 | 3300012923 | Vadose Zone Soil | THPQYGALVRLTGLTSSGRAITLVAQVERRPMALVDISVEAA* |
| Ga0137419_106764042 | 3300012925 | Vadose Zone Soil | QPVPAGTHPQYGALVRLTGLTSSGRAITLTAQVERLPMALVDISVEAA* |
| Ga0137419_117034042 | 3300012925 | Vadose Zone Soil | GGAATPKPADCHSEYGDLVRLTGMSSTGRTITLVARVDRLPLVLVDIEADSAA* |
| Ga0137416_107413061 | 3300012927 | Vadose Zone Soil | ELVRLTGMSSSGRAITLVAQVEHLPLVLVDIQVDTA* |
| Ga0137404_114446011 | 3300012929 | Vadose Zone Soil | EQQPAGTHPEYGDLVRLTGLTSTGRAITLVAQVDRLPLALVDIEADPK* |
| Ga0137410_103894152 | 3300012944 | Vadose Zone Soil | YGELVRLTGIGSSGRTITLVAQVDRLPLVLVDIQVDAT* |
| Ga0137410_110202271 | 3300012944 | Vadose Zone Soil | VRLTGLTSSGRAITLVAQVERLPMALVDISVEAA* |
| Ga0134077_101054101 | 3300012972 | Grasslands Soil | QPAGTHPEYGDLVRLTGLTSTGRAITLVAQVDRLPLALVDIEADPA* |
| Ga0134077_101906162 | 3300012972 | Grasslands Soil | QPAGSHPEYGELVRLTGLTSAGRAITLVAQVDRRPLTLVDIEADAA* |
| Ga0134077_105632402 | 3300012972 | Grasslands Soil | GLATPARPAGTHPEYGELVRLTGLTSAGRAVTLVARVDRLPLVLVDIEADR* |
| Ga0134076_101341082 | 3300012976 | Grasslands Soil | IGGITTPQPAGSHPQYGELVRLTGISSSGRAITLVAQVDRLPLALVDIEVDAA* |
| Ga0134076_102008212 | 3300012976 | Grasslands Soil | EYGELVRLTGLTSSGRTITLVAQVDRLPLALVDIEADAA* |
| Ga0134087_104339211 | 3300012977 | Grasslands Soil | EQQPAGTHPEYGDLVRLTGLTSTGRAITLVAQVDRLPLALVDIEADPA* |
| Ga0134087_104639372 | 3300012977 | Grasslands Soil | ATPARPGGTHPEYGELVRLTGLTSAGRAVTLVARVDRLPLVLVDIEADR* |
| Ga0134081_100114941 | 3300014150 | Grasslands Soil | IGGVTTEQQPAGTHPEYGDLVRLTGLTSTGRAITLVAQVDRLPLALVDIEADPA* |
| Ga0134075_100918691 | 3300014154 | Grasslands Soil | HPQYGELVRLTGLTSAGRAITLVAQVNRLPMALVDIAVDAA* |
| Ga0134078_100131921 | 3300014157 | Grasslands Soil | GELVSLTGLSSSGRAITLVAQVDHLPLVLVDIQADTA* |
| Ga0134078_102736381 | 3300014157 | Grasslands Soil | AGSHPQYGELVRLTGMSSTGRAITLVAQVEHLPLVLVDIQVDTA* |
| Ga0180080_11012391 | 3300014870 | Soil | GLTPSQPAGTHPKYGELVRLTGLTSGGRVITLVAQVARLPLVLVDIEVDAV* |
| Ga0134072_100895071 | 3300015357 | Grasslands Soil | TTAQPAGQHPKYGDLVRLTGLTSAGRAITLVAQVERLPLALVDIEADA* |
| Ga0134089_104525081 | 3300015358 | Grasslands Soil | PIGGVRTEQQPAGTHPEYGDLVRLTGLTSTGRAITLVAQVDRLPLALVDIEADPA* |
| Ga0132256_1030609301 | 3300015372 | Arabidopsis Rhizosphere | PIAGATPLAPAGSHPQYGELVKLTGLTSAGRAISLVAQATRLPMTLVDIAVDAV* |
| Ga0134069_10729131 | 3300017654 | Grasslands Soil | LVRLTGLTSTGRAITLVAQVDRLPLALVDIEADPA |
| Ga0134069_11260072 | 3300017654 | Grasslands Soil | TQPAGSHPQYGELVSLTGLSSSGRAITLVAQVDHLPLVLVDIQADTA |
| Ga0134112_101796192 | 3300017656 | Grasslands Soil | TEQQPAGTHPEYGDLVRLTGLTSTGRAITLVAQVDRLPLALVDIEADPA |
| Ga0134074_11029782 | 3300017657 | Grasslands Soil | HPEYGELVRLTGLTSAGRAITLVAQVDHLPLVLVDIEADAA |
| Ga0134074_12737582 | 3300017657 | Grasslands Soil | SQPAGSHPQYGELVRLTGMGSSGRAITLVAQVEHLPLVLVDIQVDAT |
| Ga0134083_101083732 | 3300017659 | Grasslands Soil | GGVTTQQPAGSHPEYGELVRLTGLTSSGRAITLVAQVERLPLVVVDIEADA |
| Ga0134083_103238521 | 3300017659 | Grasslands Soil | PAGTHPEYGDLVRLTGLTSTGRAITLVAQVDRLPLALVDIEADPA |
| Ga0184608_103834282 | 3300018028 | Groundwater Sediment | QPVPAGSHPQYGALVRLTGLTSSGRAITLTAQVERLPLALVDISVEAA |
| Ga0184623_100006861 | 3300018056 | Groundwater Sediment | ELVRLTGMSSSGRAITLVAQVDHLPLVLVDIEADAT |
| Ga0184623_101230281 | 3300018056 | Groundwater Sediment | QPAGSHPEYGALVRLTGLTSSGRAITLVAQVERLPLALVDITVESA |
| Ga0184618_102671041 | 3300018071 | Groundwater Sediment | YGELVQITGIGSSGRTITLVAQVERLPLVLVDIKADAT |
| Ga0184609_100231693 | 3300018076 | Groundwater Sediment | QPAGSQPQYGELVRLNGRSSSGRAVALVAQVDRLPLFLADIEADAE |
| Ga0066655_103619752 | 3300018431 | Grasslands Soil | GSHPEYGELVRLTGLTSSGRTITLVAQGDRLPLALVDIEADA |
| Ga0066655_109941531 | 3300018431 | Grasslands Soil | SHPQYGALVRFTGVSSSGRAITLVAQVEHLPLVLVDIQVDTA |
| Ga0066655_110095592 | 3300018431 | Grasslands Soil | GGGATTPQPAGSHPQYGELVRLTGIGSSGRAITLVAQVAHLPLVLVDIQVDAT |
| Ga0066667_109917571 | 3300018433 | Grasslands Soil | TTPQPAGSHPQYGELVRLTGMSSTGRAITLVAQVEHLPLVLVDIQVDTA |
| Ga0066667_116519641 | 3300018433 | Grasslands Soil | GELGKLTGLTSAGRAITLVAQVASLPLALVDIAVEAA |
| Ga0066667_117621712 | 3300018433 | Grasslands Soil | EMVKLTGLPSEGRAITLGAQVERLPLTLVDIAVDAA |
| Ga0066669_108806121 | 3300018482 | Grasslands Soil | QQPAGTHPEYGDLVRLTGLTSTGRAITLVAQVDRLPLALVDIEADPA |
| Ga0193705_10366291 | 3300019869 | Soil | VTTPGEPVRLTGLASSGRTITLVAQVDRLPMVLVDIGIQADTA |
| Ga0193723_10823234 | 3300019879 | Soil | GEPVRLTGLASSGRTITLVAQVDRLPMVLVDIGIQADTA |
| Ga0193755_10114511 | 3300020004 | Soil | SHPQYGALVRLTGLTSSGRAITLVAQVERLPLALVDISVEAA |
| Ga0210378_100092541 | 3300021073 | Groundwater Sediment | VTAQPAGTHPQYGELVQITGIGSSGRTITLVAQVERLPLVLVDIKADAT |
| Ga0247671_100008334 | 3300024284 | Soil | AAGATPLAPAGSHPQYGELVKLTGLTSAGRAISLVAQVTRLPMTLVDIAVDAV |
| Ga0247678_10448401 | 3300024325 | Soil | YGELVKLTGLTSAGRAISLVAQVTRLPMTLVDIAVDAV |
| Ga0207646_118557841 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | PIGEDGVTPSQPAGTHPEYGDLVKLIGLTSAGRVITLVARVDRLPIVLVDIEVDAA |
| Ga0209237_11569882 | 3300026297 | Grasslands Soil | GVTTQQPAGSHPEYGELVRLTGLTSGGRAITLVAQVDHLPLALVDIAVDAG |
| Ga0209237_12895771 | 3300026297 | Grasslands Soil | GGGGVTTQPAGSHPEYGELVRLTGMTSAGRTITLVAQVDRLPLTLVDIAVERE |
| Ga0209236_12069762 | 3300026298 | Grasslands Soil | QPVGSDPEYGELVRLTGLTSAGRAITLVAQVDRLPLVLVDIAVERE |
| Ga0209238_10011138 | 3300026301 | Grasslands Soil | EPIGGITTPQPAGSHPQYGELVRLTGMSSSGRAITLVAQVEHLPLVLVDIQVDTA |
| Ga0209238_11431061 | 3300026301 | Grasslands Soil | SEYGELVKLTGLTSAGRAITLVAQVERLPLALVDIAVEAA |
| Ga0209469_11393521 | 3300026307 | Soil | GGVTTEQQPAGTHPEYGDLVRLTGLTSTGRAITLVAQVDRLPLALVDIEADPK |
| Ga0209239_11186111 | 3300026310 | Grasslands Soil | GTHPEYGDLVRLTGLTSTGRAITLVAQVDRLPLALVDIEADPK |
| Ga0209239_11195532 | 3300026310 | Grasslands Soil | GTHPEYGDLVRLTGLTSTGRAITLVAQVDRLPLALVDIEADPA |
| Ga0209239_11535121 | 3300026310 | Grasslands Soil | DLVRLTGLTSTGRAITLVAQVDRLPLALVDIEADPK |
| Ga0209239_11650731 | 3300026310 | Grasslands Soil | SIEPVGGVTTAQPAGHDPKYGDLVRLTGLTSAGRAITLVAQVERLPLALVDIEADA |
| Ga0209239_13700912 | 3300026310 | Grasslands Soil | ELVKLTGLTSAGRAITLVAQVERLPLALVDIAVEAA |
| Ga0209470_10052146 | 3300026324 | Soil | PEYGELVRLTGLTSAGRAITLVARVDRLPLVLVDIEVEAA |
| Ga0209802_11347401 | 3300026328 | Soil | EPIGGGGVTTQPAGSHPEYGELVRLTGLTSAGRAITLVAQVDRLPLTLVDITADAA |
| Ga0209375_10468782 | 3300026329 | Soil | AGEGVTTQQPAGSHPEYGELVRLTGLTSSGRTITLVAQGDRLPLALVDIEADA |
| Ga0209375_11827521 | 3300026329 | Soil | IGGVTPLQPAGSHPQYGELVRLTGLTSAGRAITLVAQVNRLPMALVDIAVDAA |
| Ga0209808_10708011 | 3300026523 | Soil | EPIGGVTTAHPAGRHPKYGDLVRLTGLTSAGRAITLVAQVDRLPLTLVDIEADA |
| Ga0209690_12977481 | 3300026524 | Soil | GVTTQQPAGSHPQYGDLVRLTGLTSSGRAITLVAQVDRLPLALVDIEAE |
| Ga0209058_10639872 | 3300026536 | Soil | PIGGGGVTPLQPAGSHPEYGELVRLTGLTSAGRAITLVAQVERRPLTLVDIEADAA |
| Ga0209156_102744151 | 3300026547 | Soil | DLVRLTGLTSAGRAITLVAQVDRLPLTLVDIEADA |
| Ga0209161_101560931 | 3300026548 | Soil | GVTTQPAGSHPQYGELVSLTGLSSSGRTITLVAQVDRLPLVLVDIQADTA |
| Ga0209161_104234591 | 3300026548 | Soil | VGGLATPALPGGTHPEYGELVRLTGLTSAGRAVTLVARVDRLPLVLVDIEADR |
| Ga0179587_103424511 | 3300026557 | Vadose Zone Soil | PLPAGTHPQYGALVRLTGLTSSGRAITLVAQVEHLPMALVDISVEAA |
| Ga0209845_10756082 | 3300027324 | Groundwater Sand | QYGELVRLTGLTSAGRAITVVAQVDRLPLTLVDIEADG |
| Ga0209106_10660571 | 3300027616 | Forest Soil | EPIGGVTTEQPAGSHAEYGDLVRLTGLTSTGRAITLVAQADRLPLALVDIEADPA |
| Ga0209689_10358911 | 3300027748 | Soil | ALVRLTGLTSSGRAITLVAQVERLPLALVDISVEAA |
| Ga0209701_102505771 | 3300027862 | Vadose Zone Soil | GAPVRLSGMTSTGRVITLIAQVDRLPMVLVDIQADPA |
| Ga0137415_100805536 | 3300028536 | Vadose Zone Soil | PEPAGSHPQYGELVRLTGIGSSGRTITLVAQVDRLPLVLVDIQVDAT |
| Ga0326597_102392642 | 3300031965 | Soil | AGSHPEYGDLVRLTGIGSSGRAITLVAQVDRLPLALVDIQADTA |
| Ga0307471_1004578771 | 3300032180 | Hardwood Forest Soil | GAPVRLSGMTSTGRVITLVAEVHRLPMVLVDIQADTA |
| Ga0307471_1036817151 | 3300032180 | Hardwood Forest Soil | LQPAGRHPEYGELVRLTGLTSAGRAITLVARVDRLPLVLVDVEADAT |
| Ga0214472_101789631 | 3300033407 | Soil | GGGARPPPTTHQPAGSHPEYGELVRLTGIGSSGRAITLVAQVDRLPLALVDIQADTA |
| Ga0214471_106384832 | 3300033417 | Soil | GTTHQPAGSHPEYGELVRLTGIGSSGRAITLVAQVDRLPLALVDIQADTA |
| ⦗Top⦘ |