| Basic Information | |
|---|---|
| Family ID | F027946 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 193 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MNFLYAAYAATWTIHIVYLITVVRRYSRLKKEVDELNKKI |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 193 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 87.43 % |
| % of genes near scaffold ends (potentially truncated) | 17.10 % |
| % of genes from short scaffolds (< 2000 bps) | 70.47 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.337 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (15.026 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.788 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.259 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.88% β-sheet: 0.00% Coil/Unstructured: 44.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 193 Family Scaffolds |
|---|---|---|
| PF01578 | Cytochrom_C_asm | 35.23 |
| PF07238 | PilZ | 19.17 |
| PF03379 | CcmB | 5.18 |
| PF06739 | SBBP | 3.63 |
| PF03100 | CcmE | 2.59 |
| PF04199 | Cyclase | 2.07 |
| PF00005 | ABC_tran | 2.07 |
| PF00719 | Pyrophosphatase | 1.55 |
| PF02348 | CTP_transf_3 | 1.55 |
| PF02687 | FtsX | 1.04 |
| PF05649 | Peptidase_M13_N | 1.04 |
| PF01964 | ThiC_Rad_SAM | 1.04 |
| PF11746 | DUF3303 | 0.52 |
| PF11006 | DUF2845 | 0.52 |
| PF00578 | AhpC-TSA | 0.52 |
| PF01546 | Peptidase_M20 | 0.52 |
| PF01656 | CbiA | 0.52 |
| PF08327 | AHSA1 | 0.52 |
| PF01740 | STAS | 0.52 |
| PF04366 | Ysc84 | 0.52 |
| PF02894 | GFO_IDH_MocA_C | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 193 Family Scaffolds |
|---|---|---|---|
| COG2386 | ABC-type transport system involved in cytochrome c biogenesis, permease component | Posttranslational modification, protein turnover, chaperones [O] | 5.18 |
| COG2332 | Cytochrome c biogenesis protein CcmE | Posttranslational modification, protein turnover, chaperones [O] | 2.59 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 2.07 |
| COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 1.55 |
| COG1083 | CMP-N-acetylneuraminic acid synthetase, NeuA/PseF family | Cell wall/membrane/envelope biogenesis [M] | 1.55 |
| COG1212 | CMP-2-keto-3-deoxyoctulosonic acid synthetase | Cell wall/membrane/envelope biogenesis [M] | 1.55 |
| COG1861 | Spore coat polysaccharide biosynthesis protein SpsF, cytidylyltransferase family | Cell wall/membrane/envelope biogenesis [M] | 1.55 |
| COG0422 | 4-amino-2-methyl-5-hydroxymethylpyrimidine (HMP) synthase ThiC | Coenzyme transport and metabolism [H] | 1.04 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 1.04 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.52 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.34 % |
| Unclassified | root | N/A | 4.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309004|prs_FIHLEPW02PVNNL | Not Available | 537 | Open in IMG/M |
| 2162886012|MBSR1b_contig_7984263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1378 | Open in IMG/M |
| 2228664022|INPgaii200_c0592616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101645021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1619 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105461680 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 927 | Open in IMG/M |
| 3300000559|F14TC_105150972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300001867|JGI12627J18819_10000224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 18678 | Open in IMG/M |
| 3300001867|JGI12627J18819_10046555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1812 | Open in IMG/M |
| 3300001867|JGI12627J18819_10205350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 795 | Open in IMG/M |
| 3300003324|soilH2_10299515 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10044688 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10365115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 587 | Open in IMG/M |
| 3300004268|Ga0066398_10111851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 646 | Open in IMG/M |
| 3300004479|Ga0062595_100941026 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300004633|Ga0066395_10848848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 550 | Open in IMG/M |
| 3300005167|Ga0066672_10284501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1071 | Open in IMG/M |
| 3300005171|Ga0066677_10163400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1227 | Open in IMG/M |
| 3300005178|Ga0066688_10340665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 970 | Open in IMG/M |
| 3300005332|Ga0066388_100093982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3435 | Open in IMG/M |
| 3300005332|Ga0066388_100127303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3084 | Open in IMG/M |
| 3300005332|Ga0066388_100915506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1453 | Open in IMG/M |
| 3300005332|Ga0066388_101474266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1188 | Open in IMG/M |
| 3300005332|Ga0066388_101515268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1174 | Open in IMG/M |
| 3300005332|Ga0066388_103809546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → unclassified Bacillus (in: Bacteria) → Bacillus sp. URHB0009 | 770 | Open in IMG/M |
| 3300005434|Ga0070709_10119229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1786 | Open in IMG/M |
| 3300005434|Ga0070709_10123391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1759 | Open in IMG/M |
| 3300005436|Ga0070713_100034787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4052 | Open in IMG/M |
| 3300005439|Ga0070711_100048945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2893 | Open in IMG/M |
| 3300005439|Ga0070711_100385861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1134 | Open in IMG/M |
| 3300005439|Ga0070711_101142394 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300005447|Ga0066689_10342232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 932 | Open in IMG/M |
| 3300005529|Ga0070741_10029772 | All Organisms → cellular organisms → Bacteria | 7718 | Open in IMG/M |
| 3300005529|Ga0070741_10038550 | All Organisms → cellular organisms → Bacteria | 6265 | Open in IMG/M |
| 3300005538|Ga0070731_10034486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3414 | Open in IMG/M |
| 3300005542|Ga0070732_10055590 | All Organisms → cellular organisms → Bacteria | 2291 | Open in IMG/M |
| 3300005542|Ga0070732_10258965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1042 | Open in IMG/M |
| 3300005542|Ga0070732_11011062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 508 | Open in IMG/M |
| 3300005554|Ga0066661_10560711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 682 | Open in IMG/M |
| 3300005557|Ga0066704_10015090 | All Organisms → cellular organisms → Bacteria | 4409 | Open in IMG/M |
| 3300005764|Ga0066903_100290334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2575 | Open in IMG/M |
| 3300005764|Ga0066903_101504476 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300005764|Ga0066903_102082710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1092 | Open in IMG/M |
| 3300005764|Ga0066903_103117708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 897 | Open in IMG/M |
| 3300005880|Ga0075298_1004716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 992 | Open in IMG/M |
| 3300006041|Ga0075023_100039961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1426 | Open in IMG/M |
| 3300006041|Ga0075023_100076583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1110 | Open in IMG/M |
| 3300006047|Ga0075024_100169351 | Not Available | 1006 | Open in IMG/M |
| 3300006050|Ga0075028_100110392 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300006052|Ga0075029_100253771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1111 | Open in IMG/M |
| 3300006057|Ga0075026_100847291 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300006059|Ga0075017_100003209 | All Organisms → cellular organisms → Bacteria | 10273 | Open in IMG/M |
| 3300006059|Ga0075017_100140991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1710 | Open in IMG/M |
| 3300006102|Ga0075015_100726345 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300006162|Ga0075030_100116880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2168 | Open in IMG/M |
| 3300006174|Ga0075014_100012096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3064 | Open in IMG/M |
| 3300006175|Ga0070712_100000854 | All Organisms → cellular organisms → Bacteria | 18137 | Open in IMG/M |
| 3300007076|Ga0075435_102037474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300007258|Ga0099793_10026344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2433 | Open in IMG/M |
| 3300009011|Ga0105251_10078972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1523 | Open in IMG/M |
| 3300009148|Ga0105243_11516266 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300009162|Ga0075423_12488202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300009792|Ga0126374_11794804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300010043|Ga0126380_10345176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1081 | Open in IMG/M |
| 3300010043|Ga0126380_10534954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300010043|Ga0126380_11020720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300010043|Ga0126380_11802395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300010046|Ga0126384_11493881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300010048|Ga0126373_10114683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2512 | Open in IMG/M |
| 3300010048|Ga0126373_10236877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1789 | Open in IMG/M |
| 3300010048|Ga0126373_11693779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300010048|Ga0126373_11812799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300010048|Ga0126373_11870171 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300010154|Ga0127503_10900235 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300010358|Ga0126370_10571189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 970 | Open in IMG/M |
| 3300010358|Ga0126370_10908897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300010361|Ga0126378_10212998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2013 | Open in IMG/M |
| 3300010361|Ga0126378_10615936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1199 | Open in IMG/M |
| 3300010361|Ga0126378_10983905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
| 3300010366|Ga0126379_10606064 | Not Available | 1181 | Open in IMG/M |
| 3300010366|Ga0126379_12407180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300010376|Ga0126381_100073201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4282 | Open in IMG/M |
| 3300010376|Ga0126381_101936172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 850 | Open in IMG/M |
| 3300010398|Ga0126383_12931227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300010401|Ga0134121_10047616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3511 | Open in IMG/M |
| 3300011000|Ga0138513_100047880 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300011120|Ga0150983_13452803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
| 3300012200|Ga0137382_10166055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1504 | Open in IMG/M |
| 3300012200|Ga0137382_10958243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300012200|Ga0137382_11233922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300012202|Ga0137363_10448116 | Not Available | 1080 | Open in IMG/M |
| 3300012203|Ga0137399_10161370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1799 | Open in IMG/M |
| 3300012350|Ga0137372_10063751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3199 | Open in IMG/M |
| 3300012685|Ga0137397_10030505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3838 | Open in IMG/M |
| 3300012685|Ga0137397_10826129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300012918|Ga0137396_10125530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1852 | Open in IMG/M |
| 3300012922|Ga0137394_10008642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7908 | Open in IMG/M |
| 3300012925|Ga0137419_11297796 | Not Available | 612 | Open in IMG/M |
| 3300012927|Ga0137416_10023964 | All Organisms → cellular organisms → Bacteria | 3959 | Open in IMG/M |
| 3300012971|Ga0126369_11213162 | Not Available | 844 | Open in IMG/M |
| 3300012971|Ga0126369_11862728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300012971|Ga0126369_11915965 | Not Available | 681 | Open in IMG/M |
| 3300014325|Ga0163163_10479021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1305 | Open in IMG/M |
| 3300015371|Ga0132258_10001281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 43400 | Open in IMG/M |
| 3300015371|Ga0132258_10903847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2229 | Open in IMG/M |
| 3300015371|Ga0132258_11050736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2059 | Open in IMG/M |
| 3300015371|Ga0132258_12022263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1449 | Open in IMG/M |
| 3300015371|Ga0132258_13745752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1036 | Open in IMG/M |
| 3300015373|Ga0132257_101347482 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300016357|Ga0182032_10010543 | All Organisms → cellular organisms → Bacteria | 4970 | Open in IMG/M |
| 3300016404|Ga0182037_10277402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1337 | Open in IMG/M |
| 3300017927|Ga0187824_10001445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5892 | Open in IMG/M |
| 3300017927|Ga0187824_10043239 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
| 3300017927|Ga0187824_10067061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1123 | Open in IMG/M |
| 3300017930|Ga0187825_10278965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300017936|Ga0187821_10142704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
| 3300017994|Ga0187822_10254387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300017994|Ga0187822_10266074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300018032|Ga0187788_10000373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 12354 | Open in IMG/M |
| 3300018431|Ga0066655_10812339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300018468|Ga0066662_10163478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1704 | Open in IMG/M |
| 3300019877|Ga0193722_1117103 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300020579|Ga0210407_10592488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
| 3300020579|Ga0210407_11185079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300020581|Ga0210399_10010467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7267 | Open in IMG/M |
| 3300020582|Ga0210395_10030010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3982 | Open in IMG/M |
| 3300020582|Ga0210395_10169398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1634 | Open in IMG/M |
| 3300020583|Ga0210401_10001119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 31650 | Open in IMG/M |
| 3300020583|Ga0210401_10027111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5469 | Open in IMG/M |
| 3300020583|Ga0210401_10274134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1547 | Open in IMG/M |
| 3300021088|Ga0210404_10187002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1105 | Open in IMG/M |
| 3300021088|Ga0210404_10587426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300021088|Ga0210404_10857990 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300021171|Ga0210405_11186687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300021404|Ga0210389_11053699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300021406|Ga0210386_10025395 | All Organisms → cellular organisms → Bacteria | 4637 | Open in IMG/M |
| 3300021432|Ga0210384_10140882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2164 | Open in IMG/M |
| 3300021559|Ga0210409_11348002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300021560|Ga0126371_10000619 | All Organisms → cellular organisms → Bacteria | 29534 | Open in IMG/M |
| 3300021560|Ga0126371_10003935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 13048 | Open in IMG/M |
| 3300021560|Ga0126371_10746604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1126 | Open in IMG/M |
| 3300021560|Ga0126371_12161285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300021560|Ga0126371_12230647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300024288|Ga0179589_10579840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300024330|Ga0137417_1095414 | All Organisms → cellular organisms → Bacteria | 2720 | Open in IMG/M |
| 3300024330|Ga0137417_1314334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1757 | Open in IMG/M |
| 3300025906|Ga0207699_11062478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300025928|Ga0207700_11854554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300025935|Ga0207709_10814467 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300026285|Ga0209438_1231551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300026998|Ga0208369_1012128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300027376|Ga0209004_1034612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
| 3300027562|Ga0209735_1066704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300027643|Ga0209076_1069013 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300027869|Ga0209579_10028459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3067 | Open in IMG/M |
| 3300027910|Ga0209583_10063938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1332 | Open in IMG/M |
| 3300027911|Ga0209698_10137437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2013 | Open in IMG/M |
| 3300031226|Ga0307497_10205171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300031545|Ga0318541_10042056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2317 | Open in IMG/M |
| 3300031715|Ga0307476_10018622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4476 | Open in IMG/M |
| 3300031715|Ga0307476_10103359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2014 | Open in IMG/M |
| 3300031720|Ga0307469_10000157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 26387 | Open in IMG/M |
| 3300031720|Ga0307469_10022416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3469 | Open in IMG/M |
| 3300031720|Ga0307469_10061257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2434 | Open in IMG/M |
| 3300031720|Ga0307469_10103979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2004 | Open in IMG/M |
| 3300031740|Ga0307468_101896796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300031753|Ga0307477_10145680 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
| 3300031754|Ga0307475_10020820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4604 | Open in IMG/M |
| 3300031754|Ga0307475_10125992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2020 | Open in IMG/M |
| 3300031754|Ga0307475_10167672 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
| 3300031754|Ga0307475_10587196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
| 3300031754|Ga0307475_10951832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300031820|Ga0307473_10000063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 21068 | Open in IMG/M |
| 3300031820|Ga0307473_10030545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2339 | Open in IMG/M |
| 3300031823|Ga0307478_10419000 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300031910|Ga0306923_11519577 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300031954|Ga0306926_11379414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
| 3300031962|Ga0307479_10108435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2701 | Open in IMG/M |
| 3300031962|Ga0307479_11203107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300032008|Ga0318562_10192940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1179 | Open in IMG/M |
| 3300032180|Ga0307471_100130244 | All Organisms → cellular organisms → Bacteria | 2369 | Open in IMG/M |
| 3300032180|Ga0307471_100616254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1245 | Open in IMG/M |
| 3300032180|Ga0307471_100832381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1090 | Open in IMG/M |
| 3300032180|Ga0307471_103157563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300032205|Ga0307472_101039041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300032205|Ga0307472_102357378 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300032770|Ga0335085_10007720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 16562 | Open in IMG/M |
| 3300032770|Ga0335085_12226286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300032828|Ga0335080_10666583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1088 | Open in IMG/M |
| 3300032829|Ga0335070_10991837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300033004|Ga0335084_11579743 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300033758|Ga0314868_039498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 15.03% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 12.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.81% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.22% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.18% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.66% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.15% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.63% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.11% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.07% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.04% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.04% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.04% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.04% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.52% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.52% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.52% |
| Green-Waste Compost | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost | 0.52% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.52% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.52% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.52% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309004 | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico | Environmental | Open in IMG/M |
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005880 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026998 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF046 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033758 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| prs_05045250 | 2070309004 | Green-Waste Compost | GAMSYLYAAYAATWLIHVTYLITVFRRYSRLKKEVEQLAKK |
| MBSR1b_0462.00002190 | 2162886012 | Miscanthus Rhizosphere | MKSDAFLYAAYIATWVIHIGYLSTLVRRYSRLKQEIKELERLKR |
| INPgaii200_05926162 | 2228664022 | Soil | MNFLYAAYGATWAIHIVYLITVYLRYSRLKQDVDELRKSSR |
| INPhiseqgaiiFebDRAFT_1016450212 | 3300000364 | Soil | MNFLYAAYGATWAIHIVYLITVYLRYSRLKQDVDELRKSSR* |
| INPhiseqgaiiFebDRAFT_1054616801 | 3300000364 | Soil | MTFLYAAYAATWLIHIVYLVTLVRRYSRLKQELDEFNKKKS* |
| F14TC_1051509722 | 3300000559 | Soil | MSYLYTAYTAAWLIHITYLITIVRRYSRLKQEVDELNKKKS* |
| JGI12627J18819_100002249 | 3300001867 | Forest Soil | MTFLYAAYAATWTIHIVYLFTLARRYSRLKKEVDELSKKI* |
| JGI12627J18819_100465553 | 3300001867 | Forest Soil | MTYLYVAYAATWLIHVVYLSTVARRYSRLKKEMEQLGKK* |
| JGI12627J18819_102053502 | 3300001867 | Forest Soil | MNFLYAAYAATWTIHIVYLITVVRXYSRLKKEVDELNKKI* |
| soilH2_102995152 | 3300003324 | Sugarcane Root And Bulk Soil | MNYLYAAYTITWGIHITYLITVIRRYSRLRKEVDELKKR* |
| JGIcombinedJ51221_100446882 | 3300003505 | Forest Soil | MTYLYVAYAATWLIHVAYLSTVARRYSRLKKEMEQLGKK* |
| JGIcombinedJ51221_103651151 | 3300003505 | Forest Soil | MNFLYAAYAATWTIHIVYLITVVRRYSRLKKEVNELNKKI* |
| Ga0066398_101118512 | 3300004268 | Tropical Forest Soil | MNFLYVAYGATWAIHIVYLVTLVRRYSRLRQEVDELKKSR* |
| Ga0062595_1009410262 | 3300004479 | Soil | MKSDAFLYAAYIATWVIHIGYLSTLVRRYSRLKQEIKELERLKR* |
| Ga0066395_108488481 | 3300004633 | Tropical Forest Soil | ECAPMNFLYVAYGATWAIHIVYLVTLVRRYSRLRQEVDELKKSR* |
| Ga0066672_102845012 | 3300005167 | Soil | MSFLYAAYAATWTIHIVYLITVVRRYSRLKKEVDELNKKI* |
| Ga0066677_101634001 | 3300005171 | Soil | MSFLYAAYAATWTIHIVYLITVVRRYSHLKKEVDELNKKI* |
| Ga0066688_103406652 | 3300005178 | Soil | MSFLYAAYAATWTIHIVYLITVVRRYSHLKIEVDELNKKI* |
| Ga0066388_1000939822 | 3300005332 | Tropical Forest Soil | MNFLYVAYGATWAIHIVYLVTLVRRYSRLRREVDELKKSR* |
| Ga0066388_1001273032 | 3300005332 | Tropical Forest Soil | MSYLYIAYVATWLIHITYLVTVFRRYSRLKKEVEQLPRK* |
| Ga0066388_1009155062 | 3300005332 | Tropical Forest Soil | MTFLYAAYAATWLIHIAYLVTLVRRYSRLRQELDEFNGKEH* |
| Ga0066388_1014742662 | 3300005332 | Tropical Forest Soil | MNYLYIAYTVTWLIHIVYAGSLFLRYSRLKQEMDELNKKQG* |
| Ga0066388_1015152682 | 3300005332 | Tropical Forest Soil | MTFLYAAYAATWLIHIAYLVTLVRRYSRLRQELDEFNRKKH* |
| Ga0066388_1038095461 | 3300005332 | Tropical Forest Soil | MNFLYAAYGATWAIHIVYLVTVYQRYSKLKQEVDELKKSR* |
| Ga0070709_101192292 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTYLYTAYAATWAIHVVYLVTVVRRYSQLKKEVDELNRKKS* |
| Ga0070709_101233912 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFLYAAYGATWAIHIVYLITVFQRYSKLKREVDELNKK* |
| Ga0070709_111732782 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFLYTAYAAVWIIHVTYLVTLVRRYSRLKDEIAGLKKK* |
| Ga0070713_1000347874 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MNYLYVAYGATWTIHVIYLITVMRRYSRLKKEVDELTKKS* |
| Ga0070711_1000489451 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFLYAAYGATWAIHIVYLITVFQRYSELNREVDELNKK* |
| Ga0070711_1003858612 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFLYAAYGATWAIHIVYLITVFQRYSKLKREVDELNKT* |
| Ga0070711_1011423941 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MNYLYTAYAITWIIHITYLVTVSQRYSRLRKEIEDLRRRAK* |
| Ga0066689_103422322 | 3300005447 | Soil | PMSFLYAAYAATWTIHIVYLITVVRRYSHLKKEVDELNKKI* |
| Ga0070741_1000046896 | 3300005529 | Surface Soil | MKFLYAAFVATWLIHIGYLGTLVSRYTHLRREIDEINEINRRSS* |
| Ga0070741_100297724 | 3300005529 | Surface Soil | MNFLYAAYAATWAIHIAYLVTLGLRYARLKREIEDMGRKGR* |
| Ga0070741_100385503 | 3300005529 | Surface Soil | MNFLYAAYAVTWIIHIGYLTTLVRRYSRLKKEIKELNRSQ* |
| Ga0070731_100344865 | 3300005538 | Surface Soil | MTYLYVAYAATWLIHVAYLSTVVRRYSRLKKEMEQLGKK* |
| Ga0070732_100555902 | 3300005542 | Surface Soil | MTYLYVAYAATWAIHVGYLITLAVRYSRLKQEINDLNKK* |
| Ga0070732_102589652 | 3300005542 | Surface Soil | MNYLYAAYAATWLIHVTYLTTVFRRYSRLKKEVEELGKK* |
| Ga0070732_110110622 | 3300005542 | Surface Soil | MNFLYAAYAATWTIHIVYLITVVRRYSRLKKEVDELNKKI* |
| Ga0066661_105607112 | 3300005554 | Soil | MNYLYIAYGATWTIHVVYLITVMRRYSRLKKEVDELKKKS* |
| Ga0066704_100150905 | 3300005557 | Soil | PMSFLYAAYAATWTIHIVYLITVVRRYSRLKKEVDELNKKI* |
| Ga0066903_1002903342 | 3300005764 | Tropical Forest Soil | MSYLYIAYAATWLIHITYLVTVFRRYSRLKKEVEQLPRK* |
| Ga0066903_1015044762 | 3300005764 | Tropical Forest Soil | MNFLYTAYVATWAIHIGYLITLVRRYGRVKREIAQLKK* |
| Ga0066903_1020827101 | 3300005764 | Tropical Forest Soil | MNFLYAALAATWAIHVGYLITLVRRYSRLKAEIEELKK* |
| Ga0066903_1031177082 | 3300005764 | Tropical Forest Soil | MNYLYAAYAITWIIHITYLVTVSQRYSRLKKEIEDLQRRAK* |
| Ga0075298_10047162 | 3300005880 | Rice Paddy Soil | MNFLYVAYAATWIIHICYLTTLARRYSRLRKEIRDLQKKG* |
| Ga0075023_1000399613 | 3300006041 | Watersheds | MTYLYVAYGATWSIHIIYLVTVVQRYSRLKQEVDELNRNKKS* |
| Ga0075023_1000765832 | 3300006041 | Watersheds | MNFLYAAYGATWAIHIVYLITVARRYSRLKPEVDELKKGSR* |
| Ga0075024_1001693512 | 3300006047 | Watersheds | MNFLYAAYGATWAIHIVYLITVARRYSRLKQEVDELKKGSR* |
| Ga0075028_1001103922 | 3300006050 | Watersheds | MTFLYAAYTATWVIHISYLITVVRRYTRLKREVSELNKRKT* |
| Ga0075029_1002537712 | 3300006052 | Watersheds | MTYLFAAYTATWVIHIVYLITVVRRYSRLNRETSELKKRA* |
| Ga0075026_1008472912 | 3300006057 | Watersheds | MTYLYVAYGATWSIHIIYLVTVVQRYSRLKQEVDELNTKKS* |
| Ga0075017_10000320910 | 3300006059 | Watersheds | MTFLFAAYTATWVIHIVYLITVVRHYSRLKREVSELNRKKT* |
| Ga0075017_1001409912 | 3300006059 | Watersheds | MTFLYAAYTATWAIHITYLITVVRRYTRLKREVSELNKRKT* |
| Ga0075015_1007263452 | 3300006102 | Watersheds | MTYLYTAYAATWAIHIFYLITVVRRYSRLKRETSELKKRA* |
| Ga0075030_1001168803 | 3300006162 | Watersheds | MTYLFAAYAATWVIHIVYLITVVRRYSRLNRETSELKKRA* |
| Ga0075014_1000120964 | 3300006174 | Watersheds | MTFLYAAYAATWAIHITYLITVVRRYSRLKREVDELNQRKK* |
| Ga0070712_10000085411 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFLYAAYGATWAIHIVYLITVFQRYSELKREVDELNKK* |
| Ga0075435_1020374742 | 3300007076 | Populus Rhizosphere | MKSDAFLYAAYIATWVIHIGYLSTLVRRYSRLKQEIK |
| Ga0099793_100263443 | 3300007258 | Vadose Zone Soil | MTFLYAAYAATWAIHIIYLITIVRRYSRLKREVEELSQKKK* |
| Ga0105251_100789723 | 3300009011 | Switchgrass Rhizosphere | MKSDAFLYAAYIATWVIHIGYLSTLVRRYSRLKQEITALERLT |
| Ga0105243_115162661 | 3300009148 | Miscanthus Rhizosphere | MKSDAFLYAAYIATWAIHIGYLSTLVRRYSRLKQEIKELERLKR* |
| Ga0075423_124882022 | 3300009162 | Populus Rhizosphere | MKSDAFLYAAYIATWVIHIGYLGTLVRRYSRLKQEIKELERLKR* |
| Ga0126374_117948041 | 3300009792 | Tropical Forest Soil | MSFLYVAYGATWAIHIVYLVTLVRRYSRLKQEVDELKKSR* |
| Ga0126380_103451762 | 3300010043 | Tropical Forest Soil | MNFLYAAYGATWVIHIGYLITVVRRYSRLKQEVDELNKRR* |
| Ga0126380_105349541 | 3300010043 | Tropical Forest Soil | MTFLYAAYAATWLIHIAYLVTLVRRYSRLKQELDEFNSKKH* |
| Ga0126380_110207202 | 3300010043 | Tropical Forest Soil | MSFLYAAYGATWAIHIVYLVTLVRRYSRVRQEVDELKKGR* |
| Ga0126380_118023951 | 3300010043 | Tropical Forest Soil | MTFLYAAYAATWLIHIAYLVTLVRRYSRLRQELDEFNGKKH* |
| Ga0126384_114938812 | 3300010046 | Tropical Forest Soil | MKFLYAAYVATWAIHIGYLVTLVRRYGKVKREIDQLKK* |
| Ga0126373_101146832 | 3300010048 | Tropical Forest Soil | MSYLYAAYAATWLIHVTYLITVFRRYSRLKKEVEQLAKK* |
| Ga0126373_102368772 | 3300010048 | Tropical Forest Soil | MTYLYIAYAATWLIHVAYLSTVARRYSRLKKEMEQLGRNRK* |
| Ga0126373_116937792 | 3300010048 | Tropical Forest Soil | MNFLYAALAATWAIHVGYLITLVRRYSRLKDEIEELKR* |
| Ga0126373_118127992 | 3300010048 | Tropical Forest Soil | MTYLYVAYAATWLIHIAYLTTVVRRYSRLKKELQQLGKK* |
| Ga0126373_118701712 | 3300010048 | Tropical Forest Soil | MNFLFAALTATWVIHVGYLVTLVRRYSRLKDEIEELKK* |
| Ga0127503_109002352 | 3300010154 | Soil | FLYAAYIATWVIHIGYLSTLVRRYSRLKQEIKELERLKR* |
| Ga0126370_105711892 | 3300010358 | Tropical Forest Soil | VMNFLYAALAATWAIHVGYLITLVRRYSRLKAEIEELKK* |
| Ga0126370_109088971 | 3300010358 | Tropical Forest Soil | MNFLYAALAATWAIHVGYLITLVRRYSRLKTEIEELKK* |
| Ga0126378_102129983 | 3300010361 | Tropical Forest Soil | MNFLFAALTATWVIHVGYLVTLVRRYSRLKDEIQELKK* |
| Ga0126378_106159362 | 3300010361 | Tropical Forest Soil | MNFLYAALASTWAIHVGYLITLVRRYSRLRAEIEELKK* |
| Ga0126378_109839052 | 3300010361 | Tropical Forest Soil | MNYLYIAYTVTWLIHIVYVGSLFLRYSRLKQEMDELNKKQS* |
| Ga0126379_106060642 | 3300010366 | Tropical Forest Soil | MNYLYIAYTVTWLIHIVYAGSLFLRYSRLKQEMDELNKKQS* |
| Ga0126379_124071802 | 3300010366 | Tropical Forest Soil | MNALNYLYAAFIATWVIHIVYLTTVVRRYSRLRGELEELKRK* |
| Ga0126381_1000732013 | 3300010376 | Tropical Forest Soil | MTYLYIAYAATWLIHVAYLSTVVRRYSRLKKEMDQLGKK* |
| Ga0126381_1019361722 | 3300010376 | Tropical Forest Soil | MTYLYIAYAATWAIHVAYLITVVRRYSQLKKEVDECGKKKN* |
| Ga0126383_129312272 | 3300010398 | Tropical Forest Soil | MNFLYAAYAATWAIHIVYLLTLARRYSRLKKEVDELNKKI* |
| Ga0134121_100476161 | 3300010401 | Terrestrial Soil | LYAAYIATWVIHIGYLSTLVRRYSRLKQEIKELERLKR* |
| Ga0138513_1000478801 | 3300011000 | Soil | YIATWVIHIGYLSTLVRRYSRLKQEIKKLERLKR* |
| Ga0150983_134528032 | 3300011120 | Forest Soil | MSFLYAAYAATWTIHIVYLITVVRRYSSLKKEVDELNKKI* |
| Ga0137382_101660552 | 3300012200 | Vadose Zone Soil | MNFLYTAYAATWAIHIAYLIILVRRYSRLKQEVDELNKKTS* |
| Ga0137382_109582431 | 3300012200 | Vadose Zone Soil | YAATWAIHIAYLITLIRRYSRLQQEVDELNKKKN* |
| Ga0137382_112339221 | 3300012200 | Vadose Zone Soil | MNFLYLAYGATWTIHIVYLFTVLRSYSRLKQEVDELNKK* |
| Ga0137363_104481162 | 3300012202 | Vadose Zone Soil | MNFLYAAYAATWAIHIAYLITLVRRYSRLKQEVDELNKKKN* |
| Ga0137399_101613702 | 3300012203 | Vadose Zone Soil | MTFLFAAYAATWAIHIAYLVTLVRRYSRLKLEVDELNKKKR* |
| Ga0137372_100637513 | 3300012350 | Vadose Zone Soil | MNYLYAAYTLTWAIHIAYLITVVRRYSRLRKEVDELKKTP* |
| Ga0137397_100305053 | 3300012685 | Vadose Zone Soil | MTFLYAAYAATWAIHIAYLITLVRRYSRLKLAVDELNKRKR* |
| Ga0137397_108261291 | 3300012685 | Vadose Zone Soil | MNFLYAAYAATWAIHIAYLITLVRRYSRLKQEVDEFNKKTS* |
| Ga0137396_101255303 | 3300012918 | Vadose Zone Soil | MTFLFAAYAATWAIHIAYLVTLVRRYSRLKLEVDELNTKKR* |
| Ga0137394_100086423 | 3300012922 | Vadose Zone Soil | MNFLYAAYAVTWAIHIAYLITLVRRYSRLKQEVDELNKKKN* |
| Ga0137419_112977961 | 3300012925 | Vadose Zone Soil | RTMTFLYAAYAATWAIHIAYLVTLVRRYSRLKLEVDELNKKKR* |
| Ga0137416_100239643 | 3300012927 | Vadose Zone Soil | YAAYAATWAIHIAYLITLVRRYSRLKLAVDELNKRKR* |
| Ga0126369_112131622 | 3300012971 | Tropical Forest Soil | MNALNYLYAAFVATWVIHIVYLTTVVRRYSRLRRELEELKRK* |
| Ga0126369_118627282 | 3300012971 | Tropical Forest Soil | AMSYLYIAYVATWLIHITYLVTVFRRYSRLKKEVEQLPRK* |
| Ga0126369_119159652 | 3300012971 | Tropical Forest Soil | MNFLYAAYGATWVIHIAYLVTLVRRYSRLKQEVDELKKGR* |
| Ga0163163_104790212 | 3300014325 | Switchgrass Rhizosphere | MNYLYAAYAITWIIHITYLVTVSQRYSRLKKEIEELQRRAK* |
| Ga0132258_1000128131 | 3300015371 | Arabidopsis Rhizosphere | MTFLYAAYAATWLIHIVYLVALVRRYSRLKQELDEFNKKKS* |
| Ga0132258_109038471 | 3300015371 | Arabidopsis Rhizosphere | MTFLYAAYAATWLIHIVYLVTLIRRYSRLKEELDEF |
| Ga0132258_110507362 | 3300015371 | Arabidopsis Rhizosphere | MNFLYAAYGATWAIHILYLITLVRRYSRLKQEVDELKKK* |
| Ga0132258_120222632 | 3300015371 | Arabidopsis Rhizosphere | MNFLYAAYGATWAIHILYLFTVLRRYSRLKQEVDELNKE* |
| Ga0132258_137457521 | 3300015371 | Arabidopsis Rhizosphere | MNFLYAAYGATWAIHILYLITIVRRYSRLKQEVDELKKK* |
| Ga0132257_1013474821 | 3300015373 | Arabidopsis Rhizosphere | TAYAITWIIHITYLVTVSQRYSRLRKEIEDLRRRAK* |
| Ga0182032_100105432 | 3300016357 | Soil | MNFLYAAYTSSWVIHVGYLVTLGLRYARLKREIDDMSRKDA |
| Ga0182037_102774022 | 3300016404 | Soil | MKFLYAAYAATWTIHITYLATVVRRYSRLKKELEQLGKK |
| Ga0187824_100014452 | 3300017927 | Freshwater Sediment | MNFLYTAYAATWAIHIGYLVTVALRYRNLKREIDDMSQKDR |
| Ga0187824_100432392 | 3300017927 | Freshwater Sediment | MTYLYTAYAATWAIHVVYLVTVVRRYSQLKKEVDELNRKKS |
| Ga0187824_100670612 | 3300017927 | Freshwater Sediment | MTFLYAAYAATWAIHIGYLITVAVRYSRLKREIDDMSRKG |
| Ga0187825_102789651 | 3300017930 | Freshwater Sediment | MNFLYAAYGATWAIHILYLITVFRRYSRLKQEVDELKK |
| Ga0187821_101427041 | 3300017936 | Freshwater Sediment | MNFLYAAYGATWAIHILYLITVFRRYSRLKQEVDELKKK |
| Ga0187822_102543871 | 3300017994 | Freshwater Sediment | MNFLYAAYGATWAIHIVYLITVFQRYSKLKREVDELNKK |
| Ga0187822_102660742 | 3300017994 | Freshwater Sediment | MTFLYAAYAATWTIHIGYLITVAVRYSRLKREIDDMSRKG |
| Ga0187788_100003738 | 3300018032 | Tropical Peatland | MNFLYAAYAATWAIHIGYLITVARRYARLKREIDDMSRKDS |
| Ga0066655_108123392 | 3300018431 | Grasslands Soil | MNYLYIAYGATWTIHVVYLITVMRRYSRLKKEVDELKKKS |
| Ga0066662_101634782 | 3300018468 | Grasslands Soil | MSFLYAAYAATWTIHIVYLITVVRRYSHLKKEVDELNKKI |
| Ga0193722_11171032 | 3300019877 | Soil | MTFLYAAYGATWAIHIVYLITLALRYSRLKQEIDELNKRKN |
| Ga0210407_105924882 | 3300020579 | Soil | MTFLFAAYTLTWVIHILYLITVVRRYSRLKRELSELNRNKT |
| Ga0210407_111850791 | 3300020579 | Soil | MNFLYAAYGATWAIHIVYLITVARRYIRLKQEVDDLNKK |
| Ga0210399_100104673 | 3300020581 | Soil | MSYLYAAYAATWLIHVTYLVTVFRRYSRLKKEVQQLGKK |
| Ga0210395_100300103 | 3300020582 | Soil | MSFLYAAYAATWTIHIVYLITVVRRYSSLKKEVDELNKKI |
| Ga0210395_101693982 | 3300020582 | Soil | MTYLYVAYAATWLIHVAYLSTVARRYSRLKKEMEQLGKK |
| Ga0210401_100011194 | 3300020583 | Soil | MTYLYVAYAATWAIHVGYLITLAVRYSRLKQEINDLNKK |
| Ga0210401_100271117 | 3300020583 | Soil | MTFLFAAYAATWTIHIVYLFTLARRYSRLKKEVDELSKKI |
| Ga0210401_102741342 | 3300020583 | Soil | MNYLYAAYAATWLIHVTYLTTVFRRYSRLKKEVEELAKK |
| Ga0210404_101870021 | 3300021088 | Soil | MTFLFAAYTLTWVIHTLYLITVVRRYSRLKREVSELNRKKT |
| Ga0210404_105874262 | 3300021088 | Soil | MTFLYAAYAATWTIHIVYLFTLARRYSRLKKEVDELSKKI |
| Ga0210404_108579902 | 3300021088 | Soil | MTFLYAAYAATWTIHIIYLITIVRRYSRLKREVEEMSQRKK |
| Ga0210405_111866872 | 3300021171 | Soil | LYVAYAATWAIHVGYLITLAVRYSRLKQEINDLNKK |
| Ga0210389_110536992 | 3300021404 | Soil | MTFLYAAYAATWTIHIVYLFTLARRYSRLKIEVDELSKKI |
| Ga0210386_100253953 | 3300021406 | Soil | MTFLYAAYAATWTIHIVYLLTLARRYSRLKKEVDELSKKI |
| Ga0210384_101408824 | 3300021432 | Soil | MNYLYAAYIATWVIHIGYLWTLVGRYRHLNREMKDLNRR |
| Ga0210409_113480022 | 3300021559 | Soil | VTYLYVAYAATWAIHIAYLITVARRYSRLKQEVEEMHKKKS |
| Ga0126371_1000061922 | 3300021560 | Tropical Forest Soil | MSYLYIAYAATWLIHITYLVTVFRRYSRLKKEVEQLPRK |
| Ga0126371_100039358 | 3300021560 | Tropical Forest Soil | MSYLYAAYAATWLIHVTYLITVFRRYSRLKKEVEQLAKK |
| Ga0126371_107466042 | 3300021560 | Tropical Forest Soil | MNFLYVAYGATWAIHIVYLVTLVRRYSRLRQEVDELKKSR |
| Ga0126371_121612852 | 3300021560 | Tropical Forest Soil | MNFLYAALAATWAIHVGYLITLVRRYSRLKAEIEELKK |
| Ga0126371_122306472 | 3300021560 | Tropical Forest Soil | MTYLYIAYAATWLIHVAYLSTVVRRYSRLKKEMDQLGKK |
| Ga0179589_105798402 | 3300024288 | Vadose Zone Soil | MNFLYAAYAATWAIHIAYLITLVRRYSRLKQEVDELNKKKN |
| Ga0137417_10954142 | 3300024330 | Vadose Zone Soil | MTFLYAAYAATWAIHIIYLITIVRRYSRLKREVEELSQKKK |
| Ga0137417_13143344 | 3300024330 | Vadose Zone Soil | MTFLYAAYAATWAIHIAYLITLVRRYSRLKLAVDELNKRKR |
| Ga0207699_110624782 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFLYAAYGATWAIHIVYLITVFQRYSELKREVDELNK |
| Ga0207700_118545541 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFLYAAYAATWTIHIVYLITVVRRYSRLKREVDEL |
| Ga0207709_108144671 | 3300025935 | Miscanthus Rhizosphere | MKSDAFLYAAYIATWAIHIGYLSTLVRRYSRLKQEIKELERLKR |
| Ga0209438_12315512 | 3300026285 | Grasslands Soil | MNFLYAAYAATWAIHIAYLITLVRRYSRLKQEVDEFNKKTS |
| Ga0208369_10121281 | 3300026998 | Forest Soil | MNFLYAAYAATWTIHIVYLITVVRRYSRLKKEVNELNKKI |
| Ga0209004_10346122 | 3300027376 | Forest Soil | ERCPMTFLYAAYAATWTIHIVYLFTLARRYSRLKKEVDELSKKI |
| Ga0209735_10667042 | 3300027562 | Forest Soil | MTFLYAAYGATWAIHIAYLITVARRYSRLKQEIDELNKKKTKPL |
| Ga0209076_10690132 | 3300027643 | Vadose Zone Soil | AYAATWAIHIIYLITIVRRYSRLKREVEELSQKKK |
| Ga0209579_100284594 | 3300027869 | Surface Soil | MTYLYVAYAATWLIHVAYLSTVVRRYSRLKKEMEQLGKK |
| Ga0209583_100639382 | 3300027910 | Watersheds | MNFLYAAYGATWAIHIVYLITVARRYSRLKQEVDELKKGSR |
| Ga0209698_101374373 | 3300027911 | Watersheds | MTYLFAAYAATWVIHIVYLITVVRRYSRLNRETSELKKRA |
| Ga0307497_102051711 | 3300031226 | Soil | MNFLYAAYAATWAIHIAYLITLVRRYSRLKQEVDEFNKKTN |
| Ga0318541_100420563 | 3300031545 | Soil | MNFLYAAYTATWVIHVGYLVTLGLRYARLKREIDDMSRKDA |
| Ga0307476_100186222 | 3300031715 | Hardwood Forest Soil | MTYLYVAYAATWLIHVAYLSTVVRRYSRLKKEMEQLGNK |
| Ga0307476_101033592 | 3300031715 | Hardwood Forest Soil | MTYLYVAYAATWAIHVGYLIILAVRYSRLKQEINDLNKK |
| Ga0307469_1000015718 | 3300031720 | Hardwood Forest Soil | MNFLYAAYGATWAIHIVYLITVARRYSRLKQEIDELNRK |
| Ga0307469_100224164 | 3300031720 | Hardwood Forest Soil | MTFLYAAYAATWAIHIAYLITLVRRYSRLKQEVDELNKKKS |
| Ga0307469_100612574 | 3300031720 | Hardwood Forest Soil | MTFLYAAYTLTWVIHILYLITVVRRYSRLKREVSELIRKKT |
| Ga0307469_101039792 | 3300031720 | Hardwood Forest Soil | MNYLYAAYAATWLIHVTYLVTVFRRYSRLKKEVDGLGKR |
| Ga0307468_1018967962 | 3300031740 | Hardwood Forest Soil | MNFLYAAYGATWAIHIVYLITVYLRYSRLKQEVDELRKSSQ |
| Ga0307477_101456803 | 3300031753 | Hardwood Forest Soil | MTFLYTAYAATWAIHITYLITVVRRYSRVKREASQLKKRA |
| Ga0307475_100208203 | 3300031754 | Hardwood Forest Soil | VTYLYVAYAATWAIHIAYLITVVRRYSRLKQEVEQMHKK |
| Ga0307475_101259921 | 3300031754 | Hardwood Forest Soil | MNFLYAAYAATWTIHIVYLITVVRRYSRLKKEVDE |
| Ga0307475_101676722 | 3300031754 | Hardwood Forest Soil | MTFLYTAYAATWAIHIAYLITVVRRYSRVKRETSQLKKRA |
| Ga0307475_105871961 | 3300031754 | Hardwood Forest Soil | MTFLYTAYAATWAIHIAYLITVVRRYSRVKREASQLKKRA |
| Ga0307475_109518321 | 3300031754 | Hardwood Forest Soil | MTFLYAAYAATWTIHIVYLFTLARRYSRLKKEVDDLSKKI |
| Ga0307473_1000006311 | 3300031820 | Hardwood Forest Soil | MNFLYAAYAATWTIHIVYLITVVRRYSHLKKEVDELNKKI |
| Ga0307473_100305452 | 3300031820 | Hardwood Forest Soil | MSFLYAAYAATWAIHIAYLITLVRRYSRLKQEVDELNKKKS |
| Ga0307478_104190002 | 3300031823 | Hardwood Forest Soil | MTFLYAAYTATWAIHIAYLITVVRRYSRVKREASQLGKSA |
| Ga0306923_115195772 | 3300031910 | Soil | MTFLYAAYAATWMIHVGYLITLVRRYSRLKSEIEELKGK |
| Ga0306926_113794142 | 3300031954 | Soil | MNFLYAAYAATWTIHIVYLITVVRRYSRLKKEVDDPNKKI |
| Ga0307479_101084354 | 3300031962 | Hardwood Forest Soil | VTYLYVAYAATWAIHIAYLITVVRRYSRLKQEVEQMHKKKS |
| Ga0307479_112031071 | 3300031962 | Hardwood Forest Soil | MTFLYVAYATTWVIHITYLVTLVRRYSRLKQEIDELNQKS |
| Ga0318562_101929401 | 3300032008 | Soil | MNFLYAAYTATWVIHVGYLVTLGLRYARLKREIDDMSR |
| Ga0307471_1001302442 | 3300032180 | Hardwood Forest Soil | MNFLYAAYGATWAIHIVYLITVARRYSRLKQEIDELNRKSE |
| Ga0307471_1006162542 | 3300032180 | Hardwood Forest Soil | MNFLYAAYAATWAIHIAYLITLVRRYSRLKQEVDEFNKKKS |
| Ga0307471_1008323813 | 3300032180 | Hardwood Forest Soil | MTFLYTAYAATWAIHIAYLITVVRRYSRVKREASQL |
| Ga0307471_1031575632 | 3300032180 | Hardwood Forest Soil | MTFLYAAYAATWTIHIVYLFNLARRYSRLKKEVDELSKKI |
| Ga0307472_1010390411 | 3300032205 | Hardwood Forest Soil | MNFLYAAYGATWAIHIVYLITVARRYIRLKQEVDELNKK |
| Ga0307472_1023573781 | 3300032205 | Hardwood Forest Soil | RKMNFLYAAYAATWAIHIAYLITLVRRYSRLKQEVDEFNKKKS |
| Ga0335085_1000772014 | 3300032770 | Soil | MNFLYLAYGATWAIHIAYLVVLTSRAARLKKEVDDLKKD |
| Ga0335085_122262862 | 3300032770 | Soil | MTYLYAAYAATWIIHIVYLSTLVRRYSRLKKEIEELKK |
| Ga0335080_106665832 | 3300032828 | Soil | MNFLYTAYAATWAIHIGYLITLVRRYGRVKREIEQLKK |
| Ga0335070_109918371 | 3300032829 | Soil | MNFLYAAYAATWAIHIGYLITVARRYARLKREIADMG |
| Ga0335084_115797432 | 3300033004 | Soil | MNFLYAAYVATWAIHIGYLITLVRRYGRLKREIAQLKK |
| Ga0314868_039498_2_106 | 3300033758 | Peatland | MNFLYAAYAATWAIHIGYLITVARRYARLKREIDD |
| ⦗Top⦘ |