| Basic Information | |
|---|---|
| Family ID | F027943 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 193 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MGLIIITVLVRILETMFVVGAIGSVVVLVLSGIEDLKLLFGREEQNHS |
| Number of Associated Samples | 150 |
| Number of Associated Scaffolds | 193 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 8.24 % |
| % of genes near scaffold ends (potentially truncated) | 12.95 % |
| % of genes from short scaffolds (< 2000 bps) | 68.39 % |
| Associated GOLD sequencing projects | 134 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.420 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.990 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.943 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.850 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.89% β-sheet: 0.00% Coil/Unstructured: 42.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 193 Family Scaffolds |
|---|---|---|
| PF13520 | AA_permease_2 | 59.07 |
| PF00795 | CN_hydrolase | 4.66 |
| PF03462 | PCRF | 3.63 |
| PF00196 | GerE | 1.55 |
| PF04366 | Ysc84 | 1.04 |
| PF10110 | GPDPase_memb | 0.52 |
| PF13185 | GAF_2 | 0.52 |
| PF06751 | EutB | 0.52 |
| PF01883 | FeS_assembly_P | 0.52 |
| PF13380 | CoA_binding_2 | 0.52 |
| PF00512 | HisKA | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 193 Family Scaffolds |
|---|---|---|---|
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 3.63 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 3.63 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 1.04 |
| COG4303 | Ethanolamine ammonia-lyase, large subunit | Amino acid transport and metabolism [E] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.42 % |
| Unclassified | root | N/A | 16.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001471|JGI12712J15308_10074337 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300001593|JGI12635J15846_10272819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1073 | Open in IMG/M |
| 3300001593|JGI12635J15846_10389740 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300002906|JGI25614J43888_10027030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1820 | Open in IMG/M |
| 3300002914|JGI25617J43924_10011475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2906 | Open in IMG/M |
| 3300002914|JGI25617J43924_10283601 | Not Available | 567 | Open in IMG/M |
| 3300002917|JGI25616J43925_10118950 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10106157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1120 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10201337 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300004080|Ga0062385_10128209 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300004082|Ga0062384_100062810 | All Organisms → cellular organisms → Bacteria | 1851 | Open in IMG/M |
| 3300004091|Ga0062387_100026869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2478 | Open in IMG/M |
| 3300004092|Ga0062389_100016023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5103 | Open in IMG/M |
| 3300004092|Ga0062389_100553235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1307 | Open in IMG/M |
| 3300004635|Ga0062388_100084450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2218 | Open in IMG/M |
| 3300005176|Ga0066679_10131081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1553 | Open in IMG/M |
| 3300005332|Ga0066388_100152713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2890 | Open in IMG/M |
| 3300005445|Ga0070708_100063435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3308 | Open in IMG/M |
| 3300005445|Ga0070708_100708903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 947 | Open in IMG/M |
| 3300005467|Ga0070706_101805075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 556 | Open in IMG/M |
| 3300005468|Ga0070707_100493957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1185 | Open in IMG/M |
| 3300005471|Ga0070698_100208875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1888 | Open in IMG/M |
| 3300005536|Ga0070697_100490014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1074 | Open in IMG/M |
| 3300005591|Ga0070761_10034946 | All Organisms → cellular organisms → Bacteria | 2812 | Open in IMG/M |
| 3300005602|Ga0070762_10114772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1576 | Open in IMG/M |
| 3300005602|Ga0070762_10317305 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300005602|Ga0070762_11171827 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005602|Ga0070762_11257770 | Not Available | 513 | Open in IMG/M |
| 3300005610|Ga0070763_10286720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 902 | Open in IMG/M |
| 3300005921|Ga0070766_10683326 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300005938|Ga0066795_10015923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2099 | Open in IMG/M |
| 3300005938|Ga0066795_10156353 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300006050|Ga0075028_100092941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1527 | Open in IMG/M |
| 3300006055|Ga0097691_1039031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1761 | Open in IMG/M |
| 3300006055|Ga0097691_1180676 | Not Available | 549 | Open in IMG/M |
| 3300006059|Ga0075017_100747164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 754 | Open in IMG/M |
| 3300006059|Ga0075017_101006119 | Not Available | 649 | Open in IMG/M |
| 3300006102|Ga0075015_100746356 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300006162|Ga0075030_101192935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 598 | Open in IMG/M |
| 3300006174|Ga0075014_100288316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 861 | Open in IMG/M |
| 3300006176|Ga0070765_101115983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 745 | Open in IMG/M |
| 3300006354|Ga0075021_10050964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2393 | Open in IMG/M |
| 3300006642|Ga0075521_10246969 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300006642|Ga0075521_10302440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 770 | Open in IMG/M |
| 3300006800|Ga0066660_10061622 | All Organisms → cellular organisms → Bacteria | 2503 | Open in IMG/M |
| 3300006893|Ga0073928_10000900 | All Organisms → cellular organisms → Bacteria | 61807 | Open in IMG/M |
| 3300006893|Ga0073928_10008028 | All Organisms → cellular organisms → Bacteria | 13404 | Open in IMG/M |
| 3300006893|Ga0073928_10076304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2887 | Open in IMG/M |
| 3300007265|Ga0099794_10566733 | Not Available | 600 | Open in IMG/M |
| 3300007788|Ga0099795_10332864 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300009038|Ga0099829_10120056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2068 | Open in IMG/M |
| 3300009038|Ga0099829_10921002 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300009090|Ga0099827_10963882 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300010858|Ga0126345_1192823 | Not Available | 534 | Open in IMG/M |
| 3300011120|Ga0150983_14433198 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300011269|Ga0137392_10433804 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300012096|Ga0137389_10489480 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300012199|Ga0137383_10920421 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300012202|Ga0137363_10171610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1720 | Open in IMG/M |
| 3300012202|Ga0137363_10508405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1012 | Open in IMG/M |
| 3300012202|Ga0137363_10950582 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300012205|Ga0137362_10391648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1203 | Open in IMG/M |
| 3300012205|Ga0137362_11467261 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300012208|Ga0137376_10333597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1317 | Open in IMG/M |
| 3300012211|Ga0137377_10115651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2552 | Open in IMG/M |
| 3300012350|Ga0137372_10005633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 12224 | Open in IMG/M |
| 3300012361|Ga0137360_10599280 | Not Available | 943 | Open in IMG/M |
| 3300012362|Ga0137361_10060042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3176 | Open in IMG/M |
| 3300012363|Ga0137390_11616243 | Not Available | 585 | Open in IMG/M |
| 3300012683|Ga0137398_10078900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2026 | Open in IMG/M |
| 3300012685|Ga0137397_10166094 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
| 3300012927|Ga0137416_11102852 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300012929|Ga0137404_11474538 | Not Available | 629 | Open in IMG/M |
| 3300014489|Ga0182018_10011255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6376 | Open in IMG/M |
| 3300014490|Ga0182010_10643876 | Not Available | 594 | Open in IMG/M |
| 3300014501|Ga0182024_10007570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 23363 | Open in IMG/M |
| 3300014502|Ga0182021_10069409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4094 | Open in IMG/M |
| 3300015193|Ga0167668_1000511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7316 | Open in IMG/M |
| 3300015193|Ga0167668_1039547 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300015193|Ga0167668_1044138 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300019887|Ga0193729_1027713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2412 | Open in IMG/M |
| 3300020579|Ga0210407_10013284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6129 | Open in IMG/M |
| 3300020579|Ga0210407_10096231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2245 | Open in IMG/M |
| 3300020580|Ga0210403_10002689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 15909 | Open in IMG/M |
| 3300020582|Ga0210395_10028020 | All Organisms → cellular organisms → Bacteria | 4131 | Open in IMG/M |
| 3300020582|Ga0210395_10059914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2792 | Open in IMG/M |
| 3300020583|Ga0210401_10354286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1329 | Open in IMG/M |
| 3300020583|Ga0210401_10442088 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300020583|Ga0210401_11223848 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300021168|Ga0210406_10889051 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300021170|Ga0210400_10001297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 24963 | Open in IMG/M |
| 3300021171|Ga0210405_10074928 | All Organisms → cellular organisms → Bacteria | 2667 | Open in IMG/M |
| 3300021181|Ga0210388_10024496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4916 | Open in IMG/M |
| 3300021181|Ga0210388_11553607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300021401|Ga0210393_11631262 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300021402|Ga0210385_10000021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 252372 | Open in IMG/M |
| 3300021407|Ga0210383_10624540 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300021420|Ga0210394_11327316 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300021478|Ga0210402_10059340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3361 | Open in IMG/M |
| 3300021559|Ga0210409_10922356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 747 | Open in IMG/M |
| 3300022521|Ga0224541_1001809 | All Organisms → cellular organisms → Bacteria | 2140 | Open in IMG/M |
| 3300022557|Ga0212123_10000493 | All Organisms → cellular organisms → Bacteria | 129017 | Open in IMG/M |
| 3300022557|Ga0212123_10005380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 22815 | Open in IMG/M |
| 3300022557|Ga0212123_10029266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5737 | Open in IMG/M |
| 3300023259|Ga0224551_1000154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9041 | Open in IMG/M |
| 3300024227|Ga0228598_1023321 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
| 3300025457|Ga0208850_1026105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1021 | Open in IMG/M |
| 3300025579|Ga0207927_1046985 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300025878|Ga0209584_10128168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 948 | Open in IMG/M |
| 3300025910|Ga0207684_10386374 | Not Available | 1204 | Open in IMG/M |
| 3300025922|Ga0207646_10593107 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300025922|Ga0207646_10745082 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300026223|Ga0209840_1018517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1597 | Open in IMG/M |
| 3300026304|Ga0209240_1037885 | All Organisms → cellular organisms → Bacteria | 1832 | Open in IMG/M |
| 3300026318|Ga0209471_1052657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1883 | Open in IMG/M |
| 3300026351|Ga0257170_1054418 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300026354|Ga0257180_1004435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1475 | Open in IMG/M |
| 3300026358|Ga0257166_1051218 | Not Available | 588 | Open in IMG/M |
| 3300026360|Ga0257173_1060613 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300026371|Ga0257179_1021856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 745 | Open in IMG/M |
| 3300026376|Ga0257167_1046933 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300026480|Ga0257177_1017688 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300026482|Ga0257172_1002542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2447 | Open in IMG/M |
| 3300026551|Ga0209648_10065178 | All Organisms → cellular organisms → Bacteria | 3079 | Open in IMG/M |
| 3300026551|Ga0209648_10568457 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300026557|Ga0179587_10043866 | All Organisms → cellular organisms → Bacteria | 2546 | Open in IMG/M |
| 3300027381|Ga0208983_1082660 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300027535|Ga0209734_1001386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4027 | Open in IMG/M |
| 3300027535|Ga0209734_1083721 | Not Available | 610 | Open in IMG/M |
| 3300027546|Ga0208984_1122627 | Not Available | 560 | Open in IMG/M |
| 3300027575|Ga0209525_1006282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2755 | Open in IMG/M |
| 3300027587|Ga0209220_1132524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 648 | Open in IMG/M |
| 3300027643|Ga0209076_1020783 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
| 3300027660|Ga0209736_1021806 | Not Available | 1958 | Open in IMG/M |
| 3300027667|Ga0209009_1156241 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300027669|Ga0208981_1115164 | Not Available | 686 | Open in IMG/M |
| 3300027729|Ga0209248_10141929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 717 | Open in IMG/M |
| 3300027745|Ga0209908_10008480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1660 | Open in IMG/M |
| 3300027783|Ga0209448_10178876 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300027795|Ga0209139_10027986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2005 | Open in IMG/M |
| 3300027853|Ga0209274_10191005 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300027853|Ga0209274_10219886 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300027889|Ga0209380_10488265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300027894|Ga0209068_10008779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4773 | Open in IMG/M |
| 3300027894|Ga0209068_10081694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1683 | Open in IMG/M |
| 3300027902|Ga0209048_10242128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1290 | Open in IMG/M |
| 3300027908|Ga0209006_10014702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7083 | Open in IMG/M |
| 3300027911|Ga0209698_11137570 | Not Available | 577 | Open in IMG/M |
| 3300028558|Ga0265326_10030185 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
| 3300028639|Ga0302168_1045838 | Not Available | 658 | Open in IMG/M |
| 3300028646|Ga0302159_10109153 | Not Available | 625 | Open in IMG/M |
| 3300028770|Ga0302258_1053163 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300028800|Ga0265338_10247821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1316 | Open in IMG/M |
| 3300028906|Ga0308309_10440107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1122 | Open in IMG/M |
| 3300029990|Ga0311336_10060937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2933 | Open in IMG/M |
| 3300030042|Ga0302300_1042803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1509 | Open in IMG/M |
| 3300030509|Ga0302183_10103084 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300030618|Ga0311354_11947207 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300030677|Ga0302317_10276983 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300031128|Ga0170823_12469348 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300031231|Ga0170824_102199183 | Not Available | 580 | Open in IMG/M |
| 3300031708|Ga0310686_104981728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3647 | Open in IMG/M |
| 3300031708|Ga0310686_116681165 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
| 3300031711|Ga0265314_10424216 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300031715|Ga0307476_10186657 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
| 3300031720|Ga0307469_10494794 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300031754|Ga0307475_10290595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1311 | Open in IMG/M |
| 3300031754|Ga0307475_10461655 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300031754|Ga0307475_10974283 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300031823|Ga0307478_11251367 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300031962|Ga0307479_10499991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1199 | Open in IMG/M |
| 3300032205|Ga0307472_100145946 | All Organisms → cellular organisms → Bacteria | 1719 | Open in IMG/M |
| 3300032205|Ga0307472_101866692 | Not Available | 598 | Open in IMG/M |
| 3300032829|Ga0335070_10009837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11192 | Open in IMG/M |
| 3300032829|Ga0335070_10165472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2234 | Open in IMG/M |
| 3300033433|Ga0326726_10285427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1545 | Open in IMG/M |
| 3300033433|Ga0326726_10309094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1484 | Open in IMG/M |
| 3300033433|Ga0326726_10695060 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300033433|Ga0326726_11326329 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300033486|Ga0316624_11155143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 703 | Open in IMG/M |
| 3300033545|Ga0316214_1013314 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300034125|Ga0370484_0053657 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.99% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.81% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.22% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.22% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.18% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.18% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.66% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.63% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 3.11% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.07% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.07% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.07% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.55% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.55% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.55% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.55% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.04% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.04% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.52% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.52% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.52% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.52% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.52% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.52% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.52% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.52% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
| 3300005896 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025579 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025998 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 (SPAdes) | Environmental | Open in IMG/M |
| 3300026223 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
| 3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
| 3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Host-Associated | Open in IMG/M |
| 3300028639 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_2 | Environmental | Open in IMG/M |
| 3300028646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_2 | Environmental | Open in IMG/M |
| 3300028770 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_4 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030042 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Host-Associated | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12712J15308_100743372 | 3300001471 | Forest Soil | MGMLLVIVFVRILESMFVVGAIGSFVVLVLSGIEDLQLLFGREEKNS* |
| JGI12635J15846_102728192 | 3300001593 | Forest Soil | MDLIIILVLVRILEGMLVVGAIGSVVVLLLSGIEDLKLLFGREERNYS* |
| JGI12635J15846_103897401 | 3300001593 | Forest Soil | MGLTIVTVLVRILEAMFVAGAIGSVVVLVLSGIEDLKLLFGREEQN |
| JGI25614J43888_100270302 | 3300002906 | Grasslands Soil | MGPIIITVLVRILETTLAIGAMGSVVVLVLSGIEDLQLLFGREEQNHS* |
| JGI25617J43924_100114752 | 3300002914 | Grasslands Soil | MGLIVTALVRVLEGMFVVGAIGSVVVLVLSGIEDLKLLLGREEENHS* |
| JGI25617J43924_102836011 | 3300002914 | Grasslands Soil | MGLIIVTVLARILETMFVAGAIGSVVVLVLSGIEDLKLLFGREEQNHS* |
| JGI25616J43925_101189501 | 3300002917 | Grasslands Soil | MGLIIITVLVRILETMLVIGAMGSVVVLALSGIEDLQLLFGREEQNHS* |
| JGIcombinedJ51221_101061572 | 3300003505 | Forest Soil | MGLLIVTAAVRILETMFVVGAIGSAVVLVLSGIEDLKLLLGLEEENRS* |
| JGIcombinedJ51221_102013372 | 3300003505 | Forest Soil | MGHLIVTXLVXILESMFVVGAIGSVVVLVLSGIEDLKLLFGMEEENHS* |
| Ga0062385_101282091 | 3300004080 | Bog Forest Soil | MGLIIVTVLVRILEGMFVIGGIGSAVVLVLSGIEDLQLLFGREEKNS* |
| Ga0062384_1000628102 | 3300004082 | Bog Forest Soil | MGFIFVVVLVRILEGMFVVGSIGSALVLVLSGIEDLKLLLGLEDENHS* |
| Ga0062387_1000268692 | 3300004091 | Bog Forest Soil | MGLFFITILVRFLEGLFVVGGIGSVFVLVLSGIEDLKTLFGGEDDHF* |
| Ga0062389_1000160232 | 3300004092 | Bog Forest Soil | MTLIIVTIIVRLLEGMFAVGTIGSVVVLVLTGIEDLKLLFGREEENHS* |
| Ga0062389_1005532352 | 3300004092 | Bog Forest Soil | MGLLIVTVVVRILESMFVVGAIGSVVVLVLSGIEDLKLLLGLEEENHS* |
| Ga0062388_1000844502 | 3300004635 | Bog Forest Soil | MGFVLVTVLARILEGMFVVGAAGSAVVLVLSGIEDLKLLLGLEEENHS* |
| Ga0066679_101310812 | 3300005176 | Soil | MGLPIITVLVRILETMLVVGTIGSIVVLVLSGIEDLKLLFGREEQNYS* |
| Ga0066388_1001527131 | 3300005332 | Tropical Forest Soil | MGPVVTLLVRILEGMFVVGWAGTILVLLLSGIEDLKTLLGKGDESHS* |
| Ga0070708_1000634352 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MVPIIVTVLVRILEAMFAVGAIGSVVVLVLSGIEDLKLLFGREEQNHS* |
| Ga0070708_1007089032 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFIVTALVRILEGMFVLGAMGSVLVLVLSGIEDLKLLFGREEEGHS* |
| Ga0070706_1018050751 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLIIVTVLVRILEAMFAVGAIGSVVVLLLSGIEDLKLLFGREEQNHS* |
| Ga0070707_1004939572 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLIIVTVLVRMLETMFVVGAIGSVVVLVLSGIEDLKLLFGREEQNHS* |
| Ga0070698_1002088752 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLIVVTVLVRILEAMFVVGAIGSVVVLLLSGIEDLKLLFGREEQNHS* |
| Ga0070697_1004900142 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLIVTALVRILEGMFVLGAMGSVLVLVLSGIEDLKLLFGREEEGHS* |
| Ga0070761_100349462 | 3300005591 | Soil | MGLLIVTVLVRILEGMFVIGAIGSAVVIVLTGIEDLKMLLGREEQNHS* |
| Ga0070762_101147722 | 3300005602 | Soil | MGHLIVTILVRILESMFVVGAIGSVVVLVLSGIEDLKLLFGMEEENHS* |
| Ga0070762_103173052 | 3300005602 | Soil | MGLLIVTVLVRILEGMFVVGAIGSTVVLVLSGIEDLKLLLGMEDENHS* |
| Ga0070762_111718272 | 3300005602 | Soil | MGLLIITALVRILEGMFVVGSIGSVVVLVLSGIEDLKLLFGREE |
| Ga0070762_112577701 | 3300005602 | Soil | MGLIIVTVLVRILEAMFVAGAIGSVVVLVLSGIEDLKLLFGREEQNHS* |
| Ga0070763_102867202 | 3300005610 | Soil | MGHLIVTFLVRILESMFVVGAIGSVVVLVLSGIEDLKLLFGMEEENHS* |
| Ga0075283_10569191 | 3300005891 | Rice Paddy Soil | ILEGMFVIGSIGSFLVLVLSGIEDIGTLFGSDELEH* |
| Ga0075282_10697061 | 3300005896 | Rice Paddy Soil | HILEGMFVIGSIGSFLVLVLSGIEDIGTLFGSDELEH* |
| Ga0070766_106833262 | 3300005921 | Soil | MGLIIVTVLVRILETMFVAGASGSVVVLVLSGIEDLKLLFGREEQNHS* |
| Ga0066795_100159232 | 3300005938 | Soil | MGLIIITVLVRVLEGMFVVGAIGSFVVIVLSGIEDLKMLLGREGENHS* |
| Ga0066795_101563532 | 3300005938 | Soil | MGLKIITVLVRVLEGMFVVGAIGSFVVIVLSGIEDLKMLLGREEENHS* |
| Ga0075028_1000929412 | 3300006050 | Watersheds | MGWVVTALIRILEGMFVVGALGSTVVLVLSGIEDLKTLFGGEEEPHS* |
| Ga0097691_10390312 | 3300006055 | Arctic Peat Soil | MGLIIITVLVRFLEGMFVVGAIGSFVVLVLSGIEDLKMLLGREEENHS* |
| Ga0097691_11806761 | 3300006055 | Arctic Peat Soil | VLVRILECMFVVGSIGSFVVLVLSGIEDLKMLLGREEEENHS* |
| Ga0075017_1003680942 | 3300006059 | Watersheds | MSLVITLVARLLETMFVIGSIGSFAVLVLSGIEDLKMLLGREESEHS* |
| Ga0075017_1007471642 | 3300006059 | Watersheds | MDLIIVTVLVRILEGMFVIGVIGSAVVILLTGIEDLKMLLGREEQHHS* |
| Ga0075017_1010061191 | 3300006059 | Watersheds | MGEIVVTVLVRILEGMFLLGIIGSFVVIVLTGIEDLRMLLGREEQNHS* |
| Ga0075015_1004986332 | 3300006102 | Watersheds | MSLVITLVARLLETMFVIGSIGSVAVLVLSGIEDLKTLLGREES |
| Ga0075015_1007463562 | 3300006102 | Watersheds | MPLIVTLVVRLLESMFVVGSIGSVAVLVLSGIEDLKTLLGREESEHS* |
| Ga0075030_1011929351 | 3300006162 | Watersheds | VTVVVRILEGMFLVGIVGSFVVIVLTGIEDLRMLLGREEQNHS* |
| Ga0075014_1002883161 | 3300006174 | Watersheds | MGLMIVTVLVRILEGMFVIGVIGSAVVILLTGIEDLKMLLGREEQHHS* |
| Ga0070765_1011159832 | 3300006176 | Soil | MSLIVVVLVRILEGMFVVGAIGSTVVLVLSGIEDLKLLFGREEKNS* |
| Ga0075021_100509642 | 3300006354 | Watersheds | MSLTITTVIARFLEGLFVIGSLGSFVVLVLTGIEDLKMLLGREEENNS* |
| Ga0075521_102469692 | 3300006642 | Arctic Peat Soil | MGLKIVTVLVRFLEGMFVVGAIGSFVVLVLSGIEDLKMLLGREEEENHS* |
| Ga0075521_103024402 | 3300006642 | Arctic Peat Soil | MGLMIVTILVRILEAMFFVGALGSVVVLVLSGIEDLKTLVGGEEEHHS* |
| Ga0066660_100616222 | 3300006800 | Soil | MGLIIITLLVRVLETMLVVGTIGSIVVLVLSGIEDLKLLFGREEQNYS* |
| Ga0073928_100009003 | 3300006893 | Iron-Sulfur Acid Spring | MGLIIVTVLVRILETMFVAGAIGSVVVLVLSGIEDLKLLFGREGQNHS* |
| Ga0073928_100080283 | 3300006893 | Iron-Sulfur Acid Spring | MGLLIITVLVRILEGMFVVGAIGSVVVIVLTGIEDLKMLLGWEEENHS* |
| Ga0073928_100763043 | 3300006893 | Iron-Sulfur Acid Spring | MGLIIITLLVRILETMLVVGAIGSVVVLVLSGIEDLKLLFGREEQNYS* |
| Ga0099794_105667331 | 3300007265 | Vadose Zone Soil | MGLIITVLVRILETMLVIGTIGSIIVLVLSGIEDLKLLFGREEQNYS* |
| Ga0099795_103328642 | 3300007788 | Vadose Zone Soil | MGLIIITLLVRVLETTLVVGTIGSIVVLVLSGIEDLKLLFGREEQNHS* |
| Ga0099829_101200562 | 3300009038 | Vadose Zone Soil | MGFIVTALVRILEGMFVLGAMGSVLVLVLSGIEDLKLLFGREEENHS* |
| Ga0099829_109210022 | 3300009038 | Vadose Zone Soil | VRILEGMFVLGAMGSVLVLVLSGIEDLKLLFGREEEGHS* |
| Ga0099827_109638822 | 3300009090 | Vadose Zone Soil | MGLIIITVLVRILETMLVVGTIGSIVVLELSGIEDLKLLFGREEQNYS* |
| Ga0126345_11928232 | 3300010858 | Boreal Forest Soil | IIVTVLVRILEGMFVIGAIGSVVVLVLSGIEDLKLLFGREEQNHS* |
| Ga0150983_144331982 | 3300011120 | Forest Soil | LIVTAAVRILETMFVVGAIGSAVVLVLSGIEDLKLLLGLEEENRS* |
| Ga0137392_104338042 | 3300011269 | Vadose Zone Soil | MGLIIVTVLVRILEAMFVVGAIGSVIVLVLSGIEDLKLLFGREEQNHS* |
| Ga0137389_104894802 | 3300012096 | Vadose Zone Soil | LLMGFIVTALVRILEGMFVLGAMGSVLVLVLSGIEDLKLLFGREEENHS* |
| Ga0137383_109204211 | 3300012199 | Vadose Zone Soil | MGLIIITVLVRILETMPVVGTIGSMVVLVLSGIEDLKLLFGREEQNYF* |
| Ga0137363_101716102 | 3300012202 | Vadose Zone Soil | MGLIITVLVRILETMLVIGTIGSIIVLVLSGIEDLKLLLGREEQNYS* |
| Ga0137363_105084052 | 3300012202 | Vadose Zone Soil | MGLIVTPLVRVLEGIFVVAAIGSVVVLVLSGIEELKLLLGREEENHS* |
| Ga0137363_109505822 | 3300012202 | Vadose Zone Soil | MGFIVTALVRILEGMFVLVAMGSVLVLVLSGIEDLKLLFGREEQNYS* |
| Ga0137362_103916482 | 3300012205 | Vadose Zone Soil | MGLIVTALVRILEGMFVLGAMGSVLVLVLSGIEDLKLLFGREEENHS* |
| Ga0137362_114672612 | 3300012205 | Vadose Zone Soil | MGLIVTPLVRVLEGIFVVGAIGSVVVLVLSGIEDLKLLLGREEENHS* |
| Ga0137376_103335972 | 3300012208 | Vadose Zone Soil | MGLIIITVLVRILETMLVVGTIGSTVVLVLSGIEDLKLLFGREEQNYS* |
| Ga0137377_101156512 | 3300012211 | Vadose Zone Soil | MGLIIITLLVRVLETMLVVGTIGSMVVLVLSGIEDLKLLFGREEQNYS* |
| Ga0137372_100056335 | 3300012350 | Vadose Zone Soil | MSLAVILVVRLLESMFVIGSIGSVAVLVLSGIEDLKTLFGREESEHS* |
| Ga0137360_105992802 | 3300012361 | Vadose Zone Soil | MGLIIITMLVRILETMLVVGTIGSIVVLVLSGIEDLKLLFGREEQNYS* |
| Ga0137361_100600421 | 3300012362 | Vadose Zone Soil | MGLIVTPLVRVLEGVFVVGAIGSVVVLVLSGIEDLKLLLGREEENHS* |
| Ga0137390_116162432 | 3300012363 | Vadose Zone Soil | MGLIVTALVRVLEGMFVVGAIGSVVVLVLSGIEDLKLLLGREEENDS* |
| Ga0137398_100789002 | 3300012683 | Vadose Zone Soil | MGLPIITVLVRILETILVVGATGSVVVLVLSGIEDLKLLFGREEQNYS* |
| Ga0137397_101660942 | 3300012685 | Vadose Zone Soil | MGLIIITVLVRILETMLVVGTIGSAVVLVLSGIEDLKLLFGREEQNYS* |
| Ga0137416_111028521 | 3300012927 | Vadose Zone Soil | MGLIIITVLVRILETMLVVGTIGSMVVLVLSGIEDLKLL |
| Ga0137404_114745382 | 3300012929 | Vadose Zone Soil | MLMGLILVTVIVRLLEGVFAVGVVGSFVVLVLSGIEDLKTLFGREELNHS* |
| Ga0182018_100112554 | 3300014489 | Palsa | MGLIVITVLVRILEGMFVVGTIGSVVVLVLSGIEDFKMLFGREEEDHS* |
| Ga0182010_106438762 | 3300014490 | Fen | MGMKIVTIIVRILEGMFVVGGIGSFVVLVLSGIEDLKMLLGREEEDHS* |
| Ga0182024_1000757016 | 3300014501 | Permafrost | MGQIIVIVLVRILEGMFVVGIIGSFVVIVLTGIEDLKMLLGREEENRS* |
| Ga0182021_100694092 | 3300014502 | Fen | MGLVATVLVRILEGMFAVGVIGSIAVFVLSGIEDLRTLFGREEENHS* |
| Ga0167668_10005118 | 3300015193 | Glacier Forefield Soil | MGLIIVTVLVRILEGMFVVGAVGSVVVLVLSGIEDLKLLFGREEQNHS* |
| Ga0167668_10395472 | 3300015193 | Glacier Forefield Soil | YGLPMGLIIVTVLVRILETMFVVGAIGSVAVLVLSGIEDLKLLFGREEQNHS* |
| Ga0167668_10441382 | 3300015193 | Glacier Forefield Soil | MGLIIVTVLVRILEGMFVVGAVGSLVVLVLSGIEDLKMLFGREEEHHT* |
| Ga0193729_10277132 | 3300019887 | Soil | MGLIVVTVLVRILETMFVGGAIGSVVVLVLSGIEDLKLLFGREEQNHS |
| Ga0210407_100132842 | 3300020579 | Soil | MGLIIVTVLVRILEAMFVVGAIGSVVVLLLSGIEDLKLLFGREEQNHS |
| Ga0210407_100962312 | 3300020579 | Soil | MGLIIVTVLVRILETMFVAGAIGSVVVLVLSGIEDLKLLFGREEQNHS |
| Ga0210403_1000268916 | 3300020580 | Soil | MGLIIVTVLVRILETMFVVGAAGSVVVLVLSGIEDLKLLFGREEQNHS |
| Ga0210395_100280202 | 3300020582 | Soil | MGHLIVTFLVRILESMFVVGAIGSVVVLVLSGIEDLKLLFGMEEENHS |
| Ga0210395_100599142 | 3300020582 | Soil | MGLLIVTVLVRILEGMFVIGAIGSAVVIVLTGIEDLKMLLGREEQNHS |
| Ga0210401_103542862 | 3300020583 | Soil | MGLIIVTVLVRILEAMFVAGAIGSVVVLVLSGIEDLKLLFGREEQNHS |
| Ga0210401_104420882 | 3300020583 | Soil | MGLLIVTMLVRILEAMFLIGISGSFIVIVLTGIEDLKMLLGREEENHS |
| Ga0210401_112238482 | 3300020583 | Soil | MGLIIVTVLVRILEAMFVLGAMGSVVVLVLSGIEDLKLLFGREEQNHS |
| Ga0210406_108890511 | 3300021168 | Soil | MGLIIVTVLVRILEAMFVAGAIGSVVVLVLSGIEDLKLLFGRE |
| Ga0210400_100012979 | 3300021170 | Soil | MGLLIITVLVRILETMLVVGATGSVVVLVLSGIEDLKLLFGREEQNYS |
| Ga0210405_100749281 | 3300021171 | Soil | MGLIIVTVLVRILETMFVAGASGSVVVLVLSGIEDLKLLFGREEQNHS |
| Ga0210388_100244962 | 3300021181 | Soil | MGHLIVTILVRILESMFVVGAIGSVVVLVLSGIEDLKLLFGMEEENHS |
| Ga0210388_115536072 | 3300021181 | Soil | MGLLIVTVLVRILEGMFVVGAIGSTVVLVLSGIEDLKLLLGMEDENHS |
| Ga0210393_116312622 | 3300021401 | Soil | MGFLFVTVLARILETMFVVGAAGSAVVLVLSGIEDLKLLLGREDENHS |
| Ga0210385_10000021105 | 3300021402 | Soil | MGLLIVTAAVRILETMFVVGAIGSAVVLVLSGIEDLKLLLGLEEENRS |
| Ga0210383_106245402 | 3300021407 | Soil | MSLIVVVLVRILEGMFVVGAIGSTIVLVLSGIEDLKLLFGREEENHS |
| Ga0210394_113273162 | 3300021420 | Soil | MSLIVVVLVRILEGMFVVGAIGSTIVLVLSGIEDLKLLFGREEKNS |
| Ga0210402_100593402 | 3300021478 | Soil | MGLTIVTVLVRILEGLFVLGSVGSFIVLVLTGIEDLKMLLGREEEKHS |
| Ga0210409_109223562 | 3300021559 | Soil | MSLIIVTVLVRILEAMFVVGAIGSVVVLLLSGIEDLKLLFGREEQNHS |
| Ga0224541_10018092 | 3300022521 | Soil | MGLLIVTVVVRILETMFVVGAIGSAVVLVLSGIEDLKLLLGLEEENRS |
| Ga0212123_100004933 | 3300022557 | Iron-Sulfur Acid Spring | MGLIIVTVLVRILETMFVAGAIGSVVVLVLSGIEDLKLLFGREGQNHS |
| Ga0212123_1000538010 | 3300022557 | Iron-Sulfur Acid Spring | MGLLIITVLVRILEGMFVVGAIGSVVVIVLTGIEDLKMLLGWEEENHS |
| Ga0212123_100292663 | 3300022557 | Iron-Sulfur Acid Spring | MGLIIITLLVRILETMLVVGAIGSVVVLVLSGIEDLKLLFGREEQNYS |
| Ga0224551_10001542 | 3300023259 | Soil | MGQIIVIVLVRILEGMFVVGIIGSFVVIVLTGIEDLKMLLGREEENRS |
| Ga0228598_10233212 | 3300024227 | Rhizosphere | MGRLIVIALVRILESMFVIGAIGSVVVLVLSGIEDLKLLVGLEEEDHS |
| Ga0208850_10261052 | 3300025457 | Arctic Peat Soil | MGLKIITVLVRVLEGMFVVGAIGSFVVIVLSGIEDLKMLLGREEENHS |
| Ga0207927_10469852 | 3300025579 | Arctic Peat Soil | MGLIIITVLVRFLEGMFVVGAIGSFVVLVLSGIEDLKMLLGREEENHS |
| Ga0209584_101281682 | 3300025878 | Arctic Peat Soil | MGLMIVTILVRILEAMFFVGALGSVVVLVLSGIEDLKTLVGGEEEHHS |
| Ga0207684_103863742 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLIIVTVLVRILEAMFAVGAIGSVVVLLLSGIEDLKLLFGREEQNHS |
| Ga0207663_115594772 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | EGMFVIGSIGSVIVLVLSGIEDIKTLFGGEEEHHP |
| Ga0207646_105931072 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLIIVTVLVRMLETMFVVGAIGSVVVLVLSGIEDLKLLFGREEQNHS |
| Ga0207646_107450822 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFIVTALVRILEGMFVLGAMGSVLVLVLSGIEDLKLLFGREEEGHS |
| Ga0208651_10191941 | 3300025998 | Rice Paddy Soil | HILEGMFVIGSIGSFLVLVLSGIEDIGTLFGSDELEH |
| Ga0209840_10185172 | 3300026223 | Soil | MGLIIITVLVRVLEGMFVVGAIGSFVVIVLSGIEDLKMLLGREGENHS |
| Ga0209240_10378852 | 3300026304 | Grasslands Soil | MGPIIITVLVRILETTLAIGAMGSVVVLVLSGIEDLQLLFGREEQNHS |
| Ga0209471_10526572 | 3300026318 | Soil | MGLPIITVLVRILETMLVVGTIGSIVVLVLSGIEDLKLLFGREEQNYS |
| Ga0257170_10544181 | 3300026351 | Soil | LVRILEGMFVLGAMGSVLVLVLSGIEDLKLLFGREEENHS |
| Ga0257180_10044352 | 3300026354 | Soil | MGLIVTALVRVLEGMFVVGAIGSVVVLVLSGIEDLKLLFGREEENHS |
| Ga0257166_10512181 | 3300026358 | Soil | MGFIVTALVRILEGMFVLGAMGSVLVLVLSGIEDLKLLFGREEENHS |
| Ga0257173_10606132 | 3300026360 | Soil | MGLIVTALVRILEGMFVLGAMGSVLVLVLSGIEDLKLLF |
| Ga0257179_10218562 | 3300026371 | Soil | MGLIVTALVRVLEGMFVVGAIGSVVVLVLSGIEDLKLLLGREEENHS |
| Ga0257167_10469332 | 3300026376 | Soil | MGLIIVTVLVRVLETMFVGGAIGSVVVLVLSGIEDLKLLFGREEQNHS |
| Ga0257177_10176882 | 3300026480 | Soil | MGLIVTALVRILEGMFVLGAMGSVLVLVLSGIEDLKLLFGREEENHS |
| Ga0257172_10025422 | 3300026482 | Soil | MGLIIVTVLVRILETMFVVGAIGSVVVLLLSGIEDLKLLFGREEQNHS |
| Ga0209648_100651783 | 3300026551 | Grasslands Soil | MGLIIVTVLARILETMFVAGAIGSVVVLVLSGIEDLKLLFGREEQNHS |
| Ga0209648_105684572 | 3300026551 | Grasslands Soil | MGLIVTALVRVLEGMFVVGAIGSVVVLVLSGIEDLKLL |
| Ga0179587_100438661 | 3300026557 | Vadose Zone Soil | GLILVTVVVRLLEGMFAVGVVGSFVVLVLSGIEDLKTLFGREELNHS |
| Ga0208983_10826602 | 3300027381 | Forest Soil | IIVTVLVRILETMFVVGAIGSVVVLVLSGIEDLKLLFGREEQNHS |
| Ga0209734_10013861 | 3300027535 | Forest Soil | MGLIIVTVLVRILETMFVVGAIGSVAVLVLSGIEDLKLLFGREEQNHS |
| Ga0209734_10837212 | 3300027535 | Forest Soil | MGLIVILVLVRILEGMLVGGAIGSVVVLLLSGIEDLKLLFGREERNYS |
| Ga0208984_11226271 | 3300027546 | Forest Soil | SAYGLLMGLIIVTVLVRILETMFVVGAMGSVVVLVLSGIEDLKLLFGREEQNYS |
| Ga0209525_10062823 | 3300027575 | Forest Soil | MGLIVTAIARILETMFVIGSLGSVVVLVLSGIEDLMLLLGREEENNS |
| Ga0209220_11325242 | 3300027587 | Forest Soil | MGLIVILVLVRILEGMLVVGAIGSVVVLLLSGIEDLKLLFGREERNYS |
| Ga0209076_10207832 | 3300027643 | Vadose Zone Soil | MGLIITVLVRILETMLVVGTIGSIVVLVLSGIEDLKLLFGREEQNYS |
| Ga0209736_10218061 | 3300027660 | Forest Soil | MGLIIVTVLVRILETMFVVGAIGSVAVLVLSGIEDLKLLFGREGQNHS |
| Ga0209009_11562412 | 3300027667 | Forest Soil | MGLLIITVLVRILEGMFVVGAIGSVVVIVLTGIEDLKMLLGWEEENYS |
| Ga0208981_11151642 | 3300027669 | Forest Soil | MGLTIILVLMRILEGMLVVGAIGTVIVLVLSGIEDLKLLFGREEQNYS |
| Ga0209248_101419292 | 3300027729 | Bog Forest Soil | MGFVLVTVLARILEGMFVVGAAGSAVVLVLSGIEDLKLLLGLEEENHS |
| Ga0209908_100084802 | 3300027745 | Thawing Permafrost | MGLIVITVLVRILEGMFVVGTIGSVVVLVLSGIEDFKMLFGREEEDHS |
| Ga0209448_101788763 | 3300027783 | Bog Forest Soil | ITVLVRILEGMFIVGAAGSVVVLVLSGIEDLKLLLGLEEENHS |
| Ga0209139_100279862 | 3300027795 | Bog Forest Soil | MGLFFITILVRFLEGLFVVGGIGSVFVLVLSGIEDLKTLFGGEDDHF |
| Ga0209274_101910051 | 3300027853 | Soil | MGHLIVTFLVRILESMFVVGAIGSFVVLVLSGIEDLKMLLGREEESRS |
| Ga0209274_102198861 | 3300027853 | Soil | MGRLIVTVLVRILEGMFVIGAIGSAVVIVLTGIEDLKMLLGREEQNHS |
| Ga0209380_104882652 | 3300027889 | Soil | MGLMLVTAVARILETMFVVGALGSVVVLVLSGIEDLKLLLGREDEDHS |
| Ga0209068_100087793 | 3300027894 | Watersheds | MPLVVTLVARLLETMFVIGSIGSVAVLVLSGIEDLKTLLGREESEHS |
| Ga0209068_100816942 | 3300027894 | Watersheds | MSLTITTVIARFLEGLFVIGSLGSFVVLVLTGIEDLKMLLGREEENNS |
| Ga0209048_102421282 | 3300027902 | Freshwater Lake Sediment | MGLKVLVRFLEGMFVVGAIGSFVVIVLSGIEDLKMLFGREEENHS |
| Ga0209006_100147023 | 3300027908 | Forest Soil | MGMLLVIVFVRILESMFVVGAIGSFVVLVLSGIEDLQLLFGREEKNS |
| Ga0209006_103348733 | 3300027908 | Forest Soil | ILEGMFVIGMIGSFVVIVLTGIEDLKMLLGQEEESHS |
| Ga0209698_111375701 | 3300027911 | Watersheds | MPLVVTLVVRLLESMFVIGSIGSVAVFVLSGIEDLKTLLGREESQHS |
| Ga0265326_100301851 | 3300028558 | Rhizosphere | MGMKIVTIIVRILEGMFVVGAIGSFVVLVLSGIEDLKMLLGREEEDHS |
| Ga0302168_10458382 | 3300028639 | Fen | MGLVATVLVRILEGMFAAGVIGSIAVFVLSGIEDLRTLFGREEENHS |
| Ga0302159_101091532 | 3300028646 | Fen | MGLVATVLVRILEGMFAVGVIGSIAVFVLSGIEDLRTLFGREEENHS |
| Ga0302258_10531632 | 3300028770 | Fen | TVLVRILEGMFAVGVIGSIAVFVLSGIEDLRTLFGREEENHS |
| Ga0265338_102478212 | 3300028800 | Rhizosphere | MGLKIVTVLVRILEGMFVVGVLGSAVVFVLSGIEDFKMLFGREDESKSDHS |
| Ga0308309_104401072 | 3300028906 | Soil | MSLIVVVLVRILEGMFVVGAIGSTVVLVLSGIEDLKLLFGREEKNS |
| Ga0311336_100609372 | 3300029990 | Fen | MGLKIVTVLVRFLEGMFVVGAIGSFVVLVLSGIEDLKMLLGREEEENHS |
| Ga0302300_10428032 | 3300030042 | Palsa | MGLLIVTVVVRILETMFVVGSAVVLVLSGIEDLKLLLGLEEENRS |
| Ga0302183_101030841 | 3300030509 | Palsa | MGLLIVTVVVRILETMFVVGAIGSAVVLVLSGIEDLKLLLGLEEENR |
| Ga0311354_119472072 | 3300030618 | Palsa | MGLLIVTAVVRILETMFVVGAIGSAVVLVLSGIEDLKLLFGLEEENRS |
| Ga0302317_102769831 | 3300030677 | Palsa | VKVPGFKYHEHLMGLLIVTVVVRILETMFVVGAIGSAVVLVLSGIEDLKLLLGLEEENRS |
| Ga0170834_1090124862 | 3300031057 | Forest Soil | VRFLEGLFVVGSLGSVIVLVLSGIEDLKTLFGGEEEHS |
| Ga0170823_124693482 | 3300031128 | Forest Soil | MGLIIITVLVRILETMFVVGAIGSVVVLVLSGIEDLKLLFGREEQNHS |
| Ga0170824_1021991832 | 3300031231 | Forest Soil | MNIFVIVIVRFLEGLFVVGSLGSVIVLVLSGIEDLKTLFGGEEEHS |
| Ga0310686_1049817282 | 3300031708 | Soil | MRHLIITALVRILESMFVVGAIGSVVVLVLSGIEDLKLLFGLEESDHS |
| Ga0310686_1166811652 | 3300031708 | Soil | MGLFIVTVLVRILEGMFLIGIVGSFIVIVLTGIEDLKMLLGREEENHS |
| Ga0265314_104242161 | 3300031711 | Rhizosphere | MSLTITTVIARFLEGLFVAGSVGSLVVLVLTGIEDLRMLLGR |
| Ga0307476_101866572 | 3300031715 | Hardwood Forest Soil | MGLLIVTVLVRILEGMFVIGAIGSLVVIVLTGIEDLKMLLGREEQNHS |
| Ga0307474_113622431 | 3300031718 | Hardwood Forest Soil | LEAMFVVGAIGSVVVLLLSGIEDLKLLFGREEQNHS |
| Ga0307469_104947942 | 3300031720 | Hardwood Forest Soil | MSLIIITVLVRILETMFVVGAIGSVVVLVLSGIEDLNLLFGREEQNHS |
| Ga0307475_102905952 | 3300031754 | Hardwood Forest Soil | MGLIIITVLVRILETMLVGGAIGSVVVLVLSGIEDLKLLFGREEQNYS |
| Ga0307475_104616552 | 3300031754 | Hardwood Forest Soil | MGLIIVTVSVRILEAMFVVGAIGSVVVLVLSGIEDLKLLFGREEQNHS |
| Ga0307475_109742831 | 3300031754 | Hardwood Forest Soil | MGLIIVTALVRILETMLVVGAIGSVVVLVLSGIEDLKLLFGREEQNHS |
| Ga0307478_112513672 | 3300031823 | Hardwood Forest Soil | MGLIIITVLVRILETMLVGGAIGSVVVLVLSGIEDLKLLFGREEQ |
| Ga0307479_104999912 | 3300031962 | Hardwood Forest Soil | MGLLIITLLVRILETMLVVDAIGSVLVLVLSGIEGLKLLFGREEQNYS |
| Ga0307472_1001459462 | 3300032205 | Hardwood Forest Soil | MGLIVTALVRILEGMFVLGAMGSVLVLVLSGIEDLKLLFGREEEGHS |
| Ga0307472_1018666922 | 3300032205 | Hardwood Forest Soil | MGLKIITVLVRFLEGMFVVGAIGSLVVIVLSGIEDLKMLLGREEENHS |
| Ga0335070_100098377 | 3300032829 | Soil | MSILGTLLARILEAMFAVGSVGSFVVLLLSGIEDLKMLLGREESHDS |
| Ga0335070_101654722 | 3300032829 | Soil | MLFLGVLLARILEGMFVAGSIGSFIVLVLSGIEDLETLFGREEEANHS |
| Ga0335084_102078892 | 3300033004 | Soil | GLEGLFMAGASGSLVVLVLSGIEDLETLFGGEEEANHS |
| Ga0326726_102854272 | 3300033433 | Peat Soil | MSLVITLVARLLETMFVIGSIGSFAVLVLSGIEDLKMLLGREESEHS |
| Ga0326726_103090942 | 3300033433 | Peat Soil | MSLLGVLVARTLEAMFIVGSIGSAMVFILSGIEDLKTLFGSEDDENHS |
| Ga0326726_106950602 | 3300033433 | Peat Soil | MRLVVAALERILEGVFAVGVIGPIAVFVLSGIEDLETPFGREEENHS |
| Ga0326726_113263291 | 3300033433 | Peat Soil | MSLVVILVVRLLESMFVIGSIGSFAVLVLSGIEDLKTLFGREE |
| Ga0316624_111551432 | 3300033486 | Soil | MGLIITTVLVRFLEGMFVVGAIGSFVVIVLSGIEDLKMLLGREEENHS |
| Ga0316214_10133142 | 3300033545 | Roots | MRHLIITALVRILESMFVGGAIGSVVVLVLSGIEDLKLLFGLEESDHS |
| Ga0314862_0171596_217_360 | 3300033803 | Peatland | MSWIALAVVRLLEGMFVIGGIGSFVVLILSGIEDLRTLFGQEEENHS |
| Ga0370484_0053657_289_435 | 3300034125 | Untreated Peat Soil | MSLKIVTVLVRILEGMFVVGAIGSFVVLVLSGIEDFKMLLGREDENHS |
| ⦗Top⦘ |