| Basic Information | |
|---|---|
| Family ID | F027938 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 193 |
| Average Sequence Length | 43 residues |
| Representative Sequence | RTRAQLDEGKFEPAGFIVDLVTILTVLFGLALAGYLIYVEKSLG |
| Number of Associated Samples | 149 |
| Number of Associated Scaffolds | 193 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.53 % |
| % of genes near scaffold ends (potentially truncated) | 96.37 % |
| % of genes from short scaffolds (< 2000 bps) | 86.53 % |
| Associated GOLD sequencing projects | 138 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (51.295 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.990 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.642 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.622 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.61% β-sheet: 0.00% Coil/Unstructured: 51.39% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 193 Family Scaffolds |
|---|---|---|
| PF06026 | Rib_5-P_isom_A | 63.21 |
| PF07238 | PilZ | 3.11 |
| PF00248 | Aldo_ket_red | 2.07 |
| PF10415 | FumaraseC_C | 1.04 |
| PF12704 | MacB_PCD | 1.04 |
| PF10397 | ADSL_C | 1.04 |
| PF00171 | Aldedh | 1.04 |
| PF01425 | Amidase | 0.52 |
| PF01380 | SIS | 0.52 |
| PF02706 | Wzz | 0.52 |
| PF01266 | DAO | 0.52 |
| PF07690 | MFS_1 | 0.52 |
| PF00821 | PEPCK_GTP | 0.52 |
| PF13452 | MaoC_dehydrat_N | 0.52 |
| PF13668 | Ferritin_2 | 0.52 |
| PF10531 | SLBB | 0.52 |
| PF03473 | MOSC | 0.52 |
| PF03544 | TonB_C | 0.52 |
| PF13620 | CarboxypepD_reg | 0.52 |
| PF13549 | ATP-grasp_5 | 0.52 |
| PF13579 | Glyco_trans_4_4 | 0.52 |
| PF04542 | Sigma70_r2 | 0.52 |
| PF00491 | Arginase | 0.52 |
| PF01321 | Creatinase_N | 0.52 |
| PF00196 | GerE | 0.52 |
| PF02604 | PhdYeFM_antitox | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 193 Family Scaffolds |
|---|---|---|---|
| COG0120 | Ribose 5-phosphate isomerase | Carbohydrate transport and metabolism [G] | 63.21 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 1.04 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 1.04 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 1.04 |
| COG1274 | Phosphoenolpyruvate carboxykinase, GTP-dependent | Energy production and conversion [C] | 0.52 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.52 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.52 |
| COG3944 | Capsular polysaccharide biosynthesis protein YveK | Cell wall/membrane/envelope biogenesis [M] | 0.52 |
| COG3765 | LPS O-antigen chain length determinant protein, WzzB/FepE family | Cell wall/membrane/envelope biogenesis [M] | 0.52 |
| COG3524 | Capsule polysaccharide export protein KpsE/RkpR | Cell wall/membrane/envelope biogenesis [M] | 0.52 |
| COG3206 | Exopolysaccharide export protein/domain GumC/Wzc1 | Cell wall/membrane/envelope biogenesis [M] | 0.52 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.52 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.52 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.52 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.52 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.52 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.52 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.30 % |
| Unclassified | root | N/A | 48.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10291065 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300000955|JGI1027J12803_101502042 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300000955|JGI1027J12803_105348823 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300001356|JGI12269J14319_10198575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 792 | Open in IMG/M |
| 3300001471|JGI12712J15308_10193599 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300001546|JGI12659J15293_10078820 | Not Available | 723 | Open in IMG/M |
| 3300001867|JGI12627J18819_10286184 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100147006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2227 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100275678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1568 | Open in IMG/M |
| 3300004635|Ga0062388_102573856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300005332|Ga0066388_106222183 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300005538|Ga0070731_10005346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 10641 | Open in IMG/M |
| 3300005538|Ga0070731_10708017 | Not Available | 669 | Open in IMG/M |
| 3300005542|Ga0070732_10375296 | Not Available | 857 | Open in IMG/M |
| 3300005559|Ga0066700_10514164 | Not Available | 835 | Open in IMG/M |
| 3300005560|Ga0066670_10558881 | Not Available | 699 | Open in IMG/M |
| 3300005586|Ga0066691_10346612 | Not Available | 879 | Open in IMG/M |
| 3300005602|Ga0070762_11029557 | Not Available | 565 | Open in IMG/M |
| 3300005602|Ga0070762_11300008 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005921|Ga0070766_11217769 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300006028|Ga0070717_11228380 | Not Available | 682 | Open in IMG/M |
| 3300006052|Ga0075029_101264749 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300006174|Ga0075014_100646620 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300006176|Ga0070765_101319167 | Not Available | 681 | Open in IMG/M |
| 3300006176|Ga0070765_101605430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 611 | Open in IMG/M |
| 3300006358|Ga0068871_100450625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1153 | Open in IMG/M |
| 3300006358|Ga0068871_101527226 | Not Available | 631 | Open in IMG/M |
| 3300006804|Ga0079221_11056090 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300006854|Ga0075425_100940636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 987 | Open in IMG/M |
| 3300007982|Ga0102924_1203502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 856 | Open in IMG/M |
| 3300009038|Ga0099829_10342313 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300009518|Ga0116128_1220329 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300009521|Ga0116222_1344058 | Not Available | 646 | Open in IMG/M |
| 3300009623|Ga0116133_1000025 | All Organisms → cellular organisms → Bacteria | 45100 | Open in IMG/M |
| 3300009700|Ga0116217_10735008 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300010043|Ga0126380_11999178 | Not Available | 530 | Open in IMG/M |
| 3300010048|Ga0126373_10882328 | Not Available | 958 | Open in IMG/M |
| 3300010048|Ga0126373_11367089 | Not Available | 774 | Open in IMG/M |
| 3300010343|Ga0074044_10238984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1201 | Open in IMG/M |
| 3300010343|Ga0074044_10913964 | Not Available | 574 | Open in IMG/M |
| 3300010376|Ga0126381_103179376 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300010376|Ga0126381_103678935 | Not Available | 600 | Open in IMG/M |
| 3300010376|Ga0126381_104391903 | Not Available | 545 | Open in IMG/M |
| 3300010379|Ga0136449_101849238 | Not Available | 900 | Open in IMG/M |
| 3300010379|Ga0136449_101970118 | Not Available | 864 | Open in IMG/M |
| 3300010379|Ga0136449_103310538 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300010937|Ga0137776_1443896 | Not Available | 524 | Open in IMG/M |
| 3300012200|Ga0137382_11161905 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300012203|Ga0137399_11017575 | Not Available | 698 | Open in IMG/M |
| 3300012205|Ga0137362_10805912 | Not Available | 804 | Open in IMG/M |
| 3300012208|Ga0137376_10734046 | Not Available | 851 | Open in IMG/M |
| 3300012209|Ga0137379_10394653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1293 | Open in IMG/M |
| 3300012210|Ga0137378_11321783 | Not Available | 636 | Open in IMG/M |
| 3300012362|Ga0137361_10750763 | Not Available | 889 | Open in IMG/M |
| 3300012929|Ga0137404_11363915 | Not Available | 654 | Open in IMG/M |
| 3300014201|Ga0181537_10570419 | Not Available | 773 | Open in IMG/M |
| 3300014495|Ga0182015_10133873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1695 | Open in IMG/M |
| 3300014501|Ga0182024_12085961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300017822|Ga0187802_10328216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylovulum → Methylovulum psychrotolerans | 599 | Open in IMG/M |
| 3300017936|Ga0187821_10120065 | Not Available | 979 | Open in IMG/M |
| 3300017937|Ga0187809_10254682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300017946|Ga0187879_10239993 | Not Available | 1011 | Open in IMG/M |
| 3300017955|Ga0187817_10036224 | All Organisms → cellular organisms → Bacteria | 3007 | Open in IMG/M |
| 3300017955|Ga0187817_10938009 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 554 | Open in IMG/M |
| 3300017961|Ga0187778_10191081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1303 | Open in IMG/M |
| 3300017961|Ga0187778_11122600 | Not Available | 548 | Open in IMG/M |
| 3300017972|Ga0187781_11205961 | Not Available | 557 | Open in IMG/M |
| 3300017995|Ga0187816_10140979 | Not Available | 1042 | Open in IMG/M |
| 3300018006|Ga0187804_10008000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3525 | Open in IMG/M |
| 3300018006|Ga0187804_10339273 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300018006|Ga0187804_10517382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300018007|Ga0187805_10265036 | Not Available | 788 | Open in IMG/M |
| 3300018009|Ga0187884_10161016 | Not Available | 941 | Open in IMG/M |
| 3300018012|Ga0187810_10353355 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300018018|Ga0187886_1169552 | Not Available | 857 | Open in IMG/M |
| 3300018047|Ga0187859_10030920 | All Organisms → cellular organisms → Bacteria | 2897 | Open in IMG/M |
| 3300018085|Ga0187772_10411917 | Not Available | 942 | Open in IMG/M |
| 3300018088|Ga0187771_11462514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300019786|Ga0182025_1132431 | All Organisms → cellular organisms → Bacteria | 2254 | Open in IMG/M |
| 3300020580|Ga0210403_10811219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300020580|Ga0210403_10821250 | Not Available | 738 | Open in IMG/M |
| 3300020580|Ga0210403_10841624 | Not Available | 727 | Open in IMG/M |
| 3300020580|Ga0210403_11017855 | Not Available | 647 | Open in IMG/M |
| 3300020581|Ga0210399_10539422 | Not Available | 968 | Open in IMG/M |
| 3300020581|Ga0210399_11140458 | Not Available | 622 | Open in IMG/M |
| 3300020583|Ga0210401_11391275 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300021170|Ga0210400_10750792 | Not Available | 801 | Open in IMG/M |
| 3300021170|Ga0210400_11125257 | Not Available | 635 | Open in IMG/M |
| 3300021171|Ga0210405_10567649 | Not Available | 885 | Open in IMG/M |
| 3300021401|Ga0210393_10232220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1495 | Open in IMG/M |
| 3300021404|Ga0210389_10255473 | Not Available | 1371 | Open in IMG/M |
| 3300021404|Ga0210389_10989502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300021405|Ga0210387_10462366 | Not Available | 1127 | Open in IMG/M |
| 3300021405|Ga0210387_10666137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 923 | Open in IMG/M |
| 3300021405|Ga0210387_11208040 | Not Available | 656 | Open in IMG/M |
| 3300021406|Ga0210386_10314037 | Not Available | 1344 | Open in IMG/M |
| 3300021406|Ga0210386_11088595 | Not Available | 679 | Open in IMG/M |
| 3300021420|Ga0210394_11067104 | Not Available | 698 | Open in IMG/M |
| 3300021433|Ga0210391_10143318 | All Organisms → cellular organisms → Bacteria | 1881 | Open in IMG/M |
| 3300021433|Ga0210391_10683519 | Not Available | 804 | Open in IMG/M |
| 3300021474|Ga0210390_10443589 | Not Available | 1096 | Open in IMG/M |
| 3300021478|Ga0210402_11973850 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300021479|Ga0210410_10131490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2224 | Open in IMG/M |
| 3300021479|Ga0210410_10593648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 984 | Open in IMG/M |
| 3300022557|Ga0212123_10684994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300022873|Ga0224550_1010360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1312 | Open in IMG/M |
| 3300024227|Ga0228598_1004878 | All Organisms → cellular organisms → Bacteria | 2826 | Open in IMG/M |
| 3300025604|Ga0207930_1149913 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 501 | Open in IMG/M |
| 3300025612|Ga0208691_1119838 | Not Available | 593 | Open in IMG/M |
| 3300026294|Ga0209839_10083598 | Not Available | 1107 | Open in IMG/M |
| 3300026928|Ga0207779_1042515 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300027383|Ga0209213_1005955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 2144 | Open in IMG/M |
| 3300027565|Ga0209219_1012392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2000 | Open in IMG/M |
| 3300027583|Ga0209527_1089598 | Not Available | 691 | Open in IMG/M |
| 3300027625|Ga0208044_1176679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300027635|Ga0209625_1019298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1507 | Open in IMG/M |
| 3300027684|Ga0209626_1085219 | Not Available | 812 | Open in IMG/M |
| 3300027684|Ga0209626_1108577 | Not Available | 722 | Open in IMG/M |
| 3300027729|Ga0209248_10129415 | Not Available | 756 | Open in IMG/M |
| 3300027812|Ga0209656_10118871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1363 | Open in IMG/M |
| 3300027824|Ga0209040_10040523 | All Organisms → cellular organisms → Bacteria | 2874 | Open in IMG/M |
| 3300027824|Ga0209040_10444126 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300027842|Ga0209580_10160738 | Not Available | 1107 | Open in IMG/M |
| 3300027853|Ga0209274_10647911 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300027857|Ga0209166_10141032 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300027867|Ga0209167_10022992 | All Organisms → cellular organisms → Bacteria | 2974 | Open in IMG/M |
| 3300027867|Ga0209167_10167378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1160 | Open in IMG/M |
| 3300027867|Ga0209167_10211362 | Not Available | 1035 | Open in IMG/M |
| 3300027889|Ga0209380_10596366 | Not Available | 640 | Open in IMG/M |
| 3300027889|Ga0209380_10736660 | Not Available | 563 | Open in IMG/M |
| 3300027889|Ga0209380_10750402 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300027895|Ga0209624_10301354 | Not Available | 1067 | Open in IMG/M |
| 3300027895|Ga0209624_10556611 | Not Available | 762 | Open in IMG/M |
| 3300027895|Ga0209624_10760830 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300027905|Ga0209415_10128989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2634 | Open in IMG/M |
| 3300028574|Ga0302153_10165177 | Not Available | 758 | Open in IMG/M |
| 3300028773|Ga0302234_10435760 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300028798|Ga0302222_10190798 | Not Available | 803 | Open in IMG/M |
| 3300028806|Ga0302221_10491362 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300028871|Ga0302230_10105550 | Not Available | 1126 | Open in IMG/M |
| 3300028871|Ga0302230_10327314 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300028906|Ga0308309_10390054 | Not Available | 1193 | Open in IMG/M |
| 3300028906|Ga0308309_10422960 | Not Available | 1145 | Open in IMG/M |
| 3300028906|Ga0308309_11354321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 611 | Open in IMG/M |
| 3300029908|Ga0311341_10343296 | Not Available | 876 | Open in IMG/M |
| 3300029915|Ga0311358_10738771 | Not Available | 716 | Open in IMG/M |
| 3300029917|Ga0311326_10021006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3994 | Open in IMG/M |
| 3300029999|Ga0311339_11664035 | Not Available | 560 | Open in IMG/M |
| 3300030020|Ga0311344_11101159 | Not Available | 609 | Open in IMG/M |
| 3300030054|Ga0302182_10175439 | Not Available | 922 | Open in IMG/M |
| 3300030057|Ga0302176_10429419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300030399|Ga0311353_11732305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus lacunae | 501 | Open in IMG/M |
| 3300030490|Ga0302184_10376046 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300030509|Ga0302183_10021404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2658 | Open in IMG/M |
| 3300030524|Ga0311357_10556574 | Not Available | 1060 | Open in IMG/M |
| 3300030618|Ga0311354_10767259 | Not Available | 914 | Open in IMG/M |
| 3300030707|Ga0310038_10032937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3073 | Open in IMG/M |
| 3300030862|Ga0265753_1137743 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300031231|Ga0170824_106666904 | Not Available | 718 | Open in IMG/M |
| 3300031231|Ga0170824_108403188 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300031247|Ga0265340_10542566 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300031259|Ga0302187_10478001 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300031446|Ga0170820_13215775 | Not Available | 1183 | Open in IMG/M |
| 3300031545|Ga0318541_10428920 | Not Available | 739 | Open in IMG/M |
| 3300031708|Ga0310686_119764818 | Not Available | 880 | Open in IMG/M |
| 3300031715|Ga0307476_10592302 | Not Available | 822 | Open in IMG/M |
| 3300031718|Ga0307474_10170746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1647 | Open in IMG/M |
| 3300031740|Ga0307468_100227391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1289 | Open in IMG/M |
| 3300031753|Ga0307477_10175371 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300031753|Ga0307477_11035452 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300031823|Ga0307478_10578624 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 939 | Open in IMG/M |
| 3300031823|Ga0307478_11279548 | Not Available | 610 | Open in IMG/M |
| 3300031837|Ga0302315_10403227 | Not Available | 761 | Open in IMG/M |
| 3300031897|Ga0318520_10310223 | Not Available | 952 | Open in IMG/M |
| 3300031938|Ga0308175_101001583 | Not Available | 923 | Open in IMG/M |
| 3300031962|Ga0307479_10707086 | Not Available | 986 | Open in IMG/M |
| 3300031962|Ga0307479_10954599 | Not Available | 828 | Open in IMG/M |
| 3300032160|Ga0311301_10049473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9680 | Open in IMG/M |
| 3300032180|Ga0307471_101592131 | Not Available | 809 | Open in IMG/M |
| 3300032205|Ga0307472_102499055 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300032515|Ga0348332_14268483 | Not Available | 1109 | Open in IMG/M |
| 3300032828|Ga0335080_10135590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2729 | Open in IMG/M |
| 3300032828|Ga0335080_10421885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1428 | Open in IMG/M |
| 3300032828|Ga0335080_11284184 | Not Available | 732 | Open in IMG/M |
| 3300032898|Ga0335072_10811431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 893 | Open in IMG/M |
| 3300032954|Ga0335083_10126304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2461 | Open in IMG/M |
| 3300032955|Ga0335076_10174646 | All Organisms → cellular organisms → Bacteria | 2058 | Open in IMG/M |
| 3300033545|Ga0316214_1005697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1638 | Open in IMG/M |
| 3300034163|Ga0370515_0006195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5822 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.99% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.25% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.25% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.22% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.70% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.70% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.70% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.18% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.11% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.11% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.11% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.59% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.59% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.59% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.55% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.04% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.04% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.04% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.04% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.04% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.04% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.52% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.52% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.52% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.52% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.52% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.52% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.52% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.52% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.52% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.52% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.52% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300025604 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026928 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 44 (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028574 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031259 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Host-Associated | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_102910651 | 3300000567 | Peatlands Soil | QLDAGTFEPAGFVLNLVTVLTVLLGLILAAYLIYTEKSLG* |
| JGI1027J12803_1015020421 | 3300000955 | Soil | YRQTRERLDQGKFEPAGFVLDLVTAMTVLFGLALAGYLIYIERSVG* |
| JGI1027J12803_1053488232 | 3300000955 | Soil | LFRYRQTRERLDQGKFEPAGFVLDLVTVLTVLFGLVLAGYLIYIERSVG* |
| JGI12269J14319_101985751 | 3300001356 | Peatlands Soil | RTRAQLESGTFEPAGFVIDFVGILAALFGLALAGYLVYIALRL* |
| JGI12712J15308_101935991 | 3300001471 | Forest Soil | EEGKFEPAGFIVDLVTILTVLFGLALAGYLIYVERSLG* |
| JGI12659J15293_100788202 | 3300001546 | Forest Soil | VVAGLVRYRTTRAQLDEGKFVPAGFIVDLVTILTALFGLALAGYLVYVGKSFG* |
| JGI12627J18819_102861842 | 3300001867 | Forest Soil | YRQTRDRLDQGKFEPAGFVLDLVTILTVLFGLVLAGYLIYIERSVG* |
| JGIcombinedJ26739_1001470064 | 3300002245 | Forest Soil | GKFEPAGFIVDLVTILTVLFGLALAGYLIYVQKGMG* |
| JGIcombinedJ26739_1002756783 | 3300002245 | Forest Soil | KTKHQLELGRFEPAGFLVDLIGILTALLGLALAGYLVYIELSL* |
| Ga0062388_1025738561 | 3300004635 | Bog Forest Soil | YRNTRAMLDAGRFEPAGFLVDLVGILTAVFGLALAGYLVYIEIRL* |
| Ga0066388_1062221831 | 3300005332 | Tropical Forest Soil | YRRTRDQLESGTFEPAGFVVDLVAIITTLFGLALAGYLVYIELRL* |
| Ga0070731_100053461 | 3300005538 | Surface Soil | FRYRKTRDRLDQGSFEPAGLGLDLITVLTVIIGLALAGYLIYTERVLG* |
| Ga0070731_107080171 | 3300005538 | Surface Soil | RYRRTRAQLDEGRFEPAGFLVDLVTILTALFGLALAGYLFYVKNSIG* |
| Ga0070732_103752962 | 3300005542 | Surface Soil | DQGRFEPAGFGLDLMTILTVLFGIALAGYLIYIEKSFS* |
| Ga0066700_105141642 | 3300005559 | Soil | KTREQLDAGTFQPAGVVLDLITILTVLFGLVLAGYLIYTEKSLG* |
| Ga0066670_105588812 | 3300005560 | Soil | LRYRKTRTLLEVGKFQPAGFVLDLVTILTVLFGLALAGCLIYIEKSLG* |
| Ga0066691_103466121 | 3300005586 | Soil | FEPAGFVLDLVTALTVLFGLALAGYLIYIERSVG* |
| Ga0070762_110295572 | 3300005602 | Soil | DAGTFEPAGFVVDLITILTVLFGLALAAYLIYTETSLR* |
| Ga0070762_113000082 | 3300005602 | Soil | QLDEGKFEPAGFIVDLVTILTALFGLALAGYLLYVEKSLG* |
| Ga0070766_112177692 | 3300005921 | Soil | LVVAGLARYRKTRAQLDEGKFEPAGFIVDLVAIVTVLFGMALAGYLIYVQKSFG* |
| Ga0070717_112283801 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RKTRDRLDQGIFEPAGFVLDLVTILTVLFGLALAIYLIYIQMNVA* |
| Ga0075029_1012647491 | 3300006052 | Watersheds | GTFEPAGFVLDLVTVLTVLFGLALAAYLLYIERSVG* |
| Ga0075014_1006466201 | 3300006174 | Watersheds | LLVVGGLFRYRKTRERLDQGSFEPAGFVLDLITLLTVLFGLVLAGYLIYIERSVG* |
| Ga0070765_1013191672 | 3300006176 | Soil | LEAGNFEPAGYIIDLVGILVGLAGVALAVYLVYIEFSL* |
| Ga0070765_1016054302 | 3300006176 | Soil | NTRTRLDEGTFEPAGFVLDLVTILTVLFGLALAAYLIYIENSVG* |
| Ga0068871_1004506253 | 3300006358 | Miscanthus Rhizosphere | RTQLDAGTFEPAGFVVDLVTILTVVFGLVLAGYLIYTERSL* |
| Ga0068871_1015272262 | 3300006358 | Miscanthus Rhizosphere | RAQLDSGTFEPAGFVLDLITILTVLFGLALAGYLIYAEKSLG* |
| Ga0079221_110560901 | 3300006804 | Agricultural Soil | RYRKTRERLERGRFEPAGFVLDLVTALTVLFGLVLAGYLIYIERSVG* |
| Ga0075425_1009406363 | 3300006854 | Populus Rhizosphere | ERLDEGTFEPAGFVLDLVTILTVLFGLALAGYLIYIEKVA* |
| Ga0102924_12035022 | 3300007982 | Iron-Sulfur Acid Spring | YRKTRARLDEGTFEPAGFVLDLVTVLTVLFGLVLAGYLIYIEKSVG* |
| Ga0099829_103423132 | 3300009038 | Vadose Zone Soil | LDQGEFEPAGFIVDLVTILTVLFGLALAGYLIYVEKSLG* |
| Ga0116128_12203292 | 3300009518 | Peatland | RTRAQLDEGKFEPAGFIVDLVTILTVLFGLALAGYLIYVEKSLG* |
| Ga0116222_13440582 | 3300009521 | Peatlands Soil | YRKTRARLEAGTFEPAGFVLDLVTILTVLFGLVLAAYLIYIEKSVG* |
| Ga0116133_10000251 | 3300009623 | Peatland | TQLDEGKFEPAGFVVDLVTILTVLFGLALAGYLVYVEKSLG* |
| Ga0116217_107350082 | 3300009700 | Peatlands Soil | ARLDAGTFEPAGFVLDLVTILTVLFGLVLAGYLIYIEKSVG* |
| Ga0126380_119991782 | 3300010043 | Tropical Forest Soil | LDAGTFQPAGFVLDLVTILTVLLGLALAGYLIYTEKVLG* |
| Ga0126373_108823282 | 3300010048 | Tropical Forest Soil | LLRYRQTRDRLEEGKFAPAGFVLDLVTVLTVLFGLVLAGYLIYIEKSVG* |
| Ga0126373_113670892 | 3300010048 | Tropical Forest Soil | LRYRKTKAQLDAGVFEPAGFLLDLVTVLTVLLGLALAGYLIYTEKVLG* |
| Ga0074044_102389841 | 3300010343 | Bog Forest Soil | YRRARMLLDEGKFEPAGFMVDVVTIITVIFGLALAGYLIYVQKVL* |
| Ga0074044_109139641 | 3300010343 | Bog Forest Soil | RYRRTRAQLESGTFEPAGFIVDFVGILVALFGLALGGYLVYTELRL* |
| Ga0126381_1031793761 | 3300010376 | Tropical Forest Soil | QGKFEPAGFVLDLVTILTVLFGLVLAGYLLYIEKSVG* |
| Ga0126381_1036789352 | 3300010376 | Tropical Forest Soil | DQLDHGTFEPAGFIIDLVAILTAIFGLGLGGYLLYIEMGLR* |
| Ga0126381_1043919031 | 3300010376 | Tropical Forest Soil | MVRAQLDLGAFEAAGTIVDLVAIITALFGLALAGYLLYIEKVL* |
| Ga0136449_1018492382 | 3300010379 | Peatlands Soil | RAQLEEGKFEPAGFIVDLVTVLTVLFGLALAGYLVYVEKSLS* |
| Ga0136449_1019701182 | 3300010379 | Peatlands Soil | RAQLEEGKFEPAGFIVDLVTVLTVLFGLALAGYLVYVEKSLG* |
| Ga0136449_1033105381 | 3300010379 | Peatlands Soil | RRQLDAGTFEPAGFVLDLITALTVLFGLVLAGYLIYTERILG* |
| Ga0137776_14438962 | 3300010937 | Sediment | AFEPAGFLLDLVTVLTVLLGLALAGYLIYTERVLG* |
| Ga0137382_111619051 | 3300012200 | Vadose Zone Soil | FRYRKTRERLDQGRFEPAGFVLDLVTALTVLFGLALAGYLIYIERSVG* |
| Ga0137399_110175751 | 3300012203 | Vadose Zone Soil | LDEGKFEPAGFIVDLVTILTVLFGLALAGYLIFVQKSLG* |
| Ga0137362_108059121 | 3300012205 | Vadose Zone Soil | LRYRKTRAQLDQGEFEPAGFIVDLVTILTVLFGLALAGYLIYVEKSLG* |
| Ga0137376_107340461 | 3300012208 | Vadose Zone Soil | TRERLDQGRFEPAGFVLDLVTALTVLFGLALAGYLIYIERSVG* |
| Ga0137379_103946533 | 3300012209 | Vadose Zone Soil | DAGTFEPAGLGLDLITTLTVVFGLALAAYLIYTQKSL* |
| Ga0137378_113217831 | 3300012210 | Vadose Zone Soil | KFEPAGFVLDLVTILTVLFGLALAGYLIYIEKSIG* |
| Ga0137361_107507631 | 3300012362 | Vadose Zone Soil | QGKFEPAGFIVDLVTILTVLFGLALAGYLVYVEKSLG* |
| Ga0137395_110476061 | 3300012917 | Vadose Zone Soil | TRAQLEVGKFEPAGFLIDVVAILTVLFGFALAAYLVYIQDSH* |
| Ga0137404_113639152 | 3300012929 | Vadose Zone Soil | MLVIAGLARYRRTRAQLDAGTFEPAGVVLDLVTILTVVFGLVLAGYLIYTEKVLG* |
| Ga0181537_105704191 | 3300014201 | Bog | QLDEGKFEPAGFIVDLVTILTALFGLALAGYLFYVEKSLG* |
| Ga0182015_101338731 | 3300014495 | Palsa | TRAQLDEGKFEPAGFIVDLVTILTALFGLALAGYLFYVEKSLG* |
| Ga0182024_120859612 | 3300014501 | Permafrost | EAGRFTPGGFVVDLVGILTALFGLALAGYLVYIGLRL* |
| Ga0187802_103282161 | 3300017822 | Freshwater Sediment | KTRAQLDVGTFEPAGFVVDLITILTVVFGLVLAGYLIYTEKSLR |
| Ga0187821_101200651 | 3300017936 | Freshwater Sediment | AGSFEPAGFVLDLVTILTVLFGLALAAYLIYIERSVA |
| Ga0187809_102546822 | 3300017937 | Freshwater Sediment | VVAGLFRYRKTRDRLDEGTFEPAGFVLDLVTILTVLFGLALAGYLIYIEKVA |
| Ga0187879_102399932 | 3300017946 | Peatland | RYRKTRAQLDAGKFEPAGFIVDLVTVLTVLFGLALAGYLVYVGKSLG |
| Ga0187817_100362245 | 3300017955 | Freshwater Sediment | MVRYRKTRRQLDAGTFEPAGFVVDLVTILTVVFGLALAGYLIYTEKSLG |
| Ga0187817_109380092 | 3300017955 | Freshwater Sediment | DLEAGRFEPAGFVVDLVGILTALFGLVLAGYLIYIELRM |
| Ga0187778_101910811 | 3300017961 | Tropical Peatland | HDKSGRFEPAGFVVDLVGILTALFGLALAGYLVYIELRL |
| Ga0187778_111226001 | 3300017961 | Tropical Peatland | LAGLLRYRRTRNQLESGKFKPAGFIVDLVGILIALFGLVLAGYLIYIELRL |
| Ga0187781_112059612 | 3300017972 | Tropical Peatland | GKFEPAGFIVDLVTILTVLFGLALAGYLIYVGRGLT |
| Ga0187816_101409792 | 3300017995 | Freshwater Sediment | RKTRAQLDSGTFEPAGFVVDLITILTVLFGLALAGYLIYTQKVLG |
| Ga0187804_100080007 | 3300018006 | Freshwater Sediment | RYRKTRARLDAGTFEPAGFGLDLLTILTVLIGLALAGYLIYTEKVLG |
| Ga0187804_103392731 | 3300018006 | Freshwater Sediment | GLVRYRKTRRQLDAGTFEPAGLVVDLVTILTVVFGLALAGYLIYTEKSLG |
| Ga0187804_105173821 | 3300018006 | Freshwater Sediment | YRKTRAQLDAGKFEPAGFIVDLVTILTVLFGLALAGYLIYVEKSLG |
| Ga0187805_102650362 | 3300018007 | Freshwater Sediment | AGLLRYRQTRVRLDEGTFQPAGFVLDLVTILTVLFGLALAAYLIYIEKSVG |
| Ga0187884_101610161 | 3300018009 | Peatland | ESGTFEPAGFIVDLVAILVALFGVALAGYLVYIGLYL |
| Ga0187810_103533552 | 3300018012 | Freshwater Sediment | LDAGTFEPAGFVVDLVTILTVVFGLALAGYLIYTEKSLG |
| Ga0187880_12128911 | 3300018016 | Peatland | RVQLESRTFEPAGFVVDVVGILLALFGLGLAGYLVYIERYL |
| Ga0187886_11695522 | 3300018018 | Peatland | YRKTRTQLDEGKFEPAGFVVDLVTILTVLFGLALAGYLVYVEKSLG |
| Ga0187859_100309205 | 3300018047 | Peatland | YRKTRAQLDEGKFEPAGFLVDLVAIVTVLFGMALAGYLIYVQKSLG |
| Ga0187772_104119172 | 3300018085 | Tropical Peatland | GLVRYRTTRTQLDAGTFQPAGFVLDLITILTVLFGLILAGYLIYTERSLG |
| Ga0187771_114625141 | 3300018088 | Tropical Peatland | RETRAQLESGTFEPAGLIVDLVGILAALSGLALAGYLVYIELRL |
| Ga0182025_11324313 | 3300019786 | Permafrost | VMVVAGLLRYRRTRAQLDEGKFEVAGFIVDLVTILTALFGLALAGYLIYVEKSLG |
| Ga0210403_108112191 | 3300020580 | Soil | VRFEPAGFLVDLIVILTALLGLALAGYLVYVELSL |
| Ga0210403_108212501 | 3300020580 | Soil | YRKTRSQLDAGKFEPAGFIVDLVTILTVLFGLALAGYLIYVGKSFG |
| Ga0210403_108416241 | 3300020580 | Soil | KTRVQLDSGTFEPAGFVLDLITILTVVFGMVLAGYLIYTEKVLG |
| Ga0210403_110178552 | 3300020580 | Soil | TAGRFEPAGFVLDLITILMVLFGLVLAGYLVYTERILG |
| Ga0210399_105394221 | 3300020581 | Soil | KFEPAGFIVDLVTILTVLFGLALAGYLIYVGKSFS |
| Ga0210399_111404582 | 3300020581 | Soil | RYRKTRAQLDEGKFEPAGFVVDLIAILTVLFGLVLAGYLIFVEKSLG |
| Ga0210401_113912752 | 3300020583 | Soil | AQLDEGKFEPAGFIVDLVTVLTVLFGLALAGYLIYVGKSIG |
| Ga0210400_107507921 | 3300021170 | Soil | LDEGKFQPAGFIVDMVTILTVLFGLALAGYLIYVEKSLG |
| Ga0210400_111252572 | 3300021170 | Soil | LARYRKTKTQLDAGTFEPAGFLLDLVTALTVAVGLGLAAYLIYTENVLG |
| Ga0210405_105676491 | 3300021171 | Soil | YRKTRAQLDEGKFEPAGFVVDLIAILTVLFGLVLAGYLVYVEKSFA |
| Ga0210393_102322203 | 3300021401 | Soil | MVVAGLVRYRTTRAQLDEGKFVPAGFIVDLVTILTALFGLALAGYLVYVGKSFG |
| Ga0210389_102554733 | 3300021404 | Soil | LARYRRTRAQLDEGKFEPAGFIVDLVTILTVLFGLALAGYLIYVEKSLG |
| Ga0210389_109895021 | 3300021404 | Soil | KTRHQLELGRFEPAGFLVDLIGILTALLGLALAGYLVYIELSL |
| Ga0210387_104623663 | 3300021405 | Soil | RTQLDEGKFEPAGFVVDLVAILTVLFGMVLAGYLIYVQKSLG |
| Ga0210387_106661371 | 3300021405 | Soil | KTRVQLDAGTFEPAGFVLDFITLLTVLFGLALAGYLIYTEKILR |
| Ga0210387_112080402 | 3300021405 | Soil | RKTRAQLTAGRFEPAGFVLDLITILMVLFGLVLAGYLIYTERILG |
| Ga0210386_103140371 | 3300021406 | Soil | RKTRAQLDSGTFEPAGFVLDFITVLTVLFGMVLAGYLIYTEKVLG |
| Ga0210386_110885951 | 3300021406 | Soil | RTRAQLDEGKFEPAGFIVDLVTILTVLFGLALAGYLIYVEKSLG |
| Ga0210394_110671042 | 3300021420 | Soil | KTRVQLETGTFEPAGFVLDLITILTMVFGLVLAGYLIYTEKILG |
| Ga0210391_101433183 | 3300021433 | Soil | QLDEGKFVPAGFIVDLVTILTALFGLALAGYLVYVGKSLG |
| Ga0210391_106835191 | 3300021433 | Soil | RRVRTQLDAGKFEPAGFVVDLVTITMVLFGLALAAYLIYTQRSLVG |
| Ga0210390_104435891 | 3300021474 | Soil | TAGRFEPAGFVLDLITILMVLFGLVLAGYLIYTERILG |
| Ga0210402_119738501 | 3300021478 | Soil | EGKFEPAGFVVDMVAILTVLFGLVLAGYLIYVQKSLG |
| Ga0210410_101314901 | 3300021479 | Soil | LDAGTFEPAGFVLDLITALTVLFGLVLAGYLIYTERILG |
| Ga0210410_105936481 | 3300021479 | Soil | RRTRAQLESGTFEPAGFVIDLVGILTALFGLALAGYLVYIELRL |
| Ga0212123_106849941 | 3300022557 | Iron-Sulfur Acid Spring | YRKTRARLDEGTFEPAGFVLDLVTVLTVLFGLVLAGYLIYIEKSVG |
| Ga0224550_10103603 | 3300022873 | Soil | MVVAGLLRYRKTRAQLDEGKFEPAGFIVDLVTILTVLFGLALAGYLVYVEKSWS |
| Ga0228598_10048781 | 3300024227 | Rhizosphere | RYRRVRTQLDAGKFEPAGFVVDLVTITMVLFGLALAAYLIYTQRSLVG |
| Ga0207930_11499131 | 3300025604 | Arctic Peat Soil | RYRKTRAQLDAGTFEPAGFVLDLITILTVVFGLALAGYLIFAEKSLG |
| Ga0208691_11198381 | 3300025612 | Peatland | RKTRTQLDEGKFEPAGFVVDLVTILTVLFGLALAGYLVYVEKSLG |
| Ga0209839_100835981 | 3300026294 | Soil | QLDAGTFEPAGFVMDLITILTVLLGFVLAGYLIYTEKILG |
| Ga0209055_13018891 | 3300026309 | Soil | RRTRAQLEAGTFQPAGFLIDVVAILTALFGLAMAGYLVYTEQSLR |
| Ga0209157_12029212 | 3300026537 | Soil | AQLEAGTFQPAGFLIDVVAILTALFGLAMAGYLVYTEQSLR |
| Ga0207779_10425152 | 3300026928 | Tropical Forest Soil | RTRAQLDAGTFEPAGFVLDLVTVLVVVFGLVLSGYLIYTEKMLG |
| Ga0209213_10059551 | 3300027383 | Forest Soil | SGTFEPAGFVIDLVGILVALFGLALAFYLVYIELRL |
| Ga0209219_10123921 | 3300027565 | Forest Soil | LFRYRKTKHQLEFGRFEPAGFLVDLIGILTALLGLALAGYLVYIELSL |
| Ga0209527_10895981 | 3300027583 | Forest Soil | RKTRAQLDAGTFEPAGFVLDLITFLTVLFGLALAGYLIYTEKILG |
| Ga0208044_11766792 | 3300027625 | Peatlands Soil | GQLDSGTFEPAGFVLDLITILTVVFGLVLAGYLIYTEKVLG |
| Ga0209625_10192983 | 3300027635 | Forest Soil | GLFRYRKTKHQLELGRFEPAGFLVDLIGILTALLGLALAGYLVYIELSL |
| Ga0209626_10852191 | 3300027684 | Forest Soil | SQLDEGKFEPAGFIVDLVTILIVLFGLALAGYLIYVQKSMG |
| Ga0209626_11085771 | 3300027684 | Forest Soil | TRALLDQGKFEPAGFIVDLVTILTVLFGLALAGYLIYVENSFG |
| Ga0209248_101294151 | 3300027729 | Bog Forest Soil | AGLARYRKTRAQLDEGKFEPAGFVVDLVAIVTVLFGMGLAGYLIYVQRSLG |
| Ga0209656_101188711 | 3300027812 | Bog Forest Soil | MRYRKTRAQLDEGRFEPAGFIVDMVTILTVLFGLALAGYLIYVEKSLG |
| Ga0209040_100405235 | 3300027824 | Bog Forest Soil | GKFEPAGFIVDLVTILTVLFGLALAGYLIYVERSFG |
| Ga0209040_104441261 | 3300027824 | Bog Forest Soil | VAGLMRYRRTRALLDLGKFEPAGFVLDLVTILTVVFGMVLAGYLIYIEKSLG |
| Ga0209580_101607381 | 3300027842 | Surface Soil | YRKTREQLDQGRFEPAGFGLDLMTILTVLFGIALAGYLIYIEKSFS |
| Ga0209274_106479111 | 3300027853 | Soil | QLDAGTFEPAGFVLDLITILTVLFGLALAGYLIYTEKILG |
| Ga0209166_101410323 | 3300027857 | Surface Soil | HQLELGRFEPAGFLVDLIGILTALLGLALAGYLVYIELSL |
| Ga0209167_100229926 | 3300027867 | Surface Soil | LDEGRFQPAGFIVDLVTILTVAFGLALAGYLIFVEKSLG |
| Ga0209167_101673781 | 3300027867 | Surface Soil | GLFRYRKNRDHLEAGTFVPAGAGLDLLTALTVLIGLALAAYLIYTERVLG |
| Ga0209167_102113622 | 3300027867 | Surface Soil | SFQPAGFVLDLVTVLTVLFGLVLAGYLIYIEKSVG |
| Ga0209380_105963662 | 3300027889 | Soil | DAGTFEPAGFVLDLITSLTVVFGLVLAGYLIYTEKILG |
| Ga0209380_107366601 | 3300027889 | Soil | ALVVAGLARYRKTRAQLDEGKFEPAGFIVDLVAIVTVLFGMALAGYLIYVQKSFG |
| Ga0209380_107504022 | 3300027889 | Soil | GLLRYRKTRAQLDAGTFEPAGFVLDLITILTVLFGLALAGYLIYTEKILG |
| Ga0209624_103013542 | 3300027895 | Forest Soil | LDEGKFEPAGFVIDLVTIVTVLFALALAGYLIYTGKSLS |
| Ga0209624_105566111 | 3300027895 | Forest Soil | QLDEGLFEPAGFIVDLVTILTALFGLALAGYLIYVEKSLG |
| Ga0209624_107608302 | 3300027895 | Forest Soil | GTFTPAGFVVDLVTLVMVLFGLALAAYLIYTQRSLG |
| Ga0209415_101289892 | 3300027905 | Peatlands Soil | ALLESGRFEPAGFVVDLVGILTALFGLVLAGYLVYIELHL |
| Ga0302153_101651772 | 3300028574 | Bog | DGKFEPAGFILDLVTILTVLFGLALAGYLIYVSKGLG |
| Ga0302234_104357601 | 3300028773 | Palsa | GLMRYRKTRAQLDEGKFEPAGFIVDLVTILTVLFGLALAGYLIYVEKSFG |
| Ga0302222_101907982 | 3300028798 | Palsa | TQLDAGTFTPAGFVVDLVTLLVVLFGLALAAYLIYTQQSLG |
| Ga0302221_104913621 | 3300028806 | Palsa | LDSGTFEPAGFVLDLITILTVLFGLALAGYLIYTEKVLG |
| Ga0302230_101055502 | 3300028871 | Palsa | AGLMRYRKTRAQLEDGKFEPAGFIVDLVTILTVLFGLALAGYLVYVGQSLG |
| Ga0302230_103273142 | 3300028871 | Palsa | AGLFRYRKTRQLLDQGKFEPAGFMLDLVTILTVLFGMVLAGYLIYTEKAL |
| Ga0308309_103900542 | 3300028906 | Soil | QTRAQLEAGNFEPAGYIIDLVGILVGLAGVALAVYLVYIEFSL |
| Ga0308309_104229601 | 3300028906 | Soil | TRAQLDEGKFVPAGFIVDLVTILTALFGLALAGYLVYVGKSLG |
| Ga0308309_113543211 | 3300028906 | Soil | NTRTRLDEGTFEPAGFVLDLVTILTVLFGLALAAYLIYIENSVG |
| Ga0311341_103432962 | 3300029908 | Bog | RYRKTRAQLEDGKFEPAGFILDLVTILTVLFGLALAGYLIYVSKGLG |
| Ga0311358_107387712 | 3300029915 | Bog | LRYRKTRAQLDAGKFEPAGFLVDLVTILTALFGLALAGYLFYVEKSLG |
| Ga0311326_100210066 | 3300029917 | Bog | VAGLVRYRKTRAQLEDGKFEPAGFILDLVTILTVLFGLALAGYLIYVSKGLG |
| Ga0311339_116640351 | 3300029999 | Palsa | RAQLDEGKFEPAGFIVDLVTILTVLFGLALAGYLFYVERSLG |
| Ga0311344_111011592 | 3300030020 | Bog | KFEPAGFIVDLVTILTALFGLALAGYLIYVEKSFG |
| Ga0302182_101754392 | 3300030054 | Palsa | LMRYRKTRAQLDEGKFEPAGFIVDLVTILTVLFGLALAGYLIYVEKSFG |
| Ga0302176_104294191 | 3300030057 | Palsa | YRKTRQLLDQGKFEPAGFMLDLVTILTVLFGMVLAGYLIYTEKAL |
| Ga0311353_117323051 | 3300030399 | Palsa | RAQLDEGKFEPAGFIVDLVTILTALFGLALAGYLFYVEKSLG |
| Ga0302184_103760462 | 3300030490 | Palsa | LDEGKFEPAGFIVDLVTILTVLFGLALAGYLVYVGKSLG |
| Ga0302183_100214041 | 3300030509 | Palsa | RKTRAQLDEGKFEPAGFIVDLVTILTVLFGLALAGYLIYVEKSFG |
| Ga0311357_105565742 | 3300030524 | Palsa | TRAQLEDGKFEPAGFIVDLVTILTVLFGLALAGYLVYVGQSLG |
| Ga0311354_107672591 | 3300030618 | Palsa | AQLDEGKFEPAGFIVDLVTILTALFGLALAGYLFYVEKSLG |
| Ga0310038_100329371 | 3300030707 | Peatlands Soil | RGQLDSGTFEPAGFVLDLITILTVVFGLVLAGYLIYTEKVLG |
| Ga0265753_11377432 | 3300030862 | Soil | DAGTFTPAGFVVDLVTLLMVLFGLALAAYLIYTQRSLG |
| Ga0170824_1066669042 | 3300031231 | Forest Soil | LDSGTFEPAGFVLDLITVLTVVFGLVLAGYLIYMEKSLG |
| Ga0170824_1084031882 | 3300031231 | Forest Soil | ALVIAGLLRYRKTRIQLDSGTFEPAGFVLDLVTILTVLFGLALAGYLIYTEMSLR |
| Ga0265340_105425661 | 3300031247 | Rhizosphere | VVAGLVRYRKTRAQLDSGSFEPAGFVLDLITILTVVFGLALAGYLIYAEMSLG |
| Ga0302187_104780011 | 3300031259 | Bog | EDGKFEPAGFILDLVTILTVLFGLALAGYLIYVSKGLG |
| Ga0170820_132157751 | 3300031446 | Forest Soil | GTFEPAGFVLDLITVLTVLFGLALAGYLIYTEKSLG |
| Ga0318541_104289201 | 3300031545 | Soil | LVRTQLDHGQFTPAGFIVDLVALVTALFGLALGGYLFYIEKAF |
| Ga0310686_1197648182 | 3300031708 | Soil | DQGKFEPAGFIVDLVTILTVLFGLVLAGYLIYVGKSFG |
| Ga0307476_105923021 | 3300031715 | Hardwood Forest Soil | LDRGTFEPAGFVLDLVTALTVLFGLALAGYLIYIERSVG |
| Ga0307474_101707463 | 3300031718 | Hardwood Forest Soil | TRERLEQGRFEPAGFVLDLVTALTVLFGLVLAGYLIYIERSVG |
| Ga0307468_1002273911 | 3300031740 | Hardwood Forest Soil | WAQLDRGMFEPAGFVIDLVAILTAVFGLGLGGYLLYIEMGFR |
| Ga0307477_101753711 | 3300031753 | Hardwood Forest Soil | FGLFEPAGFLVDLIGILTALLGLALAGYLVYIELSL |
| Ga0307477_110354521 | 3300031753 | Hardwood Forest Soil | DQGRFEPAGFVLDLVTALTVLFGLVLAGYLIYIERSVG |
| Ga0307478_105786241 | 3300031823 | Hardwood Forest Soil | QLESGRFEPAGFIVDLVAILVVLFGLALAGYLVYIEFRL |
| Ga0307478_112795481 | 3300031823 | Hardwood Forest Soil | QTRAQLDEGKFEPAGFIVDMVTILTVLFGLALAGYLIYVEKSLA |
| Ga0302315_104032271 | 3300031837 | Palsa | SGTFEPAGFVLDLITILTVLFGLALAGYLIYTEKVLG |
| Ga0318520_103102231 | 3300031897 | Soil | QLESGTFEPAGFVVDLVAIITTFFGLALAGYLVYIELRL |
| Ga0308175_1010015831 | 3300031938 | Soil | GKFEPAGFVLDLVTILTVLFGLALAAYLIYIEKSLG |
| Ga0307479_107070862 | 3300031962 | Hardwood Forest Soil | GLVRYRQTRMRLDAGTFEPAGFVLDLVTILTVLFGLGLAGYLIYIEKSVG |
| Ga0307479_109545991 | 3300031962 | Hardwood Forest Soil | VGGLFRYRKTRERLDRGTFEPAGFVLDLVTALTVLFGLALAGYLIYIERSVG |
| Ga0311301_100494731 | 3300032160 | Peatlands Soil | YHKTRTQLNSGTFEPAGFVLDLITALTVLFGLALAGYLIYTERILG |
| Ga0307471_1015921312 | 3300032180 | Hardwood Forest Soil | GLNRYRQTRTQLDTGSFQPAGFLIDLVGILTILFGLALAGYLVYIHHSLNSQ |
| Ga0307472_1024990551 | 3300032205 | Hardwood Forest Soil | GRFEPAGFVLDLVTALTVLFGLVLAGYLIYIERSVG |
| Ga0348332_142684831 | 3300032515 | Plant Litter | QLDAGKFEPAGFVVDLVTITMVLFGLALAAYLIYTQRSLVG |
| Ga0335080_101355904 | 3300032828 | Soil | RIQLDAGVFEPAGLVVNLVTILTVILGLALVGYLIYIEKVLG |
| Ga0335080_104218853 | 3300032828 | Soil | LDQGAFQPAGFVLDLVTILTVLFGLVLAGYLIYIEKSVG |
| Ga0335080_112841842 | 3300032828 | Soil | YRQTRTRLDQGTFEPAGFVLDLVTLLTVLFGLVLAGYLIFIEKSVG |
| Ga0335072_108114311 | 3300032898 | Soil | RKIRALLEEGKFEPAGFIVDLVTILTVLFGLALAGYLIYVEKSLG |
| Ga0335083_101263044 | 3300032954 | Soil | QGSFQPAGFVLDLVTVLTVLFGLVLAGYLIYIEKSVG |
| Ga0335076_101746461 | 3300032955 | Soil | EQIDAGNFEPAGFIVDLVAILTAIFGLALAAYLIYIELRF |
| Ga0316214_10056971 | 3300033545 | Roots | VRYRRVRTQLDAGKFEPAGFVVDLVTITMVLFGLALAAYLIYTQRSLVG |
| Ga0370515_0006195_5674_5820 | 3300034163 | Untreated Peat Soil | LRYRKTRAQLDAGTFEPAEFVLDFITILTVLFGLALAGYLIYTEKVLG |
| ⦗Top⦘ |