| Basic Information | |
|---|---|
| Family ID | F027910 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 193 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VSIVTLADLIEALAHPPDGRARISDDQLTALRAYQQRYGVR |
| Number of Associated Samples | 167 |
| Number of Associated Scaffolds | 193 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.04 % |
| % of genes near scaffold ends (potentially truncated) | 98.45 % |
| % of genes from short scaffolds (< 2000 bps) | 91.71 % |
| Associated GOLD sequencing projects | 159 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.927 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.979 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.870 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.150 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 193 Family Scaffolds |
|---|---|---|
| PF13511 | DUF4124 | 87.05 |
| PF00692 | dUTPase | 5.18 |
| PF04127 | DFP | 4.15 |
| PF00920 | ILVD_EDD | 1.04 |
| PF13505 | OMP_b-brl | 0.52 |
| PF00830 | Ribosomal_L28 | 0.52 |
| PF00156 | Pribosyltran | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 193 Family Scaffolds |
|---|---|---|---|
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 5.18 |
| COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 5.18 |
| COG0452 | Phosphopantothenoylcysteine synthetase/decarboxylase CoaBC | Coenzyme transport and metabolism [H] | 4.15 |
| COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 2.07 |
| COG0227 | Ribosomal protein L28 | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.93 % |
| Unclassified | root | N/A | 2.07 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000363|ICChiseqgaiiFebDRAFT_10683044 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300001471|JGI12712J15308_10151393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 600 | Open in IMG/M |
| 3300001593|JGI12635J15846_10221511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1235 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101208302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 645 | Open in IMG/M |
| 3300002568|C688J35102_118972401 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 620 | Open in IMG/M |
| 3300002909|JGI25388J43891_1021185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1137 | Open in IMG/M |
| 3300005176|Ga0066679_10024911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3225 | Open in IMG/M |
| 3300005184|Ga0066671_10080161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1755 | Open in IMG/M |
| 3300005338|Ga0068868_100757819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 873 | Open in IMG/M |
| 3300005341|Ga0070691_10784887 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
| 3300005406|Ga0070703_10440841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 575 | Open in IMG/M |
| 3300005434|Ga0070709_11157243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 620 | Open in IMG/M |
| 3300005436|Ga0070713_100920322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 841 | Open in IMG/M |
| 3300005436|Ga0070713_102027134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 558 | Open in IMG/M |
| 3300005451|Ga0066681_10643783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 650 | Open in IMG/M |
| 3300005526|Ga0073909_10238973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 803 | Open in IMG/M |
| 3300005530|Ga0070679_101240379 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 691 | Open in IMG/M |
| 3300005533|Ga0070734_10787818 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300005544|Ga0070686_101637903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 545 | Open in IMG/M |
| 3300005560|Ga0066670_10802325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 571 | Open in IMG/M |
| 3300005563|Ga0068855_101139449 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 814 | Open in IMG/M |
| 3300005577|Ga0068857_101321311 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
| 3300005586|Ga0066691_10209304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1137 | Open in IMG/M |
| 3300005591|Ga0070761_10413378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 824 | Open in IMG/M |
| 3300005602|Ga0070762_10573211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 747 | Open in IMG/M |
| 3300005618|Ga0068864_102665064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 506 | Open in IMG/M |
| 3300005719|Ga0068861_101717464 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
| 3300005764|Ga0066903_102498838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1000 | Open in IMG/M |
| 3300005764|Ga0066903_105147220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 692 | Open in IMG/M |
| 3300005834|Ga0068851_10676064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 634 | Open in IMG/M |
| 3300005921|Ga0070766_10052531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2295 | Open in IMG/M |
| 3300005921|Ga0070766_11100368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 548 | Open in IMG/M |
| 3300006176|Ga0070765_100852719 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 861 | Open in IMG/M |
| 3300006806|Ga0079220_12073009 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
| 3300009092|Ga0105250_10582211 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
| 3300009093|Ga0105240_12298271 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
| 3300009176|Ga0105242_11374609 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 732 | Open in IMG/M |
| 3300010043|Ga0126380_11402647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 614 | Open in IMG/M |
| 3300010046|Ga0126384_11218313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 695 | Open in IMG/M |
| 3300010047|Ga0126382_10564936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 929 | Open in IMG/M |
| 3300010048|Ga0126373_10797245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1006 | Open in IMG/M |
| 3300010048|Ga0126373_11045189 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 882 | Open in IMG/M |
| 3300010048|Ga0126373_11580865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 720 | Open in IMG/M |
| 3300010048|Ga0126373_12723262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 552 | Open in IMG/M |
| 3300010333|Ga0134080_10595310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 537 | Open in IMG/M |
| 3300010359|Ga0126376_11339742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 738 | Open in IMG/M |
| 3300010361|Ga0126378_11904928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 677 | Open in IMG/M |
| 3300010361|Ga0126378_12621050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 576 | Open in IMG/M |
| 3300010371|Ga0134125_11963519 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 636 | Open in IMG/M |
| 3300010373|Ga0134128_10713751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1113 | Open in IMG/M |
| 3300010373|Ga0134128_13186443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 504 | Open in IMG/M |
| 3300010375|Ga0105239_12770066 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 572 | Open in IMG/M |
| 3300010376|Ga0126381_100448130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1809 | Open in IMG/M |
| 3300010379|Ga0136449_102416650 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 757 | Open in IMG/M |
| 3300010396|Ga0134126_12123258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 613 | Open in IMG/M |
| 3300010401|Ga0134121_11173162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 766 | Open in IMG/M |
| 3300012199|Ga0137383_10660675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 764 | Open in IMG/M |
| 3300012203|Ga0137399_11169729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 648 | Open in IMG/M |
| 3300012205|Ga0137362_10237066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1574 | Open in IMG/M |
| 3300012205|Ga0137362_11514619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 557 | Open in IMG/M |
| 3300012683|Ga0137398_10043652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2620 | Open in IMG/M |
| 3300013105|Ga0157369_10031818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 5805 | Open in IMG/M |
| 3300013105|Ga0157369_10122076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2763 | Open in IMG/M |
| 3300013307|Ga0157372_12696030 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 570 | Open in IMG/M |
| 3300014150|Ga0134081_10027076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1642 | Open in IMG/M |
| 3300014658|Ga0181519_11071693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 501 | Open in IMG/M |
| 3300015357|Ga0134072_10024581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1530 | Open in IMG/M |
| 3300015374|Ga0132255_102198437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 841 | Open in IMG/M |
| 3300016270|Ga0182036_11019569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 683 | Open in IMG/M |
| 3300016319|Ga0182033_12170008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 507 | Open in IMG/M |
| 3300016357|Ga0182032_11138015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 670 | Open in IMG/M |
| 3300016387|Ga0182040_11737420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 533 | Open in IMG/M |
| 3300016404|Ga0182037_11722974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 559 | Open in IMG/M |
| 3300016404|Ga0182037_11898682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 533 | Open in IMG/M |
| 3300016445|Ga0182038_10078746 | Not Available | 2319 | Open in IMG/M |
| 3300017966|Ga0187776_11009570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 612 | Open in IMG/M |
| 3300018058|Ga0187766_10047368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2520 | Open in IMG/M |
| 3300018058|Ga0187766_10179962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1327 | Open in IMG/M |
| 3300018058|Ga0187766_10804175 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 657 | Open in IMG/M |
| 3300018062|Ga0187784_11218656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 597 | Open in IMG/M |
| 3300018085|Ga0187772_11328841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 532 | Open in IMG/M |
| 3300018090|Ga0187770_10330446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1190 | Open in IMG/M |
| 3300018090|Ga0187770_10418997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1053 | Open in IMG/M |
| 3300018429|Ga0190272_12412114 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 570 | Open in IMG/M |
| 3300019866|Ga0193756_1023708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 858 | Open in IMG/M |
| 3300019890|Ga0193728_1277611 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 652 | Open in IMG/M |
| 3300020150|Ga0187768_1117049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 611 | Open in IMG/M |
| 3300020170|Ga0179594_10223138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 708 | Open in IMG/M |
| 3300020580|Ga0210403_10893401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 701 | Open in IMG/M |
| 3300020580|Ga0210403_10998881 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
| 3300020581|Ga0210399_10291718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1362 | Open in IMG/M |
| 3300020583|Ga0210401_11273023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 593 | Open in IMG/M |
| 3300021086|Ga0179596_10637365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 540 | Open in IMG/M |
| 3300021088|Ga0210404_10714777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 571 | Open in IMG/M |
| 3300021170|Ga0210400_10642855 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 874 | Open in IMG/M |
| 3300021180|Ga0210396_10112301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2461 | Open in IMG/M |
| 3300021403|Ga0210397_10762399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 746 | Open in IMG/M |
| 3300021406|Ga0210386_10383248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1211 | Open in IMG/M |
| 3300021406|Ga0210386_10924871 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 746 | Open in IMG/M |
| 3300021433|Ga0210391_10846166 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 714 | Open in IMG/M |
| 3300021475|Ga0210392_10686154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 762 | Open in IMG/M |
| 3300021560|Ga0126371_13429879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 535 | Open in IMG/M |
| 3300022522|Ga0242659_1104280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 564 | Open in IMG/M |
| 3300022721|Ga0242666_1122649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 617 | Open in IMG/M |
| 3300022911|Ga0247783_1102490 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 783 | Open in IMG/M |
| 3300024290|Ga0247667_1061111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 697 | Open in IMG/M |
| 3300025914|Ga0207671_10314800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1238 | Open in IMG/M |
| 3300025920|Ga0207649_11071173 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 635 | Open in IMG/M |
| 3300025921|Ga0207652_11093399 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 698 | Open in IMG/M |
| 3300025939|Ga0207665_10514998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 926 | Open in IMG/M |
| 3300025949|Ga0207667_10114501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2780 | Open in IMG/M |
| 3300026273|Ga0209881_1064850 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 902 | Open in IMG/M |
| 3300026301|Ga0209238_1110527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 920 | Open in IMG/M |
| 3300026312|Ga0209153_1050475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1474 | Open in IMG/M |
| 3300026326|Ga0209801_1344131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300026329|Ga0209375_1028656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3044 | Open in IMG/M |
| 3300026523|Ga0209808_1054530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1809 | Open in IMG/M |
| 3300027505|Ga0209218_1067308 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 734 | Open in IMG/M |
| 3300027576|Ga0209003_1056543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 706 | Open in IMG/M |
| 3300027648|Ga0209420_1171870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 586 | Open in IMG/M |
| 3300027855|Ga0209693_10472717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 602 | Open in IMG/M |
| 3300027874|Ga0209465_10047756 | Not Available | 2044 | Open in IMG/M |
| 3300027889|Ga0209380_10687836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 588 | Open in IMG/M |
| 3300028800|Ga0265338_11093531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 537 | Open in IMG/M |
| 3300030524|Ga0311357_11833192 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
| 3300030573|Ga0210272_1286062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 526 | Open in IMG/M |
| 3300030906|Ga0302314_11787561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 538 | Open in IMG/M |
| 3300031128|Ga0170823_15229856 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
| 3300031231|Ga0170824_102886399 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 617 | Open in IMG/M |
| 3300031231|Ga0170824_126642008 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300031234|Ga0302325_12629903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 596 | Open in IMG/M |
| 3300031446|Ga0170820_10293329 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 837 | Open in IMG/M |
| 3300031456|Ga0307513_10807613 | Not Available | 644 | Open in IMG/M |
| 3300031474|Ga0170818_108380478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 550 | Open in IMG/M |
| 3300031545|Ga0318541_10209254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1080 | Open in IMG/M |
| 3300031549|Ga0318571_10219037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 688 | Open in IMG/M |
| 3300031561|Ga0318528_10171228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1159 | Open in IMG/M |
| 3300031564|Ga0318573_10365668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 774 | Open in IMG/M |
| 3300031572|Ga0318515_10524662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 631 | Open in IMG/M |
| 3300031573|Ga0310915_10958148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 598 | Open in IMG/M |
| 3300031640|Ga0318555_10083512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1665 | Open in IMG/M |
| 3300031680|Ga0318574_10393892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 809 | Open in IMG/M |
| 3300031681|Ga0318572_10605961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 652 | Open in IMG/M |
| 3300031713|Ga0318496_10786802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 524 | Open in IMG/M |
| 3300031718|Ga0307474_10035865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3649 | Open in IMG/M |
| 3300031720|Ga0307469_10056230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2510 | Open in IMG/M |
| 3300031724|Ga0318500_10156028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1076 | Open in IMG/M |
| 3300031751|Ga0318494_10868292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 529 | Open in IMG/M |
| 3300031753|Ga0307477_10917556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 577 | Open in IMG/M |
| 3300031754|Ga0307475_11513184 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300031770|Ga0318521_10156269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1297 | Open in IMG/M |
| 3300031777|Ga0318543_10172383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 956 | Open in IMG/M |
| 3300031778|Ga0318498_10556264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 503 | Open in IMG/M |
| 3300031779|Ga0318566_10599348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 536 | Open in IMG/M |
| 3300031779|Ga0318566_10623491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 524 | Open in IMG/M |
| 3300031782|Ga0318552_10587424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 568 | Open in IMG/M |
| 3300031793|Ga0318548_10465164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 619 | Open in IMG/M |
| 3300031797|Ga0318550_10298526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 781 | Open in IMG/M |
| 3300031819|Ga0318568_10047062 | Not Available | 2476 | Open in IMG/M |
| 3300031819|Ga0318568_10591401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 691 | Open in IMG/M |
| 3300031831|Ga0318564_10158101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1011 | Open in IMG/M |
| 3300031831|Ga0318564_10358595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 640 | Open in IMG/M |
| 3300031859|Ga0318527_10107113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1151 | Open in IMG/M |
| 3300031859|Ga0318527_10218902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 807 | Open in IMG/M |
| 3300031879|Ga0306919_11106803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 604 | Open in IMG/M |
| 3300031893|Ga0318536_10425752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 670 | Open in IMG/M |
| 3300031897|Ga0318520_11042092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 517 | Open in IMG/M |
| 3300031910|Ga0306923_12212563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 551 | Open in IMG/M |
| 3300031946|Ga0310910_10766082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 761 | Open in IMG/M |
| 3300031954|Ga0306926_11756445 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 706 | Open in IMG/M |
| 3300031962|Ga0307479_11863349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 552 | Open in IMG/M |
| 3300032025|Ga0318507_10210935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 839 | Open in IMG/M |
| 3300032025|Ga0318507_10451599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 559 | Open in IMG/M |
| 3300032054|Ga0318570_10258842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 789 | Open in IMG/M |
| 3300032055|Ga0318575_10355661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 742 | Open in IMG/M |
| 3300032063|Ga0318504_10049766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1756 | Open in IMG/M |
| 3300032067|Ga0318524_10040731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2182 | Open in IMG/M |
| 3300032089|Ga0318525_10107991 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1420 | Open in IMG/M |
| 3300032160|Ga0311301_11686100 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 764 | Open in IMG/M |
| 3300032174|Ga0307470_10218271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1234 | Open in IMG/M |
| 3300032180|Ga0307471_101507329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 830 | Open in IMG/M |
| 3300032180|Ga0307471_103014825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 597 | Open in IMG/M |
| 3300032180|Ga0307471_103655908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 544 | Open in IMG/M |
| 3300032895|Ga0335074_10602887 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1096 | Open in IMG/M |
| 3300032896|Ga0335075_11373106 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 598 | Open in IMG/M |
| 3300032898|Ga0335072_10350934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → unclassified Oxalobacteraceae → Oxalobacteraceae bacterium | 1615 | Open in IMG/M |
| 3300032898|Ga0335072_10554741 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1171 | Open in IMG/M |
| 3300032954|Ga0335083_10281772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1469 | Open in IMG/M |
| 3300032955|Ga0335076_10165452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2123 | Open in IMG/M |
| 3300033289|Ga0310914_10965436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 752 | Open in IMG/M |
| 3300033289|Ga0310914_11006533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 734 | Open in IMG/M |
| 3300033805|Ga0314864_0062196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 867 | Open in IMG/M |
| 3300033979|Ga0334978_0472180 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.18% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.66% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.66% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.63% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.11% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.11% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.11% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.59% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.55% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.55% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.04% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.04% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.04% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.04% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.04% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.52% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.52% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.52% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.52% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.52% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022911 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5 | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026273 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030573 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO036SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiFebDRAFT_106830442 | 3300000363 | Soil | SVITLAALIEALSSGASGASRISAEQLTALRAYRDRYGVA* |
| JGI12712J15308_101513932 | 3300001471 | Forest Soil | VSIVTLADLIEALSQTTDARARISAEQLTSLEAYRRRYGAL* |
| JGI12635J15846_102215113 | 3300001593 | Forest Soil | ELEQQQGLQCVSIVTLADLIEALSRPAKGRARISAEQLTALRAYQQRYGAA* |
| JGIcombinedJ26739_1012083021 | 3300002245 | Forest Soil | IVTLADLIEALSQTTDARARISAEQLTSLEAYRRRYGAL* |
| C688J35102_1189724012 | 3300002568 | Soil | QELESQHGLSCVSVVTLADLIETLSNPPDGRARISAEQLTSLRDYRQRYGVT* |
| JGI25388J43891_10211853 | 3300002909 | Grasslands Soil | GRDAASAVQELEQQQGLQCVSIVTLSELIEALSRPPDGHARVSAEQLTALRAYQQRYGAA |
| Ga0066679_100249111 | 3300005176 | Soil | LEEAYGLKCVSIVTLADLIEALSRPVGGRPRIAEDQLASLRAYRERYGVG* |
| Ga0066671_100801611 | 3300005184 | Soil | ELEQQQGLQCVSIVTLTELIEALSRPPDGHARVSAEQLTALRAYQQRYGAA* |
| Ga0068868_1007578191 | 3300005338 | Miscanthus Rhizosphere | AVQELEAEHGLKCVSVITLVALIEALSSGTGGSSRISAEQLTALRGYRERYGVA* |
| Ga0070691_107848872 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | QEIESTYGLKCVSVVTLTDLIEALARPVRGPARISAEQLTSLRAYREAFGVT* |
| Ga0070703_104408411 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | GLKCVSIITLADLIEALSQSADAPARISAEQLTSLKAYQVRYGVT* |
| Ga0070709_111572431 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | CVSIVTLAELIEALSHPADGRARISAEQLTSLKAYRQRFGVV* |
| Ga0070713_1009203222 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | CVSIVTLADLVEALTAPPDGRARISDDQLTALRAYQQRYGVR* |
| Ga0070713_1020271342 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | IRCVSVVTLADLIEALSRPGPGPARISADQLTSLRAYRDRYGIK* |
| Ga0066681_106437831 | 3300005451 | Soil | EQQQGLQCVSIVTLAELIEALSRPPDGQARVSAEQLTALRAYQERYGAA* |
| Ga0073909_102389732 | 3300005526 | Surface Soil | LADLIEALAHPPDGRARISDDQLTALRAYQQRYGVR* |
| Ga0070679_1012403792 | 3300005530 | Corn Rhizosphere | SVVTLADLIEALSRPAGGQAAISDDQLTLLKAYRERYGVA* |
| Ga0070734_107878182 | 3300005533 | Surface Soil | CVSIVTLADLIEALAQGSGTLARISAEHLTSMRAYRDRYGPS* |
| Ga0070686_1016379032 | 3300005544 | Switchgrass Rhizosphere | QELEQSQGVRCVSIVTLADLIEALAHPPDGRARISDDQLTALRAYQQRYGVR* |
| Ga0066670_108023251 | 3300005560 | Soil | EQQQGLQCVSIVTLTELIEALSGPPDGRARVSAEQLTALRAYQQRYGAA* |
| Ga0068855_1011394491 | 3300005563 | Corn Rhizosphere | ADLIETLSNPPDGRARISAEQLTSLRDYRQRYGVT* |
| Ga0068857_1013213111 | 3300005577 | Corn Rhizosphere | AEHGLKCVSVITLVALIEALSTGTGGSSRISAEQLTALKGYRERYGVA* |
| Ga0066691_102093043 | 3300005586 | Soil | ELIEALSRPPDGRARISAGQLTALRAYQQRYGAK* |
| Ga0070761_104133782 | 3300005591 | Soil | VTLSDLIEALSRPVSGPQRISVEQLAALMAYRARYGAT* |
| Ga0070762_105732112 | 3300005602 | Soil | ADLIEALSQTTDARARISAEQLTSLEAYRRRYGAL* |
| Ga0068864_1026650642 | 3300005618 | Switchgrass Rhizosphere | HGAPSAVQELESQHGLSCVSVVTLADLIETLSNPPDGRARISAEQLTSLRDYRQRYGVT* |
| Ga0068861_1017174641 | 3300005719 | Switchgrass Rhizosphere | VALIEALSSSTGGSSRISAEQLTALRGYRERYGVA* |
| Ga0066903_1024988381 | 3300005764 | Tropical Forest Soil | SAVQELKSQGLQCVSIVTLSELIEALEQPPRGRARISVEQLTALKAYRERYGAI* |
| Ga0066903_1051472201 | 3300005764 | Tropical Forest Soil | LRCVSIVTLADLIEALAHPPDGRARISDDQLTALRAYQQRYGVR* |
| Ga0068851_106760642 | 3300005834 | Corn Rhizosphere | ATSAVQELESQHGLSCVSVVTLADLIETLSNPPDGRARISAEQLTSLRDYRQRYGVT* |
| Ga0070766_100525314 | 3300005921 | Soil | CVSIVTLDDLIEALAHPADGRARISEEQLTALRAYRQRYGAR* |
| Ga0070766_111003681 | 3300005921 | Soil | DLKCVSIVTLSDLIEALSHPTGGVPGISAQQLTELDAYRARYGAR* |
| Ga0070765_1008527192 | 3300006176 | Soil | SIVTLADLIETLSRPADGRVRISAEQLTSLRAYRERYGAG* |
| Ga0079220_120730092 | 3300006806 | Agricultural Soil | LADLIEALSSPAERRARISDDQLTALRAYRERYGIH* |
| Ga0105250_105822112 | 3300009092 | Switchgrass Rhizosphere | HGLSCVSVVTLADLIETLSNPPDGRARISAEQLTSLRDYRQRYGVT* |
| Ga0105240_122982712 | 3300009093 | Corn Rhizosphere | VVTLADLIETLSNPPDGRARISAEQLTSLREYRQRYGVT* |
| Ga0105242_113746091 | 3300009176 | Miscanthus Rhizosphere | VQELEAEHGLKCVSVITLAALIEALSSGSGSSSRISAEQLTALRAYREQYGVA* |
| Ga0126380_114026471 | 3300010043 | Tropical Forest Soil | TLADLIEALTRGPDGRARISDDQLTALRAYQERYGVR* |
| Ga0126384_112183131 | 3300010046 | Tropical Forest Soil | LRCVSIITLADLIEALTRGPDGRARISDDQLTALRAYQERYGVR* |
| Ga0126382_105649363 | 3300010047 | Tropical Forest Soil | VTLSDLIEALSRPAAGKARVSAEQLTALNAYRARYGAR* |
| Ga0126373_107972451 | 3300010048 | Tropical Forest Soil | RCVSIITLADLIEALAQPSAGRARISDDQLTALRAYQQRYGMQ* |
| Ga0126373_110451892 | 3300010048 | Tropical Forest Soil | EKLKCVSIVTLSDLIEALTRPAGGLQPVSAEQLAALTAYRARYGAR* |
| Ga0126373_115808651 | 3300010048 | Tropical Forest Soil | TEGLRCVSIITLADLIEALTRRPDGRARISDDQLTALRAYQQRYGVP* |
| Ga0126373_127232621 | 3300010048 | Tropical Forest Soil | QGNLSAVQELERAEGLKCVSIVTLSDLIEALTAPATGAPRISAEHLTQLRAYRARYGAR* |
| Ga0134080_105953102 | 3300010333 | Grasslands Soil | HELEQQQGLQCVSIVTLADLIEALARPADGRARVSAEQLTALRAYQQRYGAA* |
| Ga0126376_113397422 | 3300010359 | Tropical Forest Soil | CVSIITLADLIEALSQSADGRVRISDEQLTALRAYRERYGPR* |
| Ga0126378_119049282 | 3300010361 | Tropical Forest Soil | SDLIEALSRPAAGKARVSAEQLTALNAYRERYGAR* |
| Ga0126378_126210502 | 3300010361 | Tropical Forest Soil | LKCVSVVTLSGLIEALSRPADGKPRISAEQLAALSAYRARYGAR* |
| Ga0134125_119635191 | 3300010371 | Terrestrial Soil | EHGIPCVSVVTLSDLIEALSRPAGARAAISADQLTLLRAYRERYGVA* |
| Ga0134128_107137513 | 3300010373 | Terrestrial Soil | CVSIVTLADLIEALSSPAERRARISDDQLTALRVYRERYGIH* |
| Ga0134128_131864431 | 3300010373 | Terrestrial Soil | TLADLIEALSQPTDGRVRISAEQLTALRGYRQRYGPR* |
| Ga0105239_127700662 | 3300010375 | Corn Rhizosphere | VVTLTDLIEALARPVRGPARISAEQLTSLRAYREAFGVT* |
| Ga0126381_1004481301 | 3300010376 | Tropical Forest Soil | VERTYGLCCVSIVTLADLIEALSQPPDGRVRISDEQLTALKAYQSRYGAR* |
| Ga0136449_1024166501 | 3300010379 | Peatlands Soil | SIVTLADLIETLSRAADGRVRISAEQLTSLRAYRERYGAG* |
| Ga0134126_121232582 | 3300010396 | Terrestrial Soil | TYGLKCVSVITLTDLIDALSRPPRGPTRISAEQLTSLRAYRQAFGVI* |
| Ga0134121_111731622 | 3300010401 | Terrestrial Soil | RCVSIITLADLIEALSQPTDGRVRISAEQLTALRGYRQRYGPR* |
| Ga0137383_106606752 | 3300012199 | Vadose Zone Soil | LEQQQGLQCVSIVTLADLIEALARPADGRARVSAEQLTALRAYQQRYGAA* |
| Ga0137399_111697292 | 3300012203 | Vadose Zone Soil | VTLSDLIEALSRPPAGRARISAGQLTALRAYHQRYGAA* |
| Ga0137362_102370661 | 3300012205 | Vadose Zone Soil | VSIVTLADLIEALSRPPAGRARISAEQLTALRAYQQRYGAE* |
| Ga0137362_115146192 | 3300012205 | Vadose Zone Soil | VSIVTLADLIEALSRPPAGRARISAEQLTALRAYQQRYGAV* |
| Ga0137398_100436521 | 3300012683 | Vadose Zone Soil | QGPLSAVQELERSEGVRCVSIVTLAELIEALSQPPDGRPRISDGQLAALCEYQRRFGAA* |
| Ga0157369_100318189 | 3300013105 | Corn Rhizosphere | VSVVTLADLIDALSRPGSGPARISADQLTSLRAYRDRYGIT* |
| Ga0157369_101220764 | 3300013105 | Corn Rhizosphere | LRCVSVITLAELIEALARPARGPARISAEQLTSLRAYREAFGVT* |
| Ga0157372_126960301 | 3300013307 | Corn Rhizosphere | VQEVEKEHGLECVSIVTLADLIDTLARPTDGRARISAEQLTSLRAYRERYGAS* |
| Ga0134081_100270761 | 3300014150 | Grasslands Soil | QQGLQCVSIVTLSELIEALSRPPDGHARVSAEQLTALRAYQQRYGAA* |
| Ga0181519_110716931 | 3300014658 | Bog | VETAEGLRCVSIVTLADLIEALSQVTDGHARISAEQLTSLQAYRRRYGVL* |
| Ga0134072_100245813 | 3300015357 | Grasslands Soil | VVPQELEQQQGLQCVSIVTLAELIEALSRPPDGQARVSAEQLTALRAYQERYGAA* |
| Ga0132255_1021984372 | 3300015374 | Arabidopsis Rhizosphere | ADLIEALTAPRNGRSRISDDQLTALRAYRERYGIH* |
| Ga0182036_110195692 | 3300016270 | Soil | QGLRCVSIVTLADLIEALAHPPDGRARISDDQLTALRAYQQRYGVC |
| Ga0182033_121700082 | 3300016319 | Soil | LRCVSIITLANLIEALTQPPDGRVRISDDQLTALRAYQERYGVR |
| Ga0182032_111380152 | 3300016357 | Soil | ADLIEALTRGPDGRARISDDQLTALRAYQARYGVC |
| Ga0182040_117374201 | 3300016387 | Soil | IITLADLIEALTQGPDRRARISDDQLTALRAYQQRYGVR |
| Ga0182037_117229741 | 3300016404 | Soil | VERSEGLRCVSIITLADLIEALTRGPDGRARISDDQLTALRAYQARYGVC |
| Ga0182037_118986822 | 3300016404 | Soil | ADLIETLAHPPDGRARISDDQLTALQAYQQRYGVR |
| Ga0182038_100787461 | 3300016445 | Soil | GVRCVSIVTLADLIEALAHPPDGRPRISADQLTALRAYQQRYGVR |
| Ga0187776_110095702 | 3300017966 | Tropical Peatland | IVTLAELIEALSRPADSRARISDEQLTALRAYQERFGAP |
| Ga0187766_100473684 | 3300018058 | Tropical Peatland | SDLIEALSRPTGGKPRISAEQLAELRAYRARYGAR |
| Ga0187766_101799623 | 3300018058 | Tropical Peatland | GLKCVSIVTLAELIEALSRPADARARISDEQLTALRLYQERFGAP |
| Ga0187766_108041751 | 3300018058 | Tropical Peatland | AVQELERGEGLKCVSVVTLSDLIEALSRPAHGKSRISAEQLAQLRAYRARYGAR |
| Ga0187784_112186562 | 3300018062 | Tropical Peatland | QELEQTEGLKCVSIVTLAGLIEALARPADGRARISDDQLTALRAYQARYGAG |
| Ga0187772_113288411 | 3300018085 | Tropical Peatland | AVQELEQREGLKCVSVVTLEDLVEALALPPDGRMRISDEQLTALRAYRQRYGPR |
| Ga0187770_103304463 | 3300018090 | Tropical Peatland | CVSIVTLADLIEALAGPRAAGSGISADQLTALRAYRARYGVC |
| Ga0187770_104189971 | 3300018090 | Tropical Peatland | VSIVTLADLVEALAHPSDGRMRISDEQLTALRTYRERYGPR |
| Ga0190272_124121141 | 3300018429 | Soil | LKCVSVITLAALIEALSSGAGGPARISADQLTALKAYRERYGVS |
| Ga0193756_10237082 | 3300019866 | Soil | QELEQQQGLQCVSIVTLSDLIEALSRPPAGGARISVEQLTALRAYQQRYGAA |
| Ga0193728_12776112 | 3300019890 | Soil | QEIESEHGLTCVSIITLAELIETLSQPPDGQVRISAEQLTSLLAYRQRYGVS |
| Ga0187768_11170492 | 3300020150 | Tropical Peatland | ITLADLIEALTRGPDGRARISDDQLTALRAYQQRYGVR |
| Ga0179594_102231381 | 3300020170 | Vadose Zone Soil | GLQCVSILTLAELIEALSRPPADGRARISAEQLTALRAYQQRYGAK |
| Ga0210403_108934011 | 3300020580 | Soil | LGCGSLVTLTELIEALSHSADAAARISAEQLTSLQAYRQRYGIL |
| Ga0210403_109988812 | 3300020580 | Soil | IVTLTDLIETLSRPADGRVRISAEQLTSLRAYRERYGGG |
| Ga0210399_102917183 | 3300020581 | Soil | VSIVTLAELIEALSRPLDGQERISAEQLTALRTYQTRYGAP |
| Ga0210401_112730232 | 3300020583 | Soil | LKCVSIVTLTELIEALSHGADAATRISAEQLTSLQAYRQRYGIL |
| Ga0179596_106373652 | 3300021086 | Vadose Zone Soil | CVSIVTLSDLIEALSRPPVGRARISAEQLTALRAYQQRYGAA |
| Ga0210404_107147772 | 3300021088 | Soil | LQCVSIVTLSDLIEAVSRPPAGRARISAEQLTALRAYQQRYGAA |
| Ga0210400_106428551 | 3300021170 | Soil | EVEKEHGLQCVSIVTLADLIEALSRPADGRVRISAEQLTSLRAYRERYGAG |
| Ga0210396_101123011 | 3300021180 | Soil | GLKCVSVVTLSDLIEALSRGTSGTQPVTEEQLRALNAYRARYGAR |
| Ga0210397_107623992 | 3300021403 | Soil | LKCVSIVTLSELIEALSHGADAAARISAEQLTSLQAYRQRYGIL |
| Ga0210386_103832481 | 3300021406 | Soil | IVTLTDLIETLARPADGRVRISAEQLTSLRAYRERYGGA |
| Ga0210386_109248711 | 3300021406 | Soil | VQEVEKEHGLKCVSIVTLADLIDTLSRAGDGRERISAEQLTSLRAYRERYGVR |
| Ga0210391_108461662 | 3300021433 | Soil | SLKCVSIVTLSDLIEALSHPTGGVPGISAQQLTELDAYRARYGAR |
| Ga0210392_106861542 | 3300021475 | Soil | VQEVEREHGLKCVSIVTLADLIETLSRAADGRVRISAEQLTSLRAYRERYGAG |
| Ga0126371_134298792 | 3300021560 | Tropical Forest Soil | CVSIVTLADLIDALSQPADGRVRISDEQLTALRAYQARYGAQ |
| Ga0242659_11042802 | 3300022522 | Soil | TAVQELEEQGLHCVSIVTLDDLIEALAHPADGRTRISDEQLTALRTYRRRYGTH |
| Ga0242666_11226491 | 3300022721 | Soil | CVSIVTLDDLIETLAHPADGRTRISDEQLTALRTYRRRYGAH |
| Ga0247783_11024901 | 3300022911 | Plant Litter | EAEHGLKCVSVVTLTTLIEMLSSSADGRSRVSADQLTTLKAYRERYGVS |
| Ga0247667_10611112 | 3300024290 | Soil | SIITLADLIEALSQRTDGRVRISAEQLTALRAYRQRYGPR |
| Ga0207671_103148003 | 3300025914 | Corn Rhizosphere | LKCVSIITLADLIEALSQSADAPARISAEQLTSLKAYQVRYGVT |
| Ga0207649_110711731 | 3300025920 | Corn Rhizosphere | VTLTDLIEALARPVRGPARISAEQLTSLRAYREAFGVT |
| Ga0207652_110933992 | 3300025921 | Corn Rhizosphere | SVVTLADLIEALSRPAGGQAAISDDQLTLLKAYRERYGVA |
| Ga0207665_105149981 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | SVSIVILADLIEALSSPAERRARISDDQLTALRVYRERYGIH |
| Ga0207667_101145014 | 3300025949 | Corn Rhizosphere | TYGLRCVSVITLAELIEALARPARGPARISAEQLTSLRAYREAFGVT |
| Ga0209881_10648502 | 3300026273 | Soil | VTLAELIDALSNPPDGQVRISAEQLTSLLAYRQRYGVS |
| Ga0209238_11105272 | 3300026301 | Grasslands Soil | VHELEQQQGLQCVSIVTLADLIEALARPADGRARVSAEQLTALRAYQQRYGSA |
| Ga0209153_10504752 | 3300026312 | Soil | VSIVTLTELIEALSRPPDGPARISAEQLTALRAYQQRYGAA |
| Ga0209801_13441311 | 3300026326 | Soil | CVSIVTLAELIEALSQPPDGPVRISDGQLAALREYQRRFGAA |
| Ga0209375_10286561 | 3300026329 | Soil | TLTELIEALSGPPDGRARVSAEQLTALRAYQQRYGAA |
| Ga0209808_10545301 | 3300026523 | Soil | SAVQELERSEGVRCVSIVTLAELIEALSQPPDGRARISDGQLGGLREYQRRFGAA |
| Ga0209218_10673082 | 3300027505 | Forest Soil | SIITLADLIAALSQPADGRARISDEQLTALRAYQERYGAR |
| Ga0209003_10565431 | 3300027576 | Forest Soil | VTLAELIATLTAPPDGRARISDDQLTALRAYRERYGVR |
| Ga0209420_11718702 | 3300027648 | Forest Soil | ITLTDLIAALSQPADGRARISAEQLTALRAYQERYGAR |
| Ga0209693_104727172 | 3300027855 | Soil | CVSIVTLSDLIEALSHPTGGVPGISAQQLTELDAYRARYGAR |
| Ga0209465_100477564 | 3300027874 | Tropical Forest Soil | LADLIEALTRGPDQRARISDDQLTALRAYQQRYGVR |
| Ga0209380_106878362 | 3300027889 | Soil | DLKCVSIVTLSDLIEALSHPTGGVPGISAQQLTELDAYRARYGAR |
| Ga0265338_110935312 | 3300028800 | Rhizosphere | EVETAEGLKCVSIVTLADLIEALSQVTDGHARISAEQLTSLQAYRRRYGVL |
| Ga0311357_118331921 | 3300030524 | Palsa | GLKCVSIVTLTDLIETLSRPADGRVRISAEQLTSLRVYRERYGAG |
| Ga0210272_12860621 | 3300030573 | Soil | EKDYGLKCVSIVTLADLIEALARPIGGQRRISDEQLTALAAYQSRYGV |
| Ga0302314_117875612 | 3300030906 | Palsa | ELEQDQGLRCVSIVTLAGLIEALARPAAGRARISDEQLTALRAYQGHYGAG |
| Ga0170823_152298561 | 3300031128 | Forest Soil | QHGLTCVSVVTLADLIETLSKPPDGRGRISAEQLTSLLAYRQRYGVS |
| Ga0170824_1028863992 | 3300031231 | Forest Soil | QHGLTCVSIITLADLIETLSRPPDGQVRISAEQLTSLLAYRQRYGVS |
| Ga0170824_1266420081 | 3300031231 | Forest Soil | LTCVSVVTLADLIETLSQPPDGQARISAEQLTSLRAYRQRYGVS |
| Ga0302325_126299032 | 3300031234 | Palsa | GMPCVSIVTLAELIEALARKSDGRARISDEQLTALRAYRERYGAR |
| Ga0170820_102933292 | 3300031446 | Forest Soil | LTCVSVVTLADLIETLSNPPDGRVRISAEQLTSLRDYRQRYGVS |
| Ga0307513_108076132 | 3300031456 | Ectomycorrhiza | VSVITLATLIETLSTDAAGASRISADQLTALRAYRERYGVS |
| Ga0170818_1083804781 | 3300031474 | Forest Soil | VTLADLIETLSRAADGRVRISAEQLTSLRAYRERYGAG |
| Ga0318541_102092541 | 3300031545 | Soil | TEGLRCVSIITLADLIEALTRGPDGRARISDDQLTALRAYQQRYGVR |
| Ga0318571_102190372 | 3300031549 | Soil | VSIVTLADLIEALAHPPDGRARISDDQLTALRAYQQRYGVC |
| Ga0318528_101712283 | 3300031561 | Soil | GLRCVSIITLADLIEALTRGPDGRARISDDQLTALRAYQARYGVC |
| Ga0318573_103656681 | 3300031564 | Soil | CVSIVTLADLIEALAHPPDGRARISDDQLTALRAYQQRYGLR |
| Ga0318515_105246622 | 3300031572 | Soil | ITLANLIEALTRGPDGRARISDDQLTALRAYQQRYGVR |
| Ga0310915_109581482 | 3300031573 | Soil | TLADLIEALAHPPDGRARISDDQLTALRAYQQRYGVR |
| Ga0318555_100835121 | 3300031640 | Soil | VSIITLADLIEALARPPDGRARISDDQLTALRAYQQRYGVR |
| Ga0318574_103938922 | 3300031680 | Soil | TYGLRCVSIVTLADLIEALSRPPDGRVRISDEQLTALKAYLTRYGAR |
| Ga0318572_106059611 | 3300031681 | Soil | VSIVTLADLIEALAHPPDGRARISDDQLTALRAYQQRYGLR |
| Ga0318496_107868021 | 3300031713 | Soil | CVSIVTLADLIEALSAAAGGPARISAEQLTSLKAYRERYGAA |
| Ga0307474_100358656 | 3300031718 | Hardwood Forest Soil | ADLVEALAHPADGRARISDDQLTALRAYQQRYGVS |
| Ga0307469_100562301 | 3300031720 | Hardwood Forest Soil | AESQGLRCVSIVTLADLVEALTAPPDGRARISDDQLTALRAYQQRYGVR |
| Ga0318500_101560283 | 3300031724 | Soil | VSIITLADLIEALTRGPDQRTRISDDQLTALRAYQQRYGVR |
| Ga0318494_108682922 | 3300031751 | Soil | ERSEGLRCVSIITLADLIEALTRGPDGRARISDDQLTALRAYQERYGVR |
| Ga0307477_109175562 | 3300031753 | Hardwood Forest Soil | GLKCVSIVTLADLIEALSRPVGGRPRISEDQLSSLRAYRERYGVT |
| Ga0307475_115131842 | 3300031754 | Hardwood Forest Soil | HGLKCVSIVTLTDLIDTLARATDGRVRISAEQLTSLRAYRERYGAN |
| Ga0318521_101562691 | 3300031770 | Soil | VSIVTLADLIEALAHPPDGRARISDDQLTALRAYQQRYGVR |
| Ga0318543_101723832 | 3300031777 | Soil | ELEQSQGVRCVSIVTLADLIEALAHPPDGRARISDDQLTALRAYQQRYGVR |
| Ga0318498_105562642 | 3300031778 | Soil | RCVSIITLADLIEALTQGPDRRARISDDQLTALRAYQQRYGVR |
| Ga0318566_105993481 | 3300031779 | Soil | SAVQELEQAHGVRCVSIVTLADLIEALARPSQGRARISDDQLTALRAYRERYGVR |
| Ga0318566_106234912 | 3300031779 | Soil | IEQTQGLRCVSIVTLADLIEALAHPPDGRARISDDQLTALRAYQQRYGLR |
| Ga0318552_105874242 | 3300031782 | Soil | QGLRCVSIVTLADLIEALAHPPDGRARISDDQLTALRAYQQRYGLR |
| Ga0318548_104651642 | 3300031793 | Soil | QTEGLRCVSIITLANLIEALTRGPDGRARISDDQLTALRAYQQRYGVR |
| Ga0318550_102985261 | 3300031797 | Soil | CVSIITLADLIEALTRGPDGRARISDDQLTALRAYQARYGVC |
| Ga0318568_100470624 | 3300031819 | Soil | SQGVRCVSIVTLADLIEALAHPPDGRARISDDQLTALRAYQQRYGVR |
| Ga0318568_105914012 | 3300031819 | Soil | VTLADLIEALARPADGRARISDDQLTALRAYQQRYGVR |
| Ga0318564_101581013 | 3300031831 | Soil | TLADLIEALAHPPDGRARISDDQLTALRAYQQRYGLR |
| Ga0318564_103585952 | 3300031831 | Soil | VSIITLADLIEALTRGPDGRARISDDQLTALRAYQARYGVC |
| Ga0318527_101071131 | 3300031859 | Soil | VEQAEGLRCVSIITLADLIEALTRGPDGRARISDDQLTALRAYQARYGVC |
| Ga0318527_102189021 | 3300031859 | Soil | VSIITLADLIEALTQPADGRVRISDDQLTALRAYQERYGVR |
| Ga0306919_111068032 | 3300031879 | Soil | LADLIEALARPPDGRARISDDQLTALRAYQQRYGVR |
| Ga0318536_104257521 | 3300031893 | Soil | CVSIITLADLIEALARAPDGRARISDDQLTALRAYQQRYGVR |
| Ga0318520_110420922 | 3300031897 | Soil | ITLADLIEALTQGPDRRARISDDQLTALRAYQQRYGVR |
| Ga0306923_122125631 | 3300031910 | Soil | ITLADLIEALARPPDGRARISDDQLTALRAYQQRYGVR |
| Ga0310910_107660821 | 3300031946 | Soil | SIITLADLIEALTRGPDGRARISDDQLTALRAYQARYGVC |
| Ga0306926_117564451 | 3300031954 | Soil | VSIITLSDLVSALSQPRDGRTRISAEQLTLLTAYRDRYGVN |
| Ga0307479_118633491 | 3300031962 | Hardwood Forest Soil | TLSDLIEALERPASGQPRISAEQLTQLRAYRARYGAR |
| Ga0318507_102109352 | 3300032025 | Soil | TQGLRCVSIVTLADLIEALAHPPDGRARISDDQLTALRAYQQRYGLR |
| Ga0318507_104515992 | 3300032025 | Soil | ITLADLIEALTRGPDGRARISDDQLTALRAYQARYGVC |
| Ga0318570_102588422 | 3300032054 | Soil | LRCVSIVTLADLIEALTQPADGRVRISDDQLTALRAYQERYGVR |
| Ga0318575_103556612 | 3300032055 | Soil | QTERLRCVSIITLADLIEALTRGPDGRARISDDQLTALRAYHARYGVC |
| Ga0318504_100497661 | 3300032063 | Soil | LANLIEALTRGPDGRARISDDQLTALRAYQQRYGVR |
| Ga0318524_100407314 | 3300032067 | Soil | VQELEQSQGVRCVSIVTLADLIEALAHPPDGRARISDDQLTALRAYQQRYGVR |
| Ga0318525_101079911 | 3300032089 | Soil | VTLADLIEALAHPPDGRARISDDQLTALRAYQQRYGVR |
| Ga0311301_116861002 | 3300032160 | Peatlands Soil | SIVTLADLIETLSRAADGRVRISAEQLTSLRAYRERYGAG |
| Ga0307470_102182711 | 3300032174 | Hardwood Forest Soil | TLADLVEALTAPPDGRARISDDQLTALRAYQQRYGVR |
| Ga0307471_1015073292 | 3300032180 | Hardwood Forest Soil | VQELERSEGVRCVSIVTLAELIEALSQPPDGRPRVSAGQLAALREYQRRFGAA |
| Ga0307471_1030148252 | 3300032180 | Hardwood Forest Soil | LSDLIEALERPAAGEPRISAEQLTQLRAYRARYGAG |
| Ga0307471_1036559082 | 3300032180 | Hardwood Forest Soil | AELIEALSHPADGLARISAEQLTSLKAYRQRFGVV |
| Ga0335074_106028871 | 3300032895 | Soil | EHGIPCVSVITLAGLIEALSRPHQGRVAISDDQLTLLKAYRQRYGVS |
| Ga0335075_113731061 | 3300032896 | Soil | RCVSVITLGRLIETLSGPAAARARISAEQLTSLKLYRQRYGAG |
| Ga0335072_103509341 | 3300032898 | Soil | VSVVTLGDLIEALSRGRDGRPAISDDQLTMLKAYRQRYGVS |
| Ga0335072_105547413 | 3300032898 | Soil | GALSATQEIESEHGIPCVSVITLAGLIEALSRPHQGRVAISDDQLTLLKAYRQRYGVS |
| Ga0335083_102817724 | 3300032954 | Soil | ADLIETLSRPPDGRSRISAEQLTSLLAYRQRYGVS |
| Ga0335076_101654524 | 3300032955 | Soil | FGLACVSVITLADLIETLSRPPDGRSRISAEQLTSLLAYRQRYGVS |
| Ga0310914_109654361 | 3300033289 | Soil | GLRCVSIITLADLIEALARPPDGRARISDDQLTALRAYQQRYGVR |
| Ga0310914_110065331 | 3300033289 | Soil | SEGLRCVSIITLADLIEALTRGPDGRARISDDQLTALRAYQERYGVR |
| Ga0314864_0062196_696_866 | 3300033805 | Peatland | ASAVQELERAEGVKCVSIITLSGLIEALTAPAGARPRITAEQLTALRAYRERYGAR |
| Ga0334978_0472180_17_142 | 3300033979 | Freshwater | VSLVTLADLIELASGPSGERFRISADQLNLLRQYRERYGTE |
| ⦗Top⦘ |