NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F027906

Metagenome / Metatranscriptome Family F027906

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F027906
Family Type Metagenome / Metatranscriptome
Number of Sequences 193
Average Sequence Length 44 residues
Representative Sequence VGTAPASAREALDMIRAGLGYLAAADAAQLPAATQAECLRELE
Number of Associated Samples 154
Number of Associated Scaffolds 193

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 97.30 %
% of genes near scaffold ends (potentially truncated) 93.78 %
% of genes from short scaffolds (< 2000 bps) 89.12 %
Associated GOLD sequencing projects 143
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (56.995 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(17.098 % of family members)
Environment Ontology (ENVO) Unclassified
(37.306 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(56.995 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 46.48%    β-sheet: 0.00%    Coil/Unstructured: 53.52%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 193 Family Scaffolds
PF00892EamA 3.11
PF04072LCM 2.59
PF13546DDE_5 2.59
PF13586DDE_Tnp_1_2 2.07
PF00004AAA 1.55
PF12697Abhydrolase_6 1.55
PF02781G6PD_C 1.55
PF10604Polyketide_cyc2 1.55
PF08241Methyltransf_11 1.04
PF07690MFS_1 1.04
PF13340DUF4096 1.04
PF12840HTH_20 1.04
PF01872RibD_C 1.04
PF01337Barstar 1.04
PF02566OsmC 1.04
PF01609DDE_Tnp_1 1.04
PF04672Methyltransf_19 0.52
PF03951Gln-synt_N 0.52
PF01053Cys_Met_Meta_PP 0.52
PF01965DJ-1_PfpI 0.52
PF13424TPR_12 0.52
PF04679DNA_ligase_A_C 0.52
PF13649Methyltransf_25 0.52
PF02687FtsX 0.52
PF07883Cupin_2 0.52
PF00881Nitroreductase 0.52
PF00441Acyl-CoA_dh_1 0.52
PF10009DUF2252 0.52
PF13977TetR_C_6 0.52
PF02899Phage_int_SAM_1 0.52
PF07366SnoaL 0.52
PF00112Peptidase_C1 0.52
PF04174CP_ATPgrasp_1 0.52
PF01381HTH_3 0.52
PF00589Phage_integrase 0.52
PF03176MMPL 0.52
PF00392GntR 0.52
PF00270DEAD 0.52
PF00041fn3 0.52
PF03781FGE-sulfatase 0.52
PF05598DUF772 0.52
PF12680SnoaL_2 0.52
PF00583Acetyltransf_1 0.52
PF03551PadR 0.52
PF02909TetR_C_1 0.52
PF13359DDE_Tnp_4 0.52
PF00196GerE 0.52
PF02627CMD 0.52

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 193 Family Scaffolds
COG3315O-Methyltransferase involved in polyketide biosynthesisSecondary metabolites biosynthesis, transport and catabolism [Q] 2.59
COG0364Glucose-6-phosphate 1-dehydrogenaseCarbohydrate transport and metabolism [G] 1.55
COG3293TransposaseMobilome: prophages, transposons [X] 1.04
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 1.04
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 1.04
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 1.04
COG2732Barstar, RNAse (barnase) inhibitorTranscription [K] 1.04
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 1.04
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 1.04
COG5421TransposaseMobilome: prophages, transposons [X] 1.04
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 1.04
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 1.04
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 1.04
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 0.52
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.52
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.52
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.52
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.52
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 0.52
COG2308Circularly permuted ATP-grasp proteinGeneral function prediction only [R] 0.52
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.52
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.52
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 0.52
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.52
COG0174Glutamine synthetaseAmino acid transport and metabolism [E] 0.52
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.52
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.52
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.52
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.52
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.52
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 0.52
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.52
COG1309DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmATranscription [K] 0.52
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.52
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.52
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.52
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.52
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.52
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.52


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms56.99 %
UnclassifiedrootN/A43.01 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573000|GPBTN7E02JQJ9UNot Available506Open in IMG/M
2189573002|GZIGXIF02HG27WNot Available521Open in IMG/M
3300004479|Ga0062595_101163380Not Available681Open in IMG/M
3300005180|Ga0066685_10939490All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300005338|Ga0068868_101676818Not Available599Open in IMG/M
3300005355|Ga0070671_100692745All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300005366|Ga0070659_100451304All Organisms → cellular organisms → Bacteria → Terrabacteria group1091Open in IMG/M
3300005434|Ga0070709_10050831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → unclassified Kitasatospora → Kitasatospora sp. SolWspMP-SS2h2598Open in IMG/M
3300005435|Ga0070714_100891330All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300005435|Ga0070714_101517509Not Available654Open in IMG/M
3300005435|Ga0070714_101522494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia653Open in IMG/M
3300005436|Ga0070713_100539813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1103Open in IMG/M
3300005436|Ga0070713_101399016Not Available678Open in IMG/M
3300005439|Ga0070711_101635523Not Available563Open in IMG/M
3300005439|Ga0070711_102025267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia506Open in IMG/M
3300005454|Ga0066687_10745414All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. URHB0020583Open in IMG/M
3300005458|Ga0070681_10911323All Organisms → cellular organisms → Bacteria → Terrabacteria group798Open in IMG/M
3300005468|Ga0070707_102248962Not Available513Open in IMG/M
3300005471|Ga0070698_101898043All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300005546|Ga0070696_100698592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. TLI_185827Open in IMG/M
3300005549|Ga0070704_102102434Not Available525Open in IMG/M
3300005563|Ga0068855_101484204Not Available697Open in IMG/M
3300005578|Ga0068854_100392338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia acaciae1146Open in IMG/M
3300005614|Ga0068856_100461198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1291Open in IMG/M
3300005983|Ga0081540_1279518Not Available576Open in IMG/M
3300006028|Ga0070717_11183810Not Available696Open in IMG/M
3300006176|Ga0070765_102237457Not Available510Open in IMG/M
3300006755|Ga0079222_11204977All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300006804|Ga0079221_10448012All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300006804|Ga0079221_10917832Not Available645Open in IMG/M
3300006871|Ga0075434_100652490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1071Open in IMG/M
3300006871|Ga0075434_101300913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria738Open in IMG/M
3300006954|Ga0079219_11580016All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300009090|Ga0099827_10992440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria728Open in IMG/M
3300009098|Ga0105245_10608404Not Available1120Open in IMG/M
3300009098|Ga0105245_11537183All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300009098|Ga0105245_12432555Not Available577Open in IMG/M
3300009143|Ga0099792_10314124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria934Open in IMG/M
3300009177|Ga0105248_10362967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1631Open in IMG/M
3300010043|Ga0126380_10153579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1478Open in IMG/M
3300010371|Ga0134125_10060539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4211Open in IMG/M
3300010373|Ga0134128_10303254All Organisms → cellular organisms → Bacteria1789Open in IMG/M
3300010373|Ga0134128_10522113All Organisms → cellular organisms → Bacteria1323Open in IMG/M
3300010373|Ga0134128_11201857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium836Open in IMG/M
3300010375|Ga0105239_10856904All Organisms → cellular organisms → Bacteria → Terrabacteria group1042Open in IMG/M
3300010375|Ga0105239_11970484All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300010375|Ga0105239_13413532Not Available517Open in IMG/M
3300010396|Ga0134126_11130046Not Available873Open in IMG/M
3300010396|Ga0134126_11172893Not Available854Open in IMG/M
3300010396|Ga0134126_11408141Not Available770Open in IMG/M
3300010396|Ga0134126_12960348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria513Open in IMG/M
3300010876|Ga0126361_10404002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300011119|Ga0105246_10034339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3379Open in IMG/M
3300011119|Ga0105246_10961892All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria770Open in IMG/M
3300012204|Ga0137374_10428314Not Available1044Open in IMG/M
3300012207|Ga0137381_11147392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia668Open in IMG/M
3300012209|Ga0137379_10727603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes rishiriensis897Open in IMG/M
3300012210|Ga0137378_10658674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia957Open in IMG/M
3300012210|Ga0137378_11375320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales620Open in IMG/M
3300012211|Ga0137377_10340497Not Available1436Open in IMG/M
3300012349|Ga0137387_10305375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1151Open in IMG/M
3300012350|Ga0137372_10371770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1089Open in IMG/M
3300012351|Ga0137386_10234545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. TLI_1851319Open in IMG/M
3300012351|Ga0137386_10505064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → Cellulomonas humilata871Open in IMG/M
3300012356|Ga0137371_10461883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria982Open in IMG/M
3300012357|Ga0137384_11165558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia614Open in IMG/M
3300012359|Ga0137385_10665681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia871Open in IMG/M
3300012473|Ga0157340_1007025Not Available722Open in IMG/M
3300012501|Ga0157351_1062664Not Available515Open in IMG/M
3300012513|Ga0157326_1024625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria764Open in IMG/M
3300012519|Ga0157352_1096654Not Available518Open in IMG/M
3300012532|Ga0137373_10465834Not Available971Open in IMG/M
3300012532|Ga0137373_11050485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia586Open in IMG/M
3300012930|Ga0137407_10096300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2527Open in IMG/M
3300012960|Ga0164301_11698483Not Available527Open in IMG/M
3300012987|Ga0164307_10500417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia918Open in IMG/M
3300013104|Ga0157370_11351167All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300013105|Ga0157369_11939052Not Available598Open in IMG/M
3300013105|Ga0157369_12364422Not Available538Open in IMG/M
3300013297|Ga0157378_11887170Not Available646Open in IMG/M
3300013297|Ga0157378_12059649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia621Open in IMG/M
3300013306|Ga0163162_12163374Not Available638Open in IMG/M
3300013307|Ga0157372_11250744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia857Open in IMG/M
3300013308|Ga0157375_13158859Not Available549Open in IMG/M
3300014325|Ga0163163_10924759Not Available935Open in IMG/M
3300014968|Ga0157379_10431520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1214Open in IMG/M
3300015371|Ga0132258_13385566All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300015372|Ga0132256_100176331All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium2168Open in IMG/M
3300015373|Ga0132257_103668058Not Available559Open in IMG/M
3300015374|Ga0132255_106052738Not Available512Open in IMG/M
3300016294|Ga0182041_12099340Not Available527Open in IMG/M
3300018482|Ga0066669_10166180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1645Open in IMG/M
3300020070|Ga0206356_11553194Not Available532Open in IMG/M
3300020579|Ga0210407_10524317Not Available925Open in IMG/M
3300020581|Ga0210399_11341818Not Available561Open in IMG/M
3300021088|Ga0210404_10665589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria593Open in IMG/M
3300021171|Ga0210405_10550519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia901Open in IMG/M
3300021178|Ga0210408_10089564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2414Open in IMG/M
3300021178|Ga0210408_11259949Not Available562Open in IMG/M
3300021403|Ga0210397_11191320Not Available592Open in IMG/M
3300021478|Ga0210402_11041258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria745Open in IMG/M
3300021559|Ga0210409_10200932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1815Open in IMG/M
3300021559|Ga0210409_11571794Not Available534Open in IMG/M
3300021560|Ga0126371_11993825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae698Open in IMG/M
3300022756|Ga0222622_10854718Not Available666Open in IMG/M
3300024288|Ga0179589_10095663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria1205Open in IMG/M
3300024331|Ga0247668_1020393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria1370Open in IMG/M
3300025885|Ga0207653_10145225Not Available870Open in IMG/M
3300025898|Ga0207692_10311231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides961Open in IMG/M
3300025898|Ga0207692_11178918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora508Open in IMG/M
3300025900|Ga0207710_10270301All Organisms → cellular organisms → Bacteria → Terrabacteria group854Open in IMG/M
3300025905|Ga0207685_10576433Not Available601Open in IMG/M
3300025906|Ga0207699_10160663All Organisms → cellular organisms → Bacteria1495Open in IMG/M
3300025906|Ga0207699_10464907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → Cellulomonas humilata909Open in IMG/M
3300025910|Ga0207684_10351119Not Available1269Open in IMG/M
3300025914|Ga0207671_11237633Not Available583Open in IMG/M
3300025915|Ga0207693_10081658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2531Open in IMG/M
3300025915|Ga0207693_10366589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1127Open in IMG/M
3300025915|Ga0207693_10469217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia983Open in IMG/M
3300025915|Ga0207693_10503374All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300025916|Ga0207663_10414968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1032Open in IMG/M
3300025919|Ga0207657_10076338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2827Open in IMG/M
3300025927|Ga0207687_10322661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1251Open in IMG/M
3300025927|Ga0207687_10800318All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300025928|Ga0207700_10312007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1361Open in IMG/M
3300025928|Ga0207700_10686115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia914Open in IMG/M
3300025929|Ga0207664_10597146Not Available991Open in IMG/M
3300025929|Ga0207664_10806598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → Cellulomonas humilata844Open in IMG/M
3300025929|Ga0207664_11439805Not Available610Open in IMG/M
3300025929|Ga0207664_11890897Not Available519Open in IMG/M
3300025931|Ga0207644_10572601Not Available936Open in IMG/M
3300025931|Ga0207644_11466487All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300025935|Ga0207709_11535572Not Available553Open in IMG/M
3300025939|Ga0207665_10602857All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300025939|Ga0207665_11013386Not Available661Open in IMG/M
3300025941|Ga0207711_10685114Not Available956Open in IMG/M
3300025942|Ga0207689_10022403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5312Open in IMG/M
3300025944|Ga0207661_11172775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia707Open in IMG/M
3300025945|Ga0207679_10265845All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1465Open in IMG/M
3300026035|Ga0207703_11951544Not Available563Open in IMG/M
3300026041|Ga0207639_10095356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria2391Open in IMG/M
3300026041|Ga0207639_10245098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1560Open in IMG/M
3300026067|Ga0207678_10564918Not Available996Open in IMG/M
3300026118|Ga0207675_102385378Not Available541Open in IMG/M
3300026142|Ga0207698_11479940Not Available694Open in IMG/M
3300027725|Ga0209178_1175979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia749Open in IMG/M
3300027765|Ga0209073_10151109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia857Open in IMG/M
3300027775|Ga0209177_10307654Not Available606Open in IMG/M
3300027775|Ga0209177_10455620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia524Open in IMG/M
3300027787|Ga0209074_10554561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300028072|Ga0247675_1047632Not Available636Open in IMG/M
3300028379|Ga0268266_10294852Not Available1511Open in IMG/M
3300028381|Ga0268264_12504124Not Available521Open in IMG/M
3300028715|Ga0307313_10196492Not Available626Open in IMG/M
3300028720|Ga0307317_10215101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia649Open in IMG/M
3300028784|Ga0307282_10188980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria983Open in IMG/M
3300028807|Ga0307305_10038910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae2183Open in IMG/M
3300031474|Ga0170818_113484183Not Available680Open in IMG/M
3300031544|Ga0318534_10116666All Organisms → cellular organisms → Bacteria1533Open in IMG/M
3300031546|Ga0318538_10219946Not Available1017Open in IMG/M
3300031546|Ga0318538_10283110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia892Open in IMG/M
3300031564|Ga0318573_10163819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1170Open in IMG/M
3300031680|Ga0318574_10797640Not Available553Open in IMG/M
3300031720|Ga0307469_11058372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia760Open in IMG/M
3300031723|Ga0318493_10808064Not Available528Open in IMG/M
3300031798|Ga0318523_10554764Not Available567Open in IMG/M
3300031846|Ga0318512_10222924All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300031890|Ga0306925_11577844Not Available639Open in IMG/M
3300031890|Ga0306925_11646631Not Available622Open in IMG/M
3300031896|Ga0318551_10751967Not Available566Open in IMG/M
3300031912|Ga0306921_12406277Not Available549Open in IMG/M
3300032001|Ga0306922_10696040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1070Open in IMG/M
3300032008|Ga0318562_10747116Not Available561Open in IMG/M
3300032052|Ga0318506_10194177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia895Open in IMG/M
3300032054|Ga0318570_10423297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia607Open in IMG/M
3300032065|Ga0318513_10014863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3137Open in IMG/M
3300032068|Ga0318553_10136033All Organisms → cellular organisms → Bacteria1268Open in IMG/M
3300032074|Ga0308173_11488173All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300032089|Ga0318525_10278154Not Available860Open in IMG/M
3300032770|Ga0335085_10299489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella asiatica1906Open in IMG/M
3300032828|Ga0335080_10228721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2038Open in IMG/M
3300032892|Ga0335081_12401715Not Available548Open in IMG/M
3300032954|Ga0335083_10770571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella endophytica774Open in IMG/M
3300033134|Ga0335073_10835357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia982Open in IMG/M
3300033475|Ga0310811_10693007All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium988Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil17.10%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere13.47%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.84%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.66%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.15%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.63%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil3.63%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.59%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.59%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.07%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.07%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.07%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.07%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.55%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.04%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil1.04%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.04%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.04%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.04%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.04%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.04%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.04%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.52%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.52%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.52%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.52%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.52%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.52%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.52%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.52%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.52%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.52%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.52%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.52%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573000Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms)EnvironmentalOpen in IMG/M
2189573002Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012473Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610Host-AssociatedOpen in IMG/M
3300012501Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610EnvironmentalOpen in IMG/M
3300012513Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510Host-AssociatedOpen in IMG/M
3300012519Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610EnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300028072Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
N55_095547002189573000Grass SoilVPAKEVTQVSTNPAFANVGEAMDMARAALGYLAAADAAQLAAETQADVPAEPGAD
FE1_004468502189573002Grass SoilVEEVTQVGTAPVFASADEALDMVRAGLGYLAAADATQLGAAAQAPVPEGVRAG
Ga0062595_10116338013300004479SoilMEEVTQVGTVPVFASADEALDMVRAGLGYLAAADATQLGAAAQARC
Ga0066685_1093949023300005180SoilVGTAPASAREALDMVRAGLGYLAAADAAQLAVATQAECLRELER
Ga0068868_10167681823300005338Miscanthus RhizosphereVTSPGEEVKVSTAPADVREALDMVRAGLGYLAAADAAQLPA
Ga0070671_10069274513300005355Switchgrass RhizosphereMSTVPANAREALDMVRAGLGYLAAADAAQLPAVTQAEFLRELEQDAAALTAARAWMLAAF
Ga0070659_10045130413300005366Corn RhizosphereMSTTAPADAREALDMVRAGLGYLAAADPAQLPAATQAEVLRELEQHDAMATAAR
Ga0070709_1005083123300005434Corn, Switchgrass And Miscanthus RhizosphereVDAAPASTREALDMVRAGLGYLAAADAAQLATATQAECLRELEQHDAMAT
Ga0070714_10089133013300005435Agricultural SoilMPAAATRPGEEVTQMSTTAPADAREALDMVRAGLGYLAAAGPARLPAATQAEVLRELE
Ga0070714_10151750913300005435Agricultural SoilVSTAPADVREALDMVRAGLGYLASADSGQLPAATQAECLRELERD
Ga0070714_10152249413300005435Agricultural SoilVSTTAPADAREALNMVRAGLGYLAAADPGQLPAATQAECLREL
Ga0070713_10053981323300005436Corn, Switchgrass And Miscanthus RhizosphereVGAMAPADAREALDMIRAGLGYLAAADPGQLPVATQAECL
Ga0070713_10139901623300005436Corn, Switchgrass And Miscanthus RhizosphereVDAAPASTREALDMVRAGLGYLAAADAAQLATATQAECLREL
Ga0070711_10163552313300005439Corn, Switchgrass And Miscanthus RhizosphereMSTVPANAREALDMIRAGLGYLAAADAAQLPAATQAECLREFEQDAAALTAAR
Ga0070711_10202526723300005439Corn, Switchgrass And Miscanthus RhizosphereVSTTAPADAREALDMIRAGLGYLTAPGAAQLPAATQAEVLRELEQHDAMATAARAGFLAAFT
Ga0066687_1074541413300005454SoilVGANTPGNTREALDMVRAGLGYLAAADAARLPAAVQAECLR
Ga0070681_1091132313300005458Corn RhizosphereMSTVPANAREALDMVRAGLGYLAAADAAQLPAVTQAEFLRELEQDAAALTAAR
Ga0070707_10224896213300005468Corn, Switchgrass And Miscanthus RhizosphereVSTTAPADAREALDMIRAGLGYLTAAGPAQLPAATQAEVLRELEQHDAMATAARAGFLAAFTAG
Ga0070698_10189804313300005471Corn, Switchgrass And Miscanthus RhizosphereVQEVTRVGATAPADVREALDMVRAGLGYLAAADAAQLPAA
Ga0070696_10069859213300005546Corn, Switchgrass And Miscanthus RhizosphereVGAAPAFGSVGEALEMVRAGLGYLAAADAAQLPAAVQAQVL
Ga0070704_10210243413300005549Corn, Switchgrass And Miscanthus RhizosphereVSTTAPADAREALDMIRAGLGYLTAADAAQLPVTTQAECLRELEQDAAAL
Ga0068855_10148420413300005563Corn RhizosphereVSTTAPADAREALDMIRAGLGYLTAAGPAQLPAATQAECLRELEQDAAALTAARA
Ga0068854_10039233813300005578Corn RhizosphereMSTTAPADAREALDMVRAGLGYLAAADPAQLPAATQADVLRELEQHDAVAT
Ga0068856_10046119813300005614Corn RhizosphereVSTTAPANAREALDMIRAGLGYLAAAGPGQLPVATQAECL
Ga0081540_127951813300005983Tabebuia Heterophylla RhizosphereVGTTPANVREALDMVRAGLGYLAAADAAQLATAVQAECLRELEQDAAALTAVQAWMLAS
Ga0070717_1118381023300006028Corn, Switchgrass And Miscanthus RhizosphereVGAAPAFGSVGEALEMVRAGLGYLAAADAAQLPAAAQA
Ga0070765_10223745713300006176SoilVGTAPAFASVGEALDMVRAGLGYLASTDAARLPAAAQAQVLRELEQ
Ga0079222_1120497723300006755Agricultural SoilVGTAPASAREALDMVRAALGYLAAADPAQLSAATQAECL
Ga0079221_1044801213300006804Agricultural SoilVGTVPASAREALDMIRAGLGYLAAADAAQLPAATQAEAL
Ga0079221_1091783223300006804Agricultural SoilMGATAPADAREALDMIRAGLGYLAAADATQLATATQA
Ga0075434_10065249013300006871Populus RhizosphereVGANAPACAREALDMVRAGLGYLAAADAAQLGAATQA
Ga0075434_10130091323300006871Populus RhizosphereMSTAPADAREALDMIRAGLGYLAAAGAGQLPAATQADVLRELEQHDAVATAAR
Ga0079219_1158001623300006954Agricultural SoilVSTTAPADARQALDMIRAGLGYLADADAAQLPAAGQAECLRE
Ga0099827_1099244023300009090Vadose Zone SoilVGTVPASAREALDMVRAGLGYLAAADAARLPAATQA
Ga0105245_1060840423300009098Miscanthus RhizosphereVSTTAPANAREALDMIRAGLGYLAAADPAQLPAATQAECLR
Ga0105245_1153718313300009098Miscanthus RhizosphereVTQVSTTAPADAREALGMVRAGLGYLAAAGPAQLPAATQAEVL
Ga0105245_1243255513300009098Miscanthus RhizosphereVEEVTQVGAAAPASAREALDMVRAGLDYLAAADAAQL
Ga0099792_1031412413300009143Vadose Zone SoilVQEVTQVSTAPACASVGEALDMVRAGLGYLAAADAARLPAATQAQVLREL
Ga0105248_1036296723300009177Switchgrass RhizosphereMAPADAREALDMIRAGLGYLAAADPGQLPVATQAECLR
Ga0126380_1015357913300010043Tropical Forest SoilVGIAPVSVHEALDMVRAGLGYLAAADTAQLSAATQADCLRELERSGAVVTAARASM
Ga0134125_1006053953300010371Terrestrial SoilVSTTAPANAREALDMVRAGLGYLTAADPARLPAVTQAECLRELEQHDAMA
Ga0134128_1030325433300010373Terrestrial SoilVQEVTQVGATAPANTREALDMVRAGLGYLAAADATQLPAATQAECLRELEQNDAA
Ga0134128_1052211333300010373Terrestrial SoilMSTTAPADAREALDMVRAGLGYLAAADPAQLPAATQADVLREL
Ga0134128_1120185723300010373Terrestrial SoilVTQVSTAPAFASVGEALDMVRAGLGYLAAADAARLPAVT
Ga0105239_1085690413300010375Corn RhizosphereMSTVPANAREALDMVRAGLGYLAAADPGQLPAATQADVLRELEQHDAMATAA
Ga0105239_1197048413300010375Corn RhizosphereVTQVSTTAPADAREALDMIRAGLGYLAAADPGQLPAATQAEVLRELEQ
Ga0105239_1341353233300010375Corn RhizosphereVTQVSTTAPADAREALDMVRAGLGYLAAADPGQLPVATQ
Ga0134126_1113004623300010396Terrestrial SoilMVDAPESVREALGMIRAGFAWLAGADVASVPAAVQAECLRELERVRSV
Ga0134126_1117289323300010396Terrestrial SoilVSTTAPADAREALDMIRAGLSYLAAADAARLAAVTQAEVLRELEQD
Ga0134126_1140814113300010396Terrestrial SoilVTQVSTTAPANAREALDMIRAGLGYLAAAGPGQLPVATQAECLRELE
Ga0134126_1296034823300010396Terrestrial SoilVTQVSTAPADTREALDMIRARLGYLAAAGPARLPAATQADVLRELEQH
Ga0126361_1040400223300010876Boreal Forest SoilVNTLTAPADAGQALAMVRAGLSYLAAADATQMAAQVQAECLHGLE
Ga0105246_1003433913300011119Miscanthus RhizosphereVTQVSTTAPADAREALDMVRAGLGYLAAADPARLPAATQADVLRELEQHDA
Ga0105246_1096189223300011119Miscanthus RhizosphereVSTTVPADAREALDMVRAGLGYLAAADPGQLPAATQA
Ga0137374_1042831413300012204Vadose Zone SoilVEEVTWVGTAPASAREALDMVRAGLGYLASADPGQFPAVTQAECLRELERDAAVL
Ga0137381_1114739233300012207Vadose Zone SoilVEEVTQVGNAPASAREALDMVRAGLGYLAAADAAQLPAAT
Ga0137379_1072760323300012209Vadose Zone SoilVEEVTWVGTAPASAREALDMVRAGLGYLAAADATQLSAA
Ga0137378_1065867413300012210Vadose Zone SoilVGATAPASAREALDMVRAGLGYLAAADAARLPAAT
Ga0137378_1137532023300012210Vadose Zone SoilVTQVGTAPATTREALDMIRAGLGYLAAADAAQLPAAAQAECLRELEQHDAMA
Ga0137377_1034049713300012211Vadose Zone SoilVTQVGTAPASAREALDMIRAGLGYLAAADAARLPAAVQAQVLRE
Ga0137387_1030537543300012349Vadose Zone SoilVTQVGATAPANAREALDMVRAGLGYLAAADAAQLPAATQAECLRE
Ga0137372_1037177033300012350Vadose Zone SoilLEEVASGVITVTAPDSARQALDMVRAGLGFLAATDPTQLDPGTQAVVLRELEADEAVLTAARA
Ga0137386_1023454513300012351Vadose Zone SoilVGATAPAFASVGEALEMVRAGLGYLAAADAARLPTAVQAECL
Ga0137386_1050506413300012351Vadose Zone SoilVTPVGTAPASAREALDMVRAGLGYLAAADAAQLPAATQAECLRELE
Ga0137371_1046188313300012356Vadose Zone SoilVTQVGTAPASAREALDMVRAGLGYLAAADAARLPTAVQAECLRE
Ga0137384_1116555823300012357Vadose Zone SoilVTQVGATAPANAREALDMVRAGLGYLAAADAAQLPAATQAEC
Ga0137385_1066568123300012359Vadose Zone SoilVTQVGATAPANAREALDMVRAGLGYLAAADAAQLPAATQA
Ga0157340_100702533300012473Arabidopsis RhizosphereVTQVSTTAPADAREALDMIRAGLGYLAAAGPGQLPAVTQAEVLRELEQHDAMATAARAGFLAAFTAGQGHAGD
Ga0157351_106266423300012501Unplanted SoilVEEVTQVGTAPVFASADEALDMVCAGLGYLAAADAT
Ga0157326_102462523300012513Arabidopsis RhizosphereMSTVPANAREALDMIRAGLGYLTAAGPGQLPAATQA
Ga0157352_109665413300012519Unplanted SoilVTQVSATAPADAREALDMIRAGLGYLAAAGPGQLPAATQAEVLRELEQH
Ga0137373_1046583423300012532Vadose Zone SoilVEEVTQVSTAPANAREALDMGRAGLGYLAAADAAQRPAATQA
Ga0137373_1105048523300012532Vadose Zone SoilVEEVTWVGTAPASAREALDMVRAGLGYLAAADATQLPAATQAECRRKLE
Ga0137407_1009630053300012930Vadose Zone SoilVEEVTWVGAAAPANAREALDMIRAGLDYLAAAGAAQLPAAVQAGCLREL
Ga0164301_1169848313300012960SoilMGNAPACASEALDMVRAGLGYLAAADAAQLSAATQAECLRGLERPARS*
Ga0164307_1050041733300012987SoilVSTTAPADAREALDMIRAGLSYLAAAGPAQLPAATQA
Ga0157370_1135116723300013104Corn RhizosphereVSTTAPANAREALDMIRAGLGYLAAAGPGQLPVATQAEFLRELEQDAAALTAARA
Ga0157369_1193905223300013105Corn RhizosphereVTQVGATAPANAREALDMVRAGLGYLAAADAAQLPAAVQAQVLRGLEQHDAMA
Ga0157369_1236442223300013105Corn RhizosphereVEEVIQVGTAPAFASVSEALDMVQAGLSYVAAADAAQLPAATQA
Ga0157378_1188717023300013297Miscanthus RhizosphereMSTVPANAREALDMIRAGLGYLAAAGPGQLPVATQAECLRELAPDAPALTAARGWLLNEYRAAKETT
Ga0157378_1205964923300013297Miscanthus RhizosphereVQEVTQVGAAPAFASVGEALEMVRAGLGYLAATDAAQ
Ga0163162_1216337413300013306Switchgrass RhizosphereVTQVSTAPADAREALDMIRAGLSYLAAADPARLPAETQAGCLRELEQHDA
Ga0157372_1125074413300013307Corn RhizosphereVQEVTQVGATAPANAREALDMVRAGLGYLAAADAAQ
Ga0157375_1315885913300013308Miscanthus RhizosphereVEEVTQVGTAPVFASADEALDMVRAGLGYLAAADATQLGAAAQ
Ga0163163_1092475913300014325Switchgrass RhizosphereVTQVSTAPADTREALDMIRARLGYLAAAGPARLPAATQADVLRELEQHAA
Ga0157379_1043152013300014968Switchgrass RhizosphereVTQVSTTAPADAREALDMIRAGLGYLAAAGPARLPAATQAECLRELEQDAAALTAA
Ga0132258_1338556633300015371Arabidopsis RhizosphereVEEVTQVGTAPVFASADEALNMVRAGLGYLAAADATQLGAAAQA
Ga0132256_10017633143300015372Arabidopsis RhizosphereVTQVSTVPANAREALDMIRAGLEYLTAADAARLPVTTQAECLRELEQDAAA
Ga0132257_10366805813300015373Arabidopsis RhizosphereVGDAPASAGEALDMVRAGLGYLAAADATQLPAATQA
Ga0132255_10605273813300015374Arabidopsis RhizosphereVTQVSTTAPADAREALDMIRAGLGYLASADAAQLPAAGQAECLRELEQDD
Ga0182041_1209934013300016294SoilVGTVPVSVREALDMVRAGLGYLAAADTTQLSAATQADCLRELECSGAVATA
Ga0187781_1138380113300017972Tropical PeatlandVSAVAAPASPREALDMVRAGFGYLATADPIEWPAEVQ
Ga0187784_1051444213300018062Tropical PeatlandVSAVAAPASPREALDMVRAGFGYLATADPIEWPAEVQAEC
Ga0066669_1016618033300018482Grasslands SoilVGTVPVFASADEALDMVRAGLGYLAAADDTQLGAAAQARCLKVFEQ
Ga0206356_1155319413300020070Corn, Switchgrass And Miscanthus RhizosphereVSTTAPADAREALDMVRAGLGYLAAADPGQLPVATQAECLREL
Ga0210407_1052431713300020579SoilVGMAPASAREALDMVRAGLGYLAAADATRLAAVTQAECLREL
Ga0210399_1134181813300020581SoilMGTAPACAREALDMVRAGLGYLAAADAARLAAATQAECLRELEQ
Ga0210404_1066558913300021088SoilVAKVGDAPASVSEALGMVRAGLGYLAAADATQLSAV
Ga0210405_1055051923300021171SoilVGNAPASAREALDMVRAGLGYLAAADATRLAAATQAECLRELEQ
Ga0210408_1008956453300021178SoilVGTVPASAREALDMVRAGLGYLATADAARLPAATQAEALRE
Ga0210408_1125994913300021178SoilVGTAPAFASAREALEMVRAGLGYLAAADAARLPAATQAECLRELEQHDAMATAGRRGRGL
Ga0210397_1119132013300021403SoilVGTVPVNAREALDMVRAGLGYLAAADASQLAAATQAECLRELEHA
Ga0210394_1142509913300021420SoilVGAAPVFASAGEALEMVRAGLGYLAAADAARLPAAVQAQVLRELEQH
Ga0210402_1104125813300021478SoilMGTAPVCAREALDMVRAGLGYLAAADATRLAAATQAECLR
Ga0210409_1020093213300021559SoilVGTAPAFASAREALEMVRAGLGYLAAADAARLPAATQAECLRELEQ
Ga0210409_1157179423300021559SoilVGTAPACAREALDMVRAGLGYLAAADAAQLSAATQAECLRGL
Ga0126371_1199382523300021560Tropical Forest SoilVTQVGTAPVSVREALDMVRAGLRYLAAADTARLSAATQ
Ga0222622_1085471813300022756Groundwater SedimentVSTAPADAREALDMVRAGLGYLAAADAAQLPAATQAECLR
Ga0179589_1009566323300024288Vadose Zone SoilVGTAPASAREALDMVRAGLGYLAAADAARVPTAAQAGCLR
Ga0247668_102039313300024331SoilVSTTAPANAREALDMIRAGLGYLAAAGAARLPAATQ
Ga0207653_1014522523300025885Corn, Switchgrass And Miscanthus RhizosphereVSTTAPADAREALDMVRAGLGYLAAAGAAQLPAATQAEV
Ga0207692_1031123113300025898Corn, Switchgrass And Miscanthus RhizosphereVSAAPASTREALDMVRAGLGYLAAADAAQLATATQA
Ga0207692_1117891813300025898Corn, Switchgrass And Miscanthus RhizosphereVSTTPPANAREALDMIRAGLSYLAAADPAQLPAATQAEVLRELE
Ga0207710_1027030113300025900Switchgrass RhizosphereMSTVPANAREALDMIRAGLGYLAAADAAQLPAATQAECLREFEQDAAAL
Ga0207685_1057643313300025905Corn, Switchgrass And Miscanthus RhizosphereVSTITAPASAREALDMVRAGLAHLAAADPAARDPETQAQVLLRRVGG
Ga0207699_1016066333300025906Corn, Switchgrass And Miscanthus RhizosphereVSTITAPASAREALDMVRAGLGYLAAADPAGLATEEQAQVLRELE
Ga0207699_1046490723300025906Corn, Switchgrass And Miscanthus RhizosphereVGTAPASAREALDMIRAGLGYLAAADAAQLPAATQAECLRELE
Ga0207684_1035111933300025910Corn, Switchgrass And Miscanthus RhizosphereVGTAPACASVGEALDMVRAGLGYLAAADAAQLPAATQ
Ga0207671_1123763323300025914Corn RhizosphereMGNAPACASEALDMVRAGLGYLAAADAAQLSAATQ
Ga0207693_1008165813300025915Corn, Switchgrass And Miscanthus RhizosphereVGATAPADAREALDMVRAGLGYLAAADAARLPAVTQA
Ga0207693_1036658943300025915Corn, Switchgrass And Miscanthus RhizosphereVSTTAPADAREALGMVRAGLGYLAAAGAAQLPAAT
Ga0207693_1046921713300025915Corn, Switchgrass And Miscanthus RhizosphereVSTTAPANAREALDMIRAGLGYLTAADAAQLPAATQAACL
Ga0207693_1050337413300025915Corn, Switchgrass And Miscanthus RhizosphereVSTVTAPASAREALAMVRAGLGYLAAADPAARDPETQAQVLREL
Ga0207663_1041496813300025916Corn, Switchgrass And Miscanthus RhizosphereVGAAPAFGSVGEALEMVRAGLGYLAAADAAQLPAAVQAQVLR
Ga0207657_1007633813300025919Corn RhizosphereMSTAPADAREALDMIRAGLGYLAAADPAQLPAATQAGCLRE
Ga0207687_1032266113300025927Miscanthus RhizosphereVSTTAPADAREALDMIRAGLGYLAAAGPAQLPAATQAEVLRELEQHDAMATAAR
Ga0207687_1080031813300025927Miscanthus RhizosphereMSTTAPADAREALDMVRAGLGYLAAAGPAQLPAATQAEVLRELEQHDAMATAARAGFL
Ga0207700_1031200733300025928Corn, Switchgrass And Miscanthus RhizosphereVGTVPASAREALEMVRAGLGYLAAADAAQLPAAAQAECLRE
Ga0207700_1068611513300025928Corn, Switchgrass And Miscanthus RhizosphereVGVTAPANAREALDMVRAGLGYLAAADAAQLPAVTQAE
Ga0207664_1059714623300025929Agricultural SoilVGTAPVFASADEALDMVRAGLGYLAAADATQLGAAAQ
Ga0207664_1080659813300025929Agricultural SoilMRPQRRPVPVEEVTPVGTAPASAREALDMVRAGLGYLATADAARLPVAVQAEALRELEQ
Ga0207664_1143980513300025929Agricultural SoilVGATAPACAREALDMVRAGLGYLAAADAARLPAATQAL
Ga0207664_1189089713300025929Agricultural SoilVSTAPADAREALDMVRAGLGYLASADAAQLPVATKAECLQELEQD
Ga0207644_1057260113300025931Switchgrass RhizosphereMSTTAPADAREALDMVRAGLGYLAAADPAQLPAATQADVLRELE
Ga0207644_1146648723300025931Switchgrass RhizosphereMSTTAPADAREALDMVRAGLGYLAAADPAQLPAATQADVLRELEQ
Ga0207709_1153557213300025935Miscanthus RhizosphereVSTTAPADAREALDMIRAGLGYLAAAGPARLPAATQAEVL
Ga0207665_1060285713300025939Corn, Switchgrass And Miscanthus RhizosphereVGANAPADAREALDMVRAGLGYLAAADAAQLPAVTQAEALRELE
Ga0207665_1101338623300025939Corn, Switchgrass And Miscanthus RhizosphereVSTAPADAREALDMVRAGLGYLAAADAAQLPAVTLAECLRELE
Ga0207711_1068511413300025941Switchgrass RhizosphereMSTTAPADAREALDMVRAGLGYLAAADPAQLPAATQAGCLRE
Ga0207689_1002240313300025942Miscanthus RhizosphereVGTAPVFASADEALDMVRAGLGYLAAADATQLGAAAQAR
Ga0207661_1117277513300025944Corn RhizosphereVSTTAPATAREALDMVRAGLGYLAAADPAQLATATQ
Ga0207679_1026584533300025945Corn RhizosphereVGTVPVFASADEALDMVRAGLGYLAAADATRLGAAAQ
Ga0207703_1195154413300026035Switchgrass RhizosphereVSTTAPANAREALDMIRAGLGYLAAAGPGQLPVATQA
Ga0207639_1009535613300026041Corn RhizosphereVSTAPADTREALDMIRARLGYLAAAGPARLPAATQADVLRELEQHAAALTAARAWMLAAF
Ga0207639_1024509813300026041Corn RhizosphereVSTTAPADAREALDMIRAGLGYLTAADAAQLPAATQA
Ga0207678_1056491813300026067Corn RhizosphereMSTAPANAREALDMIRAGLGYLAAADPARLPAATQAG
Ga0207675_10238537813300026118Switchgrass RhizosphereVSTTAPANAREALDMIRAGLGYLAAAGPGQLPVATQAECLRELEQDAAALTAAQ
Ga0207698_1147994023300026142Corn RhizosphereVSTTAPADAREALDMVRAGLGYLAAADPGQLPVAT
Ga0209178_117597923300027725Agricultural SoilMGATAPADAREALDMIRAGLGYLAAADATQLATATQAECLRELEQDAAA
Ga0209073_1015110923300027765Agricultural SoilVSTTAPADAREALDMVRAGLGYLAAADPGQLPSATQAECLRELE
Ga0209177_1030765413300027775Agricultural SoilVGTVPASAREALDMIRAGLGYLAAADAAQLPAVTQAEVLR
Ga0209177_1045562013300027775Agricultural SoilVSTTAPADARQALDMIRAGLGYLADADAAQLPAAGQAECLRELEQDDAAL
Ga0209074_1055456123300027787Agricultural SoilVSTTAPADAREALDMIRAGLGYLAAADAAQLPAGTQAEVPGNW
Ga0247675_104763213300028072SoilMGATAPADAREALDMVRAGLGYLAAADPARLPAAGQAECLRELEQDAAA
Ga0268266_1029485213300028379Switchgrass RhizosphereVSTTAPADAREALDMVRAGLGYLAAADAALLPSATQAECMRELERDAAVLTAARAGILP
Ga0268264_1250412423300028381Switchgrass RhizosphereMGNAPACAREALDMVRAGLGYLAAADAAQLSAAIQAECLRG
Ga0307313_1019649223300028715SoilVSTAPADAREALDMVRAGLGYLAAADAAQLPAATQAECLRELERN
Ga0307317_1021510123300028720SoilVSTAPADAREALDMVRAGLGYLAAADAAQLPAVTQA
Ga0307282_1018898013300028784SoilVEEVTQVGTAPASVREALDMVRAGLGYLAAADAAQLPAATQA
Ga0307305_1003891013300028807SoilVSTAPADAREALDMVRAGLGYLAAADAAQLPAATQAECLRELEQH
Ga0170818_11348418323300031474Forest SoilMGIAPACAREALDMVRAGLGYLAAADATRLAAATQAECLRELE
Ga0318534_1011666633300031544SoilMAPASAHEALDMVRAGLRYLAAADAAQLPTATQAECLR
Ga0318538_1021994623300031546SoilMAPASAHEALDMVRAGLRYLAAADAAQLPTATQAECLRRLERAD
Ga0318538_1028311013300031546SoilVGTVTAPSSAREALDMVRAGLGYLAADAAQLPTATQADCLRELEQISAVATAARAFI
Ga0318573_1016381933300031564SoilVGTVTAPSSAREALDMVRAGLGYLAAADAARLPTATQAECLRELEQI
Ga0318515_1036406623300031572SoilVSTVPTTPPFASASEALAMVRAGLGYLAAADPTAM
Ga0318574_1079764023300031680SoilMGIAPASVREALDMVHAGLGYLAAADAAQLSTATQAECLYELEQAD
Ga0307469_1105837223300031720Hardwood Forest SoilVGATAPANAREALDMVRAGLGYLAAADAAQLGAATQAECL
Ga0318493_1080806413300031723SoilMGTAPASVREALDMVHAALGYLAAADAAQLSTATQ
Ga0318554_1034879213300031765SoilVSTVPTTPPFASASEALAMVRAGLGYLAAADPTAMGAHAQAECLLELERLDAIGTA
Ga0318566_1008835113300031779SoilVSTVPTTPPFASASEALAMVRAGLGYLAAADPTAMGA
Ga0318523_1055476423300031798SoilMGIAPASVREALDMVHAGLGYLAAADAAQLSTATQAEC
Ga0310917_1057345113300031833SoilVSTVPTTPPFASASEALAMVRAGLGYLAAADPTAMGAHAQAECL
Ga0318512_1022292423300031846SoilMGTAPASVREALDMVHAALGYLAAADAAQLSTATQAEC
Ga0306925_1157784423300031890SoilVEMAPASAHEALDMVRAGLRYLAAADAAQLPTATQAECL
Ga0306925_1164663113300031890SoilVDTAPASAREALDMVRAGLGYLAAADAAQMPAATQAECL
Ga0318551_1075196713300031896SoilVEMAPASAHEALDMVRAGLRYLAAADAAQLPTATQAECLRRLERA
Ga0306921_1240627713300031912SoilVEMAPASAHEALDMVRAGLRYLAAADAAQLPTATQAEC
Ga0306922_1069604033300032001SoilVGTVTAPSSAREALDMVRAGLGYLAAADAARLPTATQAECL
Ga0318562_1074711613300032008SoilVGNAPASAREALDLVRAGLGYLAAADAAELGTSAQ
Ga0318506_1019417713300032052SoilVGTVTAPSSAREALDMVRAGLGYLAAADAAQFPAATQAECLRE
Ga0318570_1042329713300032054SoilVGTVTAPSSAREALDMVRAGLGYLAAADAARLPTATQAECLREL
Ga0318513_1001486313300032065SoilVGTVTAPSSAREALDMVRAGLGYLAAADAARLPTATQAECLRRGRE
Ga0318524_1042425923300032067SoilMGYAPASASEAMDMVQAGLSYLAAADAAQLPAETQ
Ga0318553_1013603333300032068SoilVGTVTAPASASEALDMVHAGLRYLAAADAAQLAAAEQAEC
Ga0308173_1148817323300032074SoilVSTAPANAREALDMVRAGLGYLAAADATQFGTATQAEFLRELEQADAVAT
Ga0318525_1027815423300032089SoilMGIAPASVREALDMVHAGLGYLAAADAAQLSTATQAECL
Ga0335085_1029948913300032770SoilVGTAPAFASVSEALDMVQAGLSYLAAADTAQLPAATQAECL
Ga0335080_1022872113300032828SoilMDTAPASAREALDMVRAGLAYLAAADTAQLSVATQ
Ga0335081_1240171523300032892SoilVIQVGATVPADAREALDMVRAGLGYLASAEPGQLPAATQA
Ga0335083_1077057113300032954SoilVGTVTVPSSPREALDMVRAGLGYLAAVDAAQLPAATQAECLRELEQYDAAATAARA
Ga0335073_1083535723300033134SoilVSTTAPADARQALDMIRAGLGYLAAADAAQLPAATQAECLRELEQDAAGLTA
Ga0310811_1069300733300033475SoilVSTTTPADAREALDMIHAGLGYLAAAGPARLPAATQAECLR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.