Basic Information | |
---|---|
Family ID | F027906 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 193 |
Average Sequence Length | 44 residues |
Representative Sequence | VGTAPASAREALDMIRAGLGYLAAADAAQLPAATQAECLRELE |
Number of Associated Samples | 154 |
Number of Associated Scaffolds | 193 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 97.30 % |
% of genes near scaffold ends (potentially truncated) | 93.78 % |
% of genes from short scaffolds (< 2000 bps) | 89.12 % |
Associated GOLD sequencing projects | 143 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (56.995 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.098 % of family members) |
Environment Ontology (ENVO) | Unclassified (37.306 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (56.995 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.48% β-sheet: 0.00% Coil/Unstructured: 53.52% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 193 Family Scaffolds |
---|---|---|
PF00892 | EamA | 3.11 |
PF04072 | LCM | 2.59 |
PF13546 | DDE_5 | 2.59 |
PF13586 | DDE_Tnp_1_2 | 2.07 |
PF00004 | AAA | 1.55 |
PF12697 | Abhydrolase_6 | 1.55 |
PF02781 | G6PD_C | 1.55 |
PF10604 | Polyketide_cyc2 | 1.55 |
PF08241 | Methyltransf_11 | 1.04 |
PF07690 | MFS_1 | 1.04 |
PF13340 | DUF4096 | 1.04 |
PF12840 | HTH_20 | 1.04 |
PF01872 | RibD_C | 1.04 |
PF01337 | Barstar | 1.04 |
PF02566 | OsmC | 1.04 |
PF01609 | DDE_Tnp_1 | 1.04 |
PF04672 | Methyltransf_19 | 0.52 |
PF03951 | Gln-synt_N | 0.52 |
PF01053 | Cys_Met_Meta_PP | 0.52 |
PF01965 | DJ-1_PfpI | 0.52 |
PF13424 | TPR_12 | 0.52 |
PF04679 | DNA_ligase_A_C | 0.52 |
PF13649 | Methyltransf_25 | 0.52 |
PF02687 | FtsX | 0.52 |
PF07883 | Cupin_2 | 0.52 |
PF00881 | Nitroreductase | 0.52 |
PF00441 | Acyl-CoA_dh_1 | 0.52 |
PF10009 | DUF2252 | 0.52 |
PF13977 | TetR_C_6 | 0.52 |
PF02899 | Phage_int_SAM_1 | 0.52 |
PF07366 | SnoaL | 0.52 |
PF00112 | Peptidase_C1 | 0.52 |
PF04174 | CP_ATPgrasp_1 | 0.52 |
PF01381 | HTH_3 | 0.52 |
PF00589 | Phage_integrase | 0.52 |
PF03176 | MMPL | 0.52 |
PF00392 | GntR | 0.52 |
PF00270 | DEAD | 0.52 |
PF00041 | fn3 | 0.52 |
PF03781 | FGE-sulfatase | 0.52 |
PF05598 | DUF772 | 0.52 |
PF12680 | SnoaL_2 | 0.52 |
PF00583 | Acetyltransf_1 | 0.52 |
PF03551 | PadR | 0.52 |
PF02909 | TetR_C_1 | 0.52 |
PF13359 | DDE_Tnp_4 | 0.52 |
PF00196 | GerE | 0.52 |
PF02627 | CMD | 0.52 |
COG ID | Name | Functional Category | % Frequency in 193 Family Scaffolds |
---|---|---|---|
COG3315 | O-Methyltransferase involved in polyketide biosynthesis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.59 |
COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 1.55 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 1.04 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.04 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 1.04 |
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 1.04 |
COG2732 | Barstar, RNAse (barnase) inhibitor | Transcription [K] | 1.04 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 1.04 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 1.04 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 1.04 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.04 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 1.04 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 1.04 |
COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.52 |
COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.52 |
COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.52 |
COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.52 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.52 |
COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.52 |
COG2308 | Circularly permuted ATP-grasp protein | General function prediction only [R] | 0.52 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.52 |
COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.52 |
COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.52 |
COG0174 | Glutamine synthetase | Amino acid transport and metabolism [E] | 0.52 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.52 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.52 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.52 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.52 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.52 |
COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.52 |
COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.52 |
COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 0.52 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.52 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.52 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.52 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.52 |
COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.52 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.52 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 56.99 % |
Unclassified | root | N/A | 43.01 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2189573000|GPBTN7E02JQJ9U | Not Available | 506 | Open in IMG/M |
2189573002|GZIGXIF02HG27W | Not Available | 521 | Open in IMG/M |
3300004479|Ga0062595_101163380 | Not Available | 681 | Open in IMG/M |
3300005180|Ga0066685_10939490 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300005338|Ga0068868_101676818 | Not Available | 599 | Open in IMG/M |
3300005355|Ga0070671_100692745 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300005366|Ga0070659_100451304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1091 | Open in IMG/M |
3300005434|Ga0070709_10050831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → unclassified Kitasatospora → Kitasatospora sp. SolWspMP-SS2h | 2598 | Open in IMG/M |
3300005435|Ga0070714_100891330 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
3300005435|Ga0070714_101517509 | Not Available | 654 | Open in IMG/M |
3300005435|Ga0070714_101522494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 653 | Open in IMG/M |
3300005436|Ga0070713_100539813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1103 | Open in IMG/M |
3300005436|Ga0070713_101399016 | Not Available | 678 | Open in IMG/M |
3300005439|Ga0070711_101635523 | Not Available | 563 | Open in IMG/M |
3300005439|Ga0070711_102025267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
3300005454|Ga0066687_10745414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. URHB0020 | 583 | Open in IMG/M |
3300005458|Ga0070681_10911323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 798 | Open in IMG/M |
3300005468|Ga0070707_102248962 | Not Available | 513 | Open in IMG/M |
3300005471|Ga0070698_101898043 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300005546|Ga0070696_100698592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. TLI_185 | 827 | Open in IMG/M |
3300005549|Ga0070704_102102434 | Not Available | 525 | Open in IMG/M |
3300005563|Ga0068855_101484204 | Not Available | 697 | Open in IMG/M |
3300005578|Ga0068854_100392338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia acaciae | 1146 | Open in IMG/M |
3300005614|Ga0068856_100461198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1291 | Open in IMG/M |
3300005983|Ga0081540_1279518 | Not Available | 576 | Open in IMG/M |
3300006028|Ga0070717_11183810 | Not Available | 696 | Open in IMG/M |
3300006176|Ga0070765_102237457 | Not Available | 510 | Open in IMG/M |
3300006755|Ga0079222_11204977 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300006804|Ga0079221_10448012 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300006804|Ga0079221_10917832 | Not Available | 645 | Open in IMG/M |
3300006871|Ga0075434_100652490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1071 | Open in IMG/M |
3300006871|Ga0075434_101300913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria | 738 | Open in IMG/M |
3300006954|Ga0079219_11580016 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300009090|Ga0099827_10992440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 728 | Open in IMG/M |
3300009098|Ga0105245_10608404 | Not Available | 1120 | Open in IMG/M |
3300009098|Ga0105245_11537183 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300009098|Ga0105245_12432555 | Not Available | 577 | Open in IMG/M |
3300009143|Ga0099792_10314124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 934 | Open in IMG/M |
3300009177|Ga0105248_10362967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1631 | Open in IMG/M |
3300010043|Ga0126380_10153579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1478 | Open in IMG/M |
3300010371|Ga0134125_10060539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4211 | Open in IMG/M |
3300010373|Ga0134128_10303254 | All Organisms → cellular organisms → Bacteria | 1789 | Open in IMG/M |
3300010373|Ga0134128_10522113 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
3300010373|Ga0134128_11201857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 836 | Open in IMG/M |
3300010375|Ga0105239_10856904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1042 | Open in IMG/M |
3300010375|Ga0105239_11970484 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300010375|Ga0105239_13413532 | Not Available | 517 | Open in IMG/M |
3300010396|Ga0134126_11130046 | Not Available | 873 | Open in IMG/M |
3300010396|Ga0134126_11172893 | Not Available | 854 | Open in IMG/M |
3300010396|Ga0134126_11408141 | Not Available | 770 | Open in IMG/M |
3300010396|Ga0134126_12960348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
3300010876|Ga0126361_10404002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
3300011119|Ga0105246_10034339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3379 | Open in IMG/M |
3300011119|Ga0105246_10961892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 770 | Open in IMG/M |
3300012204|Ga0137374_10428314 | Not Available | 1044 | Open in IMG/M |
3300012207|Ga0137381_11147392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 668 | Open in IMG/M |
3300012209|Ga0137379_10727603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes rishiriensis | 897 | Open in IMG/M |
3300012210|Ga0137378_10658674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 957 | Open in IMG/M |
3300012210|Ga0137378_11375320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 620 | Open in IMG/M |
3300012211|Ga0137377_10340497 | Not Available | 1436 | Open in IMG/M |
3300012349|Ga0137387_10305375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1151 | Open in IMG/M |
3300012350|Ga0137372_10371770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1089 | Open in IMG/M |
3300012351|Ga0137386_10234545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. TLI_185 | 1319 | Open in IMG/M |
3300012351|Ga0137386_10505064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → Cellulomonas humilata | 871 | Open in IMG/M |
3300012356|Ga0137371_10461883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 982 | Open in IMG/M |
3300012357|Ga0137384_11165558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 614 | Open in IMG/M |
3300012359|Ga0137385_10665681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 871 | Open in IMG/M |
3300012473|Ga0157340_1007025 | Not Available | 722 | Open in IMG/M |
3300012501|Ga0157351_1062664 | Not Available | 515 | Open in IMG/M |
3300012513|Ga0157326_1024625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 764 | Open in IMG/M |
3300012519|Ga0157352_1096654 | Not Available | 518 | Open in IMG/M |
3300012532|Ga0137373_10465834 | Not Available | 971 | Open in IMG/M |
3300012532|Ga0137373_11050485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 586 | Open in IMG/M |
3300012930|Ga0137407_10096300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2527 | Open in IMG/M |
3300012960|Ga0164301_11698483 | Not Available | 527 | Open in IMG/M |
3300012987|Ga0164307_10500417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 918 | Open in IMG/M |
3300013104|Ga0157370_11351167 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300013105|Ga0157369_11939052 | Not Available | 598 | Open in IMG/M |
3300013105|Ga0157369_12364422 | Not Available | 538 | Open in IMG/M |
3300013297|Ga0157378_11887170 | Not Available | 646 | Open in IMG/M |
3300013297|Ga0157378_12059649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 621 | Open in IMG/M |
3300013306|Ga0163162_12163374 | Not Available | 638 | Open in IMG/M |
3300013307|Ga0157372_11250744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 857 | Open in IMG/M |
3300013308|Ga0157375_13158859 | Not Available | 549 | Open in IMG/M |
3300014325|Ga0163163_10924759 | Not Available | 935 | Open in IMG/M |
3300014968|Ga0157379_10431520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1214 | Open in IMG/M |
3300015371|Ga0132258_13385566 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
3300015372|Ga0132256_100176331 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2168 | Open in IMG/M |
3300015373|Ga0132257_103668058 | Not Available | 559 | Open in IMG/M |
3300015374|Ga0132255_106052738 | Not Available | 512 | Open in IMG/M |
3300016294|Ga0182041_12099340 | Not Available | 527 | Open in IMG/M |
3300018482|Ga0066669_10166180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1645 | Open in IMG/M |
3300020070|Ga0206356_11553194 | Not Available | 532 | Open in IMG/M |
3300020579|Ga0210407_10524317 | Not Available | 925 | Open in IMG/M |
3300020581|Ga0210399_11341818 | Not Available | 561 | Open in IMG/M |
3300021088|Ga0210404_10665589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 593 | Open in IMG/M |
3300021171|Ga0210405_10550519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 901 | Open in IMG/M |
3300021178|Ga0210408_10089564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2414 | Open in IMG/M |
3300021178|Ga0210408_11259949 | Not Available | 562 | Open in IMG/M |
3300021403|Ga0210397_11191320 | Not Available | 592 | Open in IMG/M |
3300021478|Ga0210402_11041258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 745 | Open in IMG/M |
3300021559|Ga0210409_10200932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1815 | Open in IMG/M |
3300021559|Ga0210409_11571794 | Not Available | 534 | Open in IMG/M |
3300021560|Ga0126371_11993825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 698 | Open in IMG/M |
3300022756|Ga0222622_10854718 | Not Available | 666 | Open in IMG/M |
3300024288|Ga0179589_10095663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria | 1205 | Open in IMG/M |
3300024331|Ga0247668_1020393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria | 1370 | Open in IMG/M |
3300025885|Ga0207653_10145225 | Not Available | 870 | Open in IMG/M |
3300025898|Ga0207692_10311231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 961 | Open in IMG/M |
3300025898|Ga0207692_11178918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 508 | Open in IMG/M |
3300025900|Ga0207710_10270301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 854 | Open in IMG/M |
3300025905|Ga0207685_10576433 | Not Available | 601 | Open in IMG/M |
3300025906|Ga0207699_10160663 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
3300025906|Ga0207699_10464907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → Cellulomonas humilata | 909 | Open in IMG/M |
3300025910|Ga0207684_10351119 | Not Available | 1269 | Open in IMG/M |
3300025914|Ga0207671_11237633 | Not Available | 583 | Open in IMG/M |
3300025915|Ga0207693_10081658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2531 | Open in IMG/M |
3300025915|Ga0207693_10366589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1127 | Open in IMG/M |
3300025915|Ga0207693_10469217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 983 | Open in IMG/M |
3300025915|Ga0207693_10503374 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
3300025916|Ga0207663_10414968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1032 | Open in IMG/M |
3300025919|Ga0207657_10076338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2827 | Open in IMG/M |
3300025927|Ga0207687_10322661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1251 | Open in IMG/M |
3300025927|Ga0207687_10800318 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300025928|Ga0207700_10312007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1361 | Open in IMG/M |
3300025928|Ga0207700_10686115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 914 | Open in IMG/M |
3300025929|Ga0207664_10597146 | Not Available | 991 | Open in IMG/M |
3300025929|Ga0207664_10806598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → Cellulomonas humilata | 844 | Open in IMG/M |
3300025929|Ga0207664_11439805 | Not Available | 610 | Open in IMG/M |
3300025929|Ga0207664_11890897 | Not Available | 519 | Open in IMG/M |
3300025931|Ga0207644_10572601 | Not Available | 936 | Open in IMG/M |
3300025931|Ga0207644_11466487 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300025935|Ga0207709_11535572 | Not Available | 553 | Open in IMG/M |
3300025939|Ga0207665_10602857 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300025939|Ga0207665_11013386 | Not Available | 661 | Open in IMG/M |
3300025941|Ga0207711_10685114 | Not Available | 956 | Open in IMG/M |
3300025942|Ga0207689_10022403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5312 | Open in IMG/M |
3300025944|Ga0207661_11172775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 707 | Open in IMG/M |
3300025945|Ga0207679_10265845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1465 | Open in IMG/M |
3300026035|Ga0207703_11951544 | Not Available | 563 | Open in IMG/M |
3300026041|Ga0207639_10095356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria | 2391 | Open in IMG/M |
3300026041|Ga0207639_10245098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1560 | Open in IMG/M |
3300026067|Ga0207678_10564918 | Not Available | 996 | Open in IMG/M |
3300026118|Ga0207675_102385378 | Not Available | 541 | Open in IMG/M |
3300026142|Ga0207698_11479940 | Not Available | 694 | Open in IMG/M |
3300027725|Ga0209178_1175979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 749 | Open in IMG/M |
3300027765|Ga0209073_10151109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 857 | Open in IMG/M |
3300027775|Ga0209177_10307654 | Not Available | 606 | Open in IMG/M |
3300027775|Ga0209177_10455620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
3300027787|Ga0209074_10554561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
3300028072|Ga0247675_1047632 | Not Available | 636 | Open in IMG/M |
3300028379|Ga0268266_10294852 | Not Available | 1511 | Open in IMG/M |
3300028381|Ga0268264_12504124 | Not Available | 521 | Open in IMG/M |
3300028715|Ga0307313_10196492 | Not Available | 626 | Open in IMG/M |
3300028720|Ga0307317_10215101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 649 | Open in IMG/M |
3300028784|Ga0307282_10188980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 983 | Open in IMG/M |
3300028807|Ga0307305_10038910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 2183 | Open in IMG/M |
3300031474|Ga0170818_113484183 | Not Available | 680 | Open in IMG/M |
3300031544|Ga0318534_10116666 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
3300031546|Ga0318538_10219946 | Not Available | 1017 | Open in IMG/M |
3300031546|Ga0318538_10283110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 892 | Open in IMG/M |
3300031564|Ga0318573_10163819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1170 | Open in IMG/M |
3300031680|Ga0318574_10797640 | Not Available | 553 | Open in IMG/M |
3300031720|Ga0307469_11058372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 760 | Open in IMG/M |
3300031723|Ga0318493_10808064 | Not Available | 528 | Open in IMG/M |
3300031798|Ga0318523_10554764 | Not Available | 567 | Open in IMG/M |
3300031846|Ga0318512_10222924 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
3300031890|Ga0306925_11577844 | Not Available | 639 | Open in IMG/M |
3300031890|Ga0306925_11646631 | Not Available | 622 | Open in IMG/M |
3300031896|Ga0318551_10751967 | Not Available | 566 | Open in IMG/M |
3300031912|Ga0306921_12406277 | Not Available | 549 | Open in IMG/M |
3300032001|Ga0306922_10696040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1070 | Open in IMG/M |
3300032008|Ga0318562_10747116 | Not Available | 561 | Open in IMG/M |
3300032052|Ga0318506_10194177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 895 | Open in IMG/M |
3300032054|Ga0318570_10423297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 607 | Open in IMG/M |
3300032065|Ga0318513_10014863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3137 | Open in IMG/M |
3300032068|Ga0318553_10136033 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
3300032074|Ga0308173_11488173 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300032089|Ga0318525_10278154 | Not Available | 860 | Open in IMG/M |
3300032770|Ga0335085_10299489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella asiatica | 1906 | Open in IMG/M |
3300032828|Ga0335080_10228721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2038 | Open in IMG/M |
3300032892|Ga0335081_12401715 | Not Available | 548 | Open in IMG/M |
3300032954|Ga0335083_10770571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella endophytica | 774 | Open in IMG/M |
3300033134|Ga0335073_10835357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 982 | Open in IMG/M |
3300033475|Ga0310811_10693007 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 988 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.10% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 13.47% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.84% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.66% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.15% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.63% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 3.63% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.11% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.59% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.59% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.07% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.07% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.07% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.07% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.55% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.04% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 1.04% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.04% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.04% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.04% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.04% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.04% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.04% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.52% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.52% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.52% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.52% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.52% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.52% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.52% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.52% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.52% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.52% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Host-Associated | Open in IMG/M |
3300012501 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610 | Environmental | Open in IMG/M |
3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Host-Associated | Open in IMG/M |
3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
N55_09554700 | 2189573000 | Grass Soil | VPAKEVTQVSTNPAFANVGEAMDMARAALGYLAAADAAQLAAETQADVPAEPGAD |
FE1_00446850 | 2189573002 | Grass Soil | VEEVTQVGTAPVFASADEALDMVRAGLGYLAAADATQLGAAAQAPVPEGVRAG |
Ga0062595_1011633801 | 3300004479 | Soil | MEEVTQVGTVPVFASADEALDMVRAGLGYLAAADATQLGAAAQARC |
Ga0066685_109394902 | 3300005180 | Soil | VGTAPASAREALDMVRAGLGYLAAADAAQLAVATQAECLRELER |
Ga0068868_1016768182 | 3300005338 | Miscanthus Rhizosphere | VTSPGEEVKVSTAPADVREALDMVRAGLGYLAAADAAQLPA |
Ga0070671_1006927451 | 3300005355 | Switchgrass Rhizosphere | MSTVPANAREALDMVRAGLGYLAAADAAQLPAVTQAEFLRELEQDAAALTAARAWMLAAF |
Ga0070659_1004513041 | 3300005366 | Corn Rhizosphere | MSTTAPADAREALDMVRAGLGYLAAADPAQLPAATQAEVLRELEQHDAMATAAR |
Ga0070709_100508312 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VDAAPASTREALDMVRAGLGYLAAADAAQLATATQAECLRELEQHDAMAT |
Ga0070714_1008913301 | 3300005435 | Agricultural Soil | MPAAATRPGEEVTQMSTTAPADAREALDMVRAGLGYLAAAGPARLPAATQAEVLRELE |
Ga0070714_1015175091 | 3300005435 | Agricultural Soil | VSTAPADVREALDMVRAGLGYLASADSGQLPAATQAECLRELERD |
Ga0070714_1015224941 | 3300005435 | Agricultural Soil | VSTTAPADAREALNMVRAGLGYLAAADPGQLPAATQAECLREL |
Ga0070713_1005398132 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VGAMAPADAREALDMIRAGLGYLAAADPGQLPVATQAECL |
Ga0070713_1013990162 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VDAAPASTREALDMVRAGLGYLAAADAAQLATATQAECLREL |
Ga0070711_1016355231 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTVPANAREALDMIRAGLGYLAAADAAQLPAATQAECLREFEQDAAALTAAR |
Ga0070711_1020252672 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VSTTAPADAREALDMIRAGLGYLTAPGAAQLPAATQAEVLRELEQHDAMATAARAGFLAAFT |
Ga0066687_107454141 | 3300005454 | Soil | VGANTPGNTREALDMVRAGLGYLAAADAARLPAAVQAECLR |
Ga0070681_109113231 | 3300005458 | Corn Rhizosphere | MSTVPANAREALDMVRAGLGYLAAADAAQLPAVTQAEFLRELEQDAAALTAAR |
Ga0070707_1022489621 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VSTTAPADAREALDMIRAGLGYLTAAGPAQLPAATQAEVLRELEQHDAMATAARAGFLAAFTAG |
Ga0070698_1018980431 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VQEVTRVGATAPADVREALDMVRAGLGYLAAADAAQLPAA |
Ga0070696_1006985921 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VGAAPAFGSVGEALEMVRAGLGYLAAADAAQLPAAVQAQVL |
Ga0070704_1021024341 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VSTTAPADAREALDMIRAGLGYLTAADAAQLPVTTQAECLRELEQDAAAL |
Ga0068855_1014842041 | 3300005563 | Corn Rhizosphere | VSTTAPADAREALDMIRAGLGYLTAAGPAQLPAATQAECLRELEQDAAALTAARA |
Ga0068854_1003923381 | 3300005578 | Corn Rhizosphere | MSTTAPADAREALDMVRAGLGYLAAADPAQLPAATQADVLRELEQHDAVAT |
Ga0068856_1004611981 | 3300005614 | Corn Rhizosphere | VSTTAPANAREALDMIRAGLGYLAAAGPGQLPVATQAECL |
Ga0081540_12795181 | 3300005983 | Tabebuia Heterophylla Rhizosphere | VGTTPANVREALDMVRAGLGYLAAADAAQLATAVQAECLRELEQDAAALTAVQAWMLAS |
Ga0070717_111838102 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VGAAPAFGSVGEALEMVRAGLGYLAAADAAQLPAAAQA |
Ga0070765_1022374571 | 3300006176 | Soil | VGTAPAFASVGEALDMVRAGLGYLASTDAARLPAAAQAQVLRELEQ |
Ga0079222_112049772 | 3300006755 | Agricultural Soil | VGTAPASAREALDMVRAALGYLAAADPAQLSAATQAECL |
Ga0079221_104480121 | 3300006804 | Agricultural Soil | VGTVPASAREALDMIRAGLGYLAAADAAQLPAATQAEAL |
Ga0079221_109178322 | 3300006804 | Agricultural Soil | MGATAPADAREALDMIRAGLGYLAAADATQLATATQA |
Ga0075434_1006524901 | 3300006871 | Populus Rhizosphere | VGANAPACAREALDMVRAGLGYLAAADAAQLGAATQA |
Ga0075434_1013009132 | 3300006871 | Populus Rhizosphere | MSTAPADAREALDMIRAGLGYLAAAGAGQLPAATQADVLRELEQHDAVATAAR |
Ga0079219_115800162 | 3300006954 | Agricultural Soil | VSTTAPADARQALDMIRAGLGYLADADAAQLPAAGQAECLRE |
Ga0099827_109924402 | 3300009090 | Vadose Zone Soil | VGTVPASAREALDMVRAGLGYLAAADAARLPAATQA |
Ga0105245_106084042 | 3300009098 | Miscanthus Rhizosphere | VSTTAPANAREALDMIRAGLGYLAAADPAQLPAATQAECLR |
Ga0105245_115371831 | 3300009098 | Miscanthus Rhizosphere | VTQVSTTAPADAREALGMVRAGLGYLAAAGPAQLPAATQAEVL |
Ga0105245_124325551 | 3300009098 | Miscanthus Rhizosphere | VEEVTQVGAAAPASAREALDMVRAGLDYLAAADAAQL |
Ga0099792_103141241 | 3300009143 | Vadose Zone Soil | VQEVTQVSTAPACASVGEALDMVRAGLGYLAAADAARLPAATQAQVLREL |
Ga0105248_103629672 | 3300009177 | Switchgrass Rhizosphere | MAPADAREALDMIRAGLGYLAAADPGQLPVATQAECLR |
Ga0126380_101535791 | 3300010043 | Tropical Forest Soil | VGIAPVSVHEALDMVRAGLGYLAAADTAQLSAATQADCLRELERSGAVVTAARASM |
Ga0134125_100605395 | 3300010371 | Terrestrial Soil | VSTTAPANAREALDMVRAGLGYLTAADPARLPAVTQAECLRELEQHDAMA |
Ga0134128_103032543 | 3300010373 | Terrestrial Soil | VQEVTQVGATAPANTREALDMVRAGLGYLAAADATQLPAATQAECLRELEQNDAA |
Ga0134128_105221133 | 3300010373 | Terrestrial Soil | MSTTAPADAREALDMVRAGLGYLAAADPAQLPAATQADVLREL |
Ga0134128_112018572 | 3300010373 | Terrestrial Soil | VTQVSTAPAFASVGEALDMVRAGLGYLAAADAARLPAVT |
Ga0105239_108569041 | 3300010375 | Corn Rhizosphere | MSTVPANAREALDMVRAGLGYLAAADPGQLPAATQADVLRELEQHDAMATAA |
Ga0105239_119704841 | 3300010375 | Corn Rhizosphere | VTQVSTTAPADAREALDMIRAGLGYLAAADPGQLPAATQAEVLRELEQ |
Ga0105239_134135323 | 3300010375 | Corn Rhizosphere | VTQVSTTAPADAREALDMVRAGLGYLAAADPGQLPVATQ |
Ga0134126_111300462 | 3300010396 | Terrestrial Soil | MVDAPESVREALGMIRAGFAWLAGADVASVPAAVQAECLRELERVRSV |
Ga0134126_111728932 | 3300010396 | Terrestrial Soil | VSTTAPADAREALDMIRAGLSYLAAADAARLAAVTQAEVLRELEQD |
Ga0134126_114081411 | 3300010396 | Terrestrial Soil | VTQVSTTAPANAREALDMIRAGLGYLAAAGPGQLPVATQAECLRELE |
Ga0134126_129603482 | 3300010396 | Terrestrial Soil | VTQVSTAPADTREALDMIRARLGYLAAAGPARLPAATQADVLRELEQH |
Ga0126361_104040022 | 3300010876 | Boreal Forest Soil | VNTLTAPADAGQALAMVRAGLSYLAAADATQMAAQVQAECLHGLE |
Ga0105246_100343391 | 3300011119 | Miscanthus Rhizosphere | VTQVSTTAPADAREALDMVRAGLGYLAAADPARLPAATQADVLRELEQHDA |
Ga0105246_109618922 | 3300011119 | Miscanthus Rhizosphere | VSTTVPADAREALDMVRAGLGYLAAADPGQLPAATQA |
Ga0137374_104283141 | 3300012204 | Vadose Zone Soil | VEEVTWVGTAPASAREALDMVRAGLGYLASADPGQFPAVTQAECLRELERDAAVL |
Ga0137381_111473923 | 3300012207 | Vadose Zone Soil | VEEVTQVGNAPASAREALDMVRAGLGYLAAADAAQLPAAT |
Ga0137379_107276032 | 3300012209 | Vadose Zone Soil | VEEVTWVGTAPASAREALDMVRAGLGYLAAADATQLSAA |
Ga0137378_106586741 | 3300012210 | Vadose Zone Soil | VGATAPASAREALDMVRAGLGYLAAADAARLPAAT |
Ga0137378_113753202 | 3300012210 | Vadose Zone Soil | VTQVGTAPATTREALDMIRAGLGYLAAADAAQLPAAAQAECLRELEQHDAMA |
Ga0137377_103404971 | 3300012211 | Vadose Zone Soil | VTQVGTAPASAREALDMIRAGLGYLAAADAARLPAAVQAQVLRE |
Ga0137387_103053754 | 3300012349 | Vadose Zone Soil | VTQVGATAPANAREALDMVRAGLGYLAAADAAQLPAATQAECLRE |
Ga0137372_103717703 | 3300012350 | Vadose Zone Soil | LEEVASGVITVTAPDSARQALDMVRAGLGFLAATDPTQLDPGTQAVVLRELEADEAVLTAARA |
Ga0137386_102345451 | 3300012351 | Vadose Zone Soil | VGATAPAFASVGEALEMVRAGLGYLAAADAARLPTAVQAECL |
Ga0137386_105050641 | 3300012351 | Vadose Zone Soil | VTPVGTAPASAREALDMVRAGLGYLAAADAAQLPAATQAECLRELE |
Ga0137371_104618831 | 3300012356 | Vadose Zone Soil | VTQVGTAPASAREALDMVRAGLGYLAAADAARLPTAVQAECLRE |
Ga0137384_111655582 | 3300012357 | Vadose Zone Soil | VTQVGATAPANAREALDMVRAGLGYLAAADAAQLPAATQAEC |
Ga0137385_106656812 | 3300012359 | Vadose Zone Soil | VTQVGATAPANAREALDMVRAGLGYLAAADAAQLPAATQA |
Ga0157340_10070253 | 3300012473 | Arabidopsis Rhizosphere | VTQVSTTAPADAREALDMIRAGLGYLAAAGPGQLPAVTQAEVLRELEQHDAMATAARAGFLAAFTAGQGHAGD |
Ga0157351_10626642 | 3300012501 | Unplanted Soil | VEEVTQVGTAPVFASADEALDMVCAGLGYLAAADAT |
Ga0157326_10246252 | 3300012513 | Arabidopsis Rhizosphere | MSTVPANAREALDMIRAGLGYLTAAGPGQLPAATQA |
Ga0157352_10966541 | 3300012519 | Unplanted Soil | VTQVSATAPADAREALDMIRAGLGYLAAAGPGQLPAATQAEVLRELEQH |
Ga0137373_104658342 | 3300012532 | Vadose Zone Soil | VEEVTQVSTAPANAREALDMGRAGLGYLAAADAAQRPAATQA |
Ga0137373_110504852 | 3300012532 | Vadose Zone Soil | VEEVTWVGTAPASAREALDMVRAGLGYLAAADATQLPAATQAECRRKLE |
Ga0137407_100963005 | 3300012930 | Vadose Zone Soil | VEEVTWVGAAAPANAREALDMIRAGLDYLAAAGAAQLPAAVQAGCLREL |
Ga0164301_116984831 | 3300012960 | Soil | MGNAPACASEALDMVRAGLGYLAAADAAQLSAATQAECLRGLERPARS* |
Ga0164307_105004173 | 3300012987 | Soil | VSTTAPADAREALDMIRAGLSYLAAAGPAQLPAATQA |
Ga0157370_113511672 | 3300013104 | Corn Rhizosphere | VSTTAPANAREALDMIRAGLGYLAAAGPGQLPVATQAEFLRELEQDAAALTAARA |
Ga0157369_119390522 | 3300013105 | Corn Rhizosphere | VTQVGATAPANAREALDMVRAGLGYLAAADAAQLPAAVQAQVLRGLEQHDAMA |
Ga0157369_123644222 | 3300013105 | Corn Rhizosphere | VEEVIQVGTAPAFASVSEALDMVQAGLSYVAAADAAQLPAATQA |
Ga0157378_118871702 | 3300013297 | Miscanthus Rhizosphere | MSTVPANAREALDMIRAGLGYLAAAGPGQLPVATQAECLRELAPDAPALTAARGWLLNEYRAAKETT |
Ga0157378_120596492 | 3300013297 | Miscanthus Rhizosphere | VQEVTQVGAAPAFASVGEALEMVRAGLGYLAATDAAQ |
Ga0163162_121633741 | 3300013306 | Switchgrass Rhizosphere | VTQVSTAPADAREALDMIRAGLSYLAAADPARLPAETQAGCLRELEQHDA |
Ga0157372_112507441 | 3300013307 | Corn Rhizosphere | VQEVTQVGATAPANAREALDMVRAGLGYLAAADAAQ |
Ga0157375_131588591 | 3300013308 | Miscanthus Rhizosphere | VEEVTQVGTAPVFASADEALDMVRAGLGYLAAADATQLGAAAQ |
Ga0163163_109247591 | 3300014325 | Switchgrass Rhizosphere | VTQVSTAPADTREALDMIRARLGYLAAAGPARLPAATQADVLRELEQHAA |
Ga0157379_104315201 | 3300014968 | Switchgrass Rhizosphere | VTQVSTTAPADAREALDMIRAGLGYLAAAGPARLPAATQAECLRELEQDAAALTAA |
Ga0132258_133855663 | 3300015371 | Arabidopsis Rhizosphere | VEEVTQVGTAPVFASADEALNMVRAGLGYLAAADATQLGAAAQA |
Ga0132256_1001763314 | 3300015372 | Arabidopsis Rhizosphere | VTQVSTVPANAREALDMIRAGLEYLTAADAARLPVTTQAECLRELEQDAAA |
Ga0132257_1036680581 | 3300015373 | Arabidopsis Rhizosphere | VGDAPASAGEALDMVRAGLGYLAAADATQLPAATQA |
Ga0132255_1060527381 | 3300015374 | Arabidopsis Rhizosphere | VTQVSTTAPADAREALDMIRAGLGYLASADAAQLPAAGQAECLRELEQDD |
Ga0182041_120993401 | 3300016294 | Soil | VGTVPVSVREALDMVRAGLGYLAAADTTQLSAATQADCLRELECSGAVATA |
Ga0187781_113838011 | 3300017972 | Tropical Peatland | VSAVAAPASPREALDMVRAGFGYLATADPIEWPAEVQ |
Ga0187784_105144421 | 3300018062 | Tropical Peatland | VSAVAAPASPREALDMVRAGFGYLATADPIEWPAEVQAEC |
Ga0066669_101661803 | 3300018482 | Grasslands Soil | VGTVPVFASADEALDMVRAGLGYLAAADDTQLGAAAQARCLKVFEQ |
Ga0206356_115531941 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | VSTTAPADAREALDMVRAGLGYLAAADPGQLPVATQAECLREL |
Ga0210407_105243171 | 3300020579 | Soil | VGMAPASAREALDMVRAGLGYLAAADATRLAAVTQAECLREL |
Ga0210399_113418181 | 3300020581 | Soil | MGTAPACAREALDMVRAGLGYLAAADAARLAAATQAECLRELEQ |
Ga0210404_106655891 | 3300021088 | Soil | VAKVGDAPASVSEALGMVRAGLGYLAAADATQLSAV |
Ga0210405_105505192 | 3300021171 | Soil | VGNAPASAREALDMVRAGLGYLAAADATRLAAATQAECLRELEQ |
Ga0210408_100895645 | 3300021178 | Soil | VGTVPASAREALDMVRAGLGYLATADAARLPAATQAEALRE |
Ga0210408_112599491 | 3300021178 | Soil | VGTAPAFASAREALEMVRAGLGYLAAADAARLPAATQAECLRELEQHDAMATAGRRGRGL |
Ga0210397_111913201 | 3300021403 | Soil | VGTVPVNAREALDMVRAGLGYLAAADASQLAAATQAECLRELEHA |
Ga0210394_114250991 | 3300021420 | Soil | VGAAPVFASAGEALEMVRAGLGYLAAADAARLPAAVQAQVLRELEQH |
Ga0210402_110412581 | 3300021478 | Soil | MGTAPVCAREALDMVRAGLGYLAAADATRLAAATQAECLR |
Ga0210409_102009321 | 3300021559 | Soil | VGTAPAFASAREALEMVRAGLGYLAAADAARLPAATQAECLRELEQ |
Ga0210409_115717942 | 3300021559 | Soil | VGTAPACAREALDMVRAGLGYLAAADAAQLSAATQAECLRGL |
Ga0126371_119938252 | 3300021560 | Tropical Forest Soil | VTQVGTAPVSVREALDMVRAGLRYLAAADTARLSAATQ |
Ga0222622_108547181 | 3300022756 | Groundwater Sediment | VSTAPADAREALDMVRAGLGYLAAADAAQLPAATQAECLR |
Ga0179589_100956632 | 3300024288 | Vadose Zone Soil | VGTAPASAREALDMVRAGLGYLAAADAARVPTAAQAGCLR |
Ga0247668_10203931 | 3300024331 | Soil | VSTTAPANAREALDMIRAGLGYLAAAGAARLPAATQ |
Ga0207653_101452252 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | VSTTAPADAREALDMVRAGLGYLAAAGAAQLPAATQAEV |
Ga0207692_103112311 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VSAAPASTREALDMVRAGLGYLAAADAAQLATATQA |
Ga0207692_111789181 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VSTTPPANAREALDMIRAGLSYLAAADPAQLPAATQAEVLRELE |
Ga0207710_102703011 | 3300025900 | Switchgrass Rhizosphere | MSTVPANAREALDMIRAGLGYLAAADAAQLPAATQAECLREFEQDAAAL |
Ga0207685_105764331 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VSTITAPASAREALDMVRAGLAHLAAADPAARDPETQAQVLLRRVGG |
Ga0207699_101606633 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VSTITAPASAREALDMVRAGLGYLAAADPAGLATEEQAQVLRELE |
Ga0207699_104649072 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VGTAPASAREALDMIRAGLGYLAAADAAQLPAATQAECLRELE |
Ga0207684_103511193 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VGTAPACASVGEALDMVRAGLGYLAAADAAQLPAATQ |
Ga0207671_112376332 | 3300025914 | Corn Rhizosphere | MGNAPACASEALDMVRAGLGYLAAADAAQLSAATQ |
Ga0207693_100816581 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VGATAPADAREALDMVRAGLGYLAAADAARLPAVTQA |
Ga0207693_103665894 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VSTTAPADAREALGMVRAGLGYLAAAGAAQLPAAT |
Ga0207693_104692171 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VSTTAPANAREALDMIRAGLGYLTAADAAQLPAATQAACL |
Ga0207693_105033741 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VSTVTAPASAREALAMVRAGLGYLAAADPAARDPETQAQVLREL |
Ga0207663_104149681 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VGAAPAFGSVGEALEMVRAGLGYLAAADAAQLPAAVQAQVLR |
Ga0207657_100763381 | 3300025919 | Corn Rhizosphere | MSTAPADAREALDMIRAGLGYLAAADPAQLPAATQAGCLRE |
Ga0207687_103226611 | 3300025927 | Miscanthus Rhizosphere | VSTTAPADAREALDMIRAGLGYLAAAGPAQLPAATQAEVLRELEQHDAMATAAR |
Ga0207687_108003181 | 3300025927 | Miscanthus Rhizosphere | MSTTAPADAREALDMVRAGLGYLAAAGPAQLPAATQAEVLRELEQHDAMATAARAGFL |
Ga0207700_103120073 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VGTVPASAREALEMVRAGLGYLAAADAAQLPAAAQAECLRE |
Ga0207700_106861151 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VGVTAPANAREALDMVRAGLGYLAAADAAQLPAVTQAE |
Ga0207664_105971462 | 3300025929 | Agricultural Soil | VGTAPVFASADEALDMVRAGLGYLAAADATQLGAAAQ |
Ga0207664_108065981 | 3300025929 | Agricultural Soil | MRPQRRPVPVEEVTPVGTAPASAREALDMVRAGLGYLATADAARLPVAVQAEALRELEQ |
Ga0207664_114398051 | 3300025929 | Agricultural Soil | VGATAPACAREALDMVRAGLGYLAAADAARLPAATQAL |
Ga0207664_118908971 | 3300025929 | Agricultural Soil | VSTAPADAREALDMVRAGLGYLASADAAQLPVATKAECLQELEQD |
Ga0207644_105726011 | 3300025931 | Switchgrass Rhizosphere | MSTTAPADAREALDMVRAGLGYLAAADPAQLPAATQADVLRELE |
Ga0207644_114664872 | 3300025931 | Switchgrass Rhizosphere | MSTTAPADAREALDMVRAGLGYLAAADPAQLPAATQADVLRELEQ |
Ga0207709_115355721 | 3300025935 | Miscanthus Rhizosphere | VSTTAPADAREALDMIRAGLGYLAAAGPARLPAATQAEVL |
Ga0207665_106028571 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VGANAPADAREALDMVRAGLGYLAAADAAQLPAVTQAEALRELE |
Ga0207665_110133862 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VSTAPADAREALDMVRAGLGYLAAADAAQLPAVTLAECLRELE |
Ga0207711_106851141 | 3300025941 | Switchgrass Rhizosphere | MSTTAPADAREALDMVRAGLGYLAAADPAQLPAATQAGCLRE |
Ga0207689_100224031 | 3300025942 | Miscanthus Rhizosphere | VGTAPVFASADEALDMVRAGLGYLAAADATQLGAAAQAR |
Ga0207661_111727751 | 3300025944 | Corn Rhizosphere | VSTTAPATAREALDMVRAGLGYLAAADPAQLATATQ |
Ga0207679_102658453 | 3300025945 | Corn Rhizosphere | VGTVPVFASADEALDMVRAGLGYLAAADATRLGAAAQ |
Ga0207703_119515441 | 3300026035 | Switchgrass Rhizosphere | VSTTAPANAREALDMIRAGLGYLAAAGPGQLPVATQA |
Ga0207639_100953561 | 3300026041 | Corn Rhizosphere | VSTAPADTREALDMIRARLGYLAAAGPARLPAATQADVLRELEQHAAALTAARAWMLAAF |
Ga0207639_102450981 | 3300026041 | Corn Rhizosphere | VSTTAPADAREALDMIRAGLGYLTAADAAQLPAATQA |
Ga0207678_105649181 | 3300026067 | Corn Rhizosphere | MSTAPANAREALDMIRAGLGYLAAADPARLPAATQAG |
Ga0207675_1023853781 | 3300026118 | Switchgrass Rhizosphere | VSTTAPANAREALDMIRAGLGYLAAAGPGQLPVATQAECLRELEQDAAALTAAQ |
Ga0207698_114799402 | 3300026142 | Corn Rhizosphere | VSTTAPADAREALDMVRAGLGYLAAADPGQLPVAT |
Ga0209178_11759792 | 3300027725 | Agricultural Soil | MGATAPADAREALDMIRAGLGYLAAADATQLATATQAECLRELEQDAAA |
Ga0209073_101511092 | 3300027765 | Agricultural Soil | VSTTAPADAREALDMVRAGLGYLAAADPGQLPSATQAECLRELE |
Ga0209177_103076541 | 3300027775 | Agricultural Soil | VGTVPASAREALDMIRAGLGYLAAADAAQLPAVTQAEVLR |
Ga0209177_104556201 | 3300027775 | Agricultural Soil | VSTTAPADARQALDMIRAGLGYLADADAAQLPAAGQAECLRELEQDDAAL |
Ga0209074_105545612 | 3300027787 | Agricultural Soil | VSTTAPADAREALDMIRAGLGYLAAADAAQLPAGTQAEVPGNW |
Ga0247675_10476321 | 3300028072 | Soil | MGATAPADAREALDMVRAGLGYLAAADPARLPAAGQAECLRELEQDAAA |
Ga0268266_102948521 | 3300028379 | Switchgrass Rhizosphere | VSTTAPADAREALDMVRAGLGYLAAADAALLPSATQAECMRELERDAAVLTAARAGILP |
Ga0268264_125041242 | 3300028381 | Switchgrass Rhizosphere | MGNAPACAREALDMVRAGLGYLAAADAAQLSAAIQAECLRG |
Ga0307313_101964922 | 3300028715 | Soil | VSTAPADAREALDMVRAGLGYLAAADAAQLPAATQAECLRELERN |
Ga0307317_102151012 | 3300028720 | Soil | VSTAPADAREALDMVRAGLGYLAAADAAQLPAVTQA |
Ga0307282_101889801 | 3300028784 | Soil | VEEVTQVGTAPASVREALDMVRAGLGYLAAADAAQLPAATQA |
Ga0307305_100389101 | 3300028807 | Soil | VSTAPADAREALDMVRAGLGYLAAADAAQLPAATQAECLRELEQH |
Ga0170818_1134841832 | 3300031474 | Forest Soil | MGIAPACAREALDMVRAGLGYLAAADATRLAAATQAECLRELE |
Ga0318534_101166663 | 3300031544 | Soil | MAPASAHEALDMVRAGLRYLAAADAAQLPTATQAECLR |
Ga0318538_102199462 | 3300031546 | Soil | MAPASAHEALDMVRAGLRYLAAADAAQLPTATQAECLRRLERAD |
Ga0318538_102831101 | 3300031546 | Soil | VGTVTAPSSAREALDMVRAGLGYLAADAAQLPTATQADCLRELEQISAVATAARAFI |
Ga0318573_101638193 | 3300031564 | Soil | VGTVTAPSSAREALDMVRAGLGYLAAADAARLPTATQAECLRELEQI |
Ga0318515_103640662 | 3300031572 | Soil | VSTVPTTPPFASASEALAMVRAGLGYLAAADPTAM |
Ga0318574_107976402 | 3300031680 | Soil | MGIAPASVREALDMVHAGLGYLAAADAAQLSTATQAECLYELEQAD |
Ga0307469_110583722 | 3300031720 | Hardwood Forest Soil | VGATAPANAREALDMVRAGLGYLAAADAAQLGAATQAECL |
Ga0318493_108080641 | 3300031723 | Soil | MGTAPASVREALDMVHAALGYLAAADAAQLSTATQ |
Ga0318554_103487921 | 3300031765 | Soil | VSTVPTTPPFASASEALAMVRAGLGYLAAADPTAMGAHAQAECLLELERLDAIGTA |
Ga0318566_100883511 | 3300031779 | Soil | VSTVPTTPPFASASEALAMVRAGLGYLAAADPTAMGA |
Ga0318523_105547642 | 3300031798 | Soil | MGIAPASVREALDMVHAGLGYLAAADAAQLSTATQAEC |
Ga0310917_105734511 | 3300031833 | Soil | VSTVPTTPPFASASEALAMVRAGLGYLAAADPTAMGAHAQAECL |
Ga0318512_102229242 | 3300031846 | Soil | MGTAPASVREALDMVHAALGYLAAADAAQLSTATQAEC |
Ga0306925_115778442 | 3300031890 | Soil | VEMAPASAHEALDMVRAGLRYLAAADAAQLPTATQAECL |
Ga0306925_116466311 | 3300031890 | Soil | VDTAPASAREALDMVRAGLGYLAAADAAQMPAATQAECL |
Ga0318551_107519671 | 3300031896 | Soil | VEMAPASAHEALDMVRAGLRYLAAADAAQLPTATQAECLRRLERA |
Ga0306921_124062771 | 3300031912 | Soil | VEMAPASAHEALDMVRAGLRYLAAADAAQLPTATQAEC |
Ga0306922_106960403 | 3300032001 | Soil | VGTVTAPSSAREALDMVRAGLGYLAAADAARLPTATQAECL |
Ga0318562_107471161 | 3300032008 | Soil | VGNAPASAREALDLVRAGLGYLAAADAAELGTSAQ |
Ga0318506_101941771 | 3300032052 | Soil | VGTVTAPSSAREALDMVRAGLGYLAAADAAQFPAATQAECLRE |
Ga0318570_104232971 | 3300032054 | Soil | VGTVTAPSSAREALDMVRAGLGYLAAADAARLPTATQAECLREL |
Ga0318513_100148631 | 3300032065 | Soil | VGTVTAPSSAREALDMVRAGLGYLAAADAARLPTATQAECLRRGRE |
Ga0318524_104242592 | 3300032067 | Soil | MGYAPASASEAMDMVQAGLSYLAAADAAQLPAETQ |
Ga0318553_101360333 | 3300032068 | Soil | VGTVTAPASASEALDMVHAGLRYLAAADAAQLAAAEQAEC |
Ga0308173_114881732 | 3300032074 | Soil | VSTAPANAREALDMVRAGLGYLAAADATQFGTATQAEFLRELEQADAVAT |
Ga0318525_102781542 | 3300032089 | Soil | MGIAPASVREALDMVHAGLGYLAAADAAQLSTATQAECL |
Ga0335085_102994891 | 3300032770 | Soil | VGTAPAFASVSEALDMVQAGLSYLAAADTAQLPAATQAECL |
Ga0335080_102287211 | 3300032828 | Soil | MDTAPASAREALDMVRAGLAYLAAADTAQLSVATQ |
Ga0335081_124017152 | 3300032892 | Soil | VIQVGATVPADAREALDMVRAGLGYLASAEPGQLPAATQA |
Ga0335083_107705711 | 3300032954 | Soil | VGTVTVPSSPREALDMVRAGLGYLAAVDAAQLPAATQAECLRELEQYDAAATAARA |
Ga0335073_108353572 | 3300033134 | Soil | VSTTAPADARQALDMIRAGLGYLAAADAAQLPAATQAECLRELEQDAAGLTA |
Ga0310811_106930073 | 3300033475 | Soil | VSTTTPADAREALDMIHAGLGYLAAAGPARLPAATQAECLR |
⦗Top⦘ |