Basic Information | |
---|---|
Family ID | F027905 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 193 |
Average Sequence Length | 45 residues |
Representative Sequence | VYLYAGLRAGASAEDVLARAEADGAPFARSDELKAWVAQGLAELA |
Number of Associated Samples | 172 |
Number of Associated Scaffolds | 193 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.68 % |
% of genes near scaffold ends (potentially truncated) | 90.16 % |
% of genes from short scaffolds (< 2000 bps) | 93.78 % |
Associated GOLD sequencing projects | 163 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.73 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (73.575 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.953 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.979 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.560 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.68% β-sheet: 0.00% Coil/Unstructured: 49.32% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.73 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 193 Family Scaffolds |
---|---|---|
PF06224 | HTH_42 | 10.88 |
PF00753 | Lactamase_B | 6.74 |
PF14378 | PAP2_3 | 5.70 |
PF14681 | UPRTase | 2.59 |
PF07883 | Cupin_2 | 2.59 |
PF13714 | PEP_mutase | 2.07 |
PF16864 | Dimerisation2 | 1.04 |
PF13417 | GST_N_3 | 1.04 |
PF12840 | HTH_20 | 1.04 |
PF01872 | RibD_C | 1.04 |
PF16859 | TetR_C_11 | 1.04 |
PF12681 | Glyoxalase_2 | 1.04 |
PF00797 | Acetyltransf_2 | 1.04 |
PF08448 | PAS_4 | 1.04 |
PF00005 | ABC_tran | 1.04 |
PF03992 | ABM | 1.04 |
PF07992 | Pyr_redox_2 | 1.04 |
PF00440 | TetR_N | 1.04 |
PF00891 | Methyltransf_2 | 1.04 |
PF13460 | NAD_binding_10 | 1.04 |
PF00106 | adh_short | 1.04 |
PF01142 | TruD | 0.52 |
PF08031 | BBE | 0.52 |
PF03193 | RsgA_GTPase | 0.52 |
PF00487 | FA_desaturase | 0.52 |
PF02687 | FtsX | 0.52 |
PF01799 | Fer2_2 | 0.52 |
PF00990 | GGDEF | 0.52 |
PF13673 | Acetyltransf_10 | 0.52 |
PF01894 | UPF0047 | 0.52 |
PF00248 | Aldo_ket_red | 0.52 |
PF09828 | Chrome_Resist | 0.52 |
PF00441 | Acyl-CoA_dh_1 | 0.52 |
PF13977 | TetR_C_6 | 0.52 |
PF00857 | Isochorismatase | 0.52 |
PF08530 | PepX_C | 0.52 |
PF13193 | AMP-binding_C | 0.52 |
PF01370 | Epimerase | 0.52 |
PF00089 | Trypsin | 0.52 |
PF12833 | HTH_18 | 0.52 |
PF00561 | Abhydrolase_1 | 0.52 |
PF12695 | Abhydrolase_5 | 0.52 |
PF01925 | TauE | 0.52 |
PF13191 | AAA_16 | 0.52 |
PF09678 | Caa3_CtaG | 0.52 |
PF00188 | CAP | 0.52 |
PF00579 | tRNA-synt_1b | 0.52 |
PF00196 | GerE | 0.52 |
PF06325 | PrmA | 0.52 |
PF06245 | DUF1015 | 0.52 |
PF13474 | SnoaL_3 | 0.52 |
PF00583 | Acetyltransf_1 | 0.52 |
PF04203 | Sortase | 0.52 |
PF00155 | Aminotran_1_2 | 0.52 |
PF01243 | Putative_PNPOx | 0.52 |
PF13305 | TetR_C_33 | 0.52 |
PF13207 | AAA_17 | 0.52 |
PF02720 | DUF222 | 0.52 |
PF13396 | PLDc_N | 0.52 |
PF00111 | Fer2 | 0.52 |
PF00211 | Guanylate_cyc | 0.52 |
PF07931 | CPT | 0.52 |
COG ID | Name | Functional Category | % Frequency in 193 Family Scaffolds |
---|---|---|---|
COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 10.88 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.04 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.04 |
COG2162 | Arylamine N-acetyltransferase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.04 |
COG4198 | Uncharacterized conserved protein, DUF1015 family | Function unknown [S] | 0.52 |
COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.52 |
COG3897 | Protein N-terminal and lysine N-methylase, NNT1/EFM7 family | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
COG3896 | Chloramphenicol 3-O-phosphotransferase | Defense mechanisms [V] | 0.52 |
COG3764 | Sortase (surface protein transpeptidase) | Cell wall/membrane/envelope biogenesis [M] | 0.52 |
COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.52 |
COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.52 |
COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.52 |
COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.52 |
COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.52 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.52 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.52 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.52 |
COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.52 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.52 |
COG1162 | Ribosome biogenesis GTPase RsgA | Translation, ribosomal structure and biogenesis [J] | 0.52 |
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.52 |
COG0585 | tRNA(Glu) U13 pseudouridine synthase TruD | Translation, ribosomal structure and biogenesis [J] | 0.52 |
COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.52 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.52 |
COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.52 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 73.58 % |
Unclassified | root | N/A | 26.42 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2166559005|cont_contig31789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1036 | Open in IMG/M |
2170459011|GKWS7RC01DEPJ4 | Not Available | 514 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c2302455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 994 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c2325642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 952 | Open in IMG/M |
3300000887|AL16A1W_10374151 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300000953|JGI11615J12901_10393045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 927 | Open in IMG/M |
3300001356|JGI12269J14319_10136448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 1087 | Open in IMG/M |
3300003996|Ga0055467_10282593 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300004081|Ga0063454_100933925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 689 | Open in IMG/M |
3300004081|Ga0063454_100999769 | Not Available | 672 | Open in IMG/M |
3300004114|Ga0062593_101148038 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300004114|Ga0062593_101584520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 710 | Open in IMG/M |
3300004153|Ga0063455_100160649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1049 | Open in IMG/M |
3300004157|Ga0062590_100860117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 843 | Open in IMG/M |
3300005332|Ga0066388_101399353 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
3300005334|Ga0068869_100591366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 936 | Open in IMG/M |
3300005355|Ga0070671_100362327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1238 | Open in IMG/M |
3300005439|Ga0070711_100047658 | All Organisms → cellular organisms → Bacteria | 2927 | Open in IMG/M |
3300005518|Ga0070699_101977264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
3300005535|Ga0070684_100787105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 889 | Open in IMG/M |
3300005542|Ga0070732_10796333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 576 | Open in IMG/M |
3300005545|Ga0070695_100704175 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300005558|Ga0066698_10440988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 890 | Open in IMG/M |
3300005559|Ga0066700_10366225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1017 | Open in IMG/M |
3300005561|Ga0066699_10960285 | Not Available | 594 | Open in IMG/M |
3300005563|Ga0068855_100494266 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
3300005569|Ga0066705_10838673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 547 | Open in IMG/M |
3300005576|Ga0066708_10943132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
3300005587|Ga0066654_10392290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 757 | Open in IMG/M |
3300005614|Ga0068856_101648348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 654 | Open in IMG/M |
3300005614|Ga0068856_102550080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 518 | Open in IMG/M |
3300005764|Ga0066903_102302462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1040 | Open in IMG/M |
3300005764|Ga0066903_103419278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 856 | Open in IMG/M |
3300005842|Ga0068858_100253893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea aridisoli | 1671 | Open in IMG/M |
3300005985|Ga0081539_10324354 | Not Available | 654 | Open in IMG/M |
3300006028|Ga0070717_11685795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
3300006032|Ga0066696_10313120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1021 | Open in IMG/M |
3300006178|Ga0075367_10800290 | Not Available | 600 | Open in IMG/M |
3300006237|Ga0097621_100411226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1213 | Open in IMG/M |
3300006755|Ga0079222_10255712 | Not Available | 1106 | Open in IMG/M |
3300006800|Ga0066660_11203892 | Not Available | 595 | Open in IMG/M |
3300006871|Ga0075434_100302159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1621 | Open in IMG/M |
3300006894|Ga0079215_10644188 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300006954|Ga0079219_11902436 | Not Available | 561 | Open in IMG/M |
3300009012|Ga0066710_100255919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2536 | Open in IMG/M |
3300009012|Ga0066710_102024861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 852 | Open in IMG/M |
3300009029|Ga0066793_10883082 | Not Available | 506 | Open in IMG/M |
3300009089|Ga0099828_11487157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 597 | Open in IMG/M |
3300009147|Ga0114129_10758789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1241 | Open in IMG/M |
3300009147|Ga0114129_11564283 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300009148|Ga0105243_10311790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1430 | Open in IMG/M |
3300009177|Ga0105248_11153123 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
3300009177|Ga0105248_12935396 | Not Available | 543 | Open in IMG/M |
3300009522|Ga0116218_1472197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 559 | Open in IMG/M |
3300009698|Ga0116216_10866727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
3300009698|Ga0116216_10998853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 500 | Open in IMG/M |
3300009700|Ga0116217_10694702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
3300010042|Ga0126314_11178281 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300010046|Ga0126384_10874665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 810 | Open in IMG/M |
3300010048|Ga0126373_11088445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 865 | Open in IMG/M |
3300010337|Ga0134062_10348220 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300010359|Ga0126376_11705870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 665 | Open in IMG/M |
3300010362|Ga0126377_12334591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 611 | Open in IMG/M |
3300010366|Ga0126379_11019340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 933 | Open in IMG/M |
3300010379|Ga0136449_101162269 | Not Available | 1220 | Open in IMG/M |
3300010397|Ga0134124_12760075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
3300012199|Ga0137383_10749624 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300012201|Ga0137365_10433546 | Not Available | 968 | Open in IMG/M |
3300012206|Ga0137380_10637459 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300012206|Ga0137380_11604577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
3300012207|Ga0137381_11801067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
3300012208|Ga0137376_10919290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 751 | Open in IMG/M |
3300012208|Ga0137376_11790785 | Not Available | 504 | Open in IMG/M |
3300012210|Ga0137378_11039489 | Not Available | 733 | Open in IMG/M |
3300012212|Ga0150985_122483662 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
3300012349|Ga0137387_10673525 | Not Available | 749 | Open in IMG/M |
3300012353|Ga0137367_11000031 | Not Available | 571 | Open in IMG/M |
3300012358|Ga0137368_10826589 | Not Available | 571 | Open in IMG/M |
3300012363|Ga0137390_11463287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 625 | Open in IMG/M |
3300012513|Ga0157326_1005087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 1385 | Open in IMG/M |
3300012529|Ga0136630_1282187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 592 | Open in IMG/M |
3300012896|Ga0157303_10325693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
3300012917|Ga0137395_11025874 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300012929|Ga0137404_12048207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
3300012955|Ga0164298_10642526 | Not Available | 735 | Open in IMG/M |
3300012955|Ga0164298_10958629 | Not Available | 628 | Open in IMG/M |
3300012958|Ga0164299_11186444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
3300012961|Ga0164302_11204670 | Not Available | 605 | Open in IMG/M |
3300012985|Ga0164308_10577126 | Not Available | 953 | Open in IMG/M |
3300012985|Ga0164308_10603503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 934 | Open in IMG/M |
3300012986|Ga0164304_10513945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 877 | Open in IMG/M |
3300012986|Ga0164304_11088246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
3300012988|Ga0164306_10398308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1034 | Open in IMG/M |
3300013105|Ga0157369_10779885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 982 | Open in IMG/M |
3300013308|Ga0157375_12678592 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300013758|Ga0120147_1018855 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1357 | Open in IMG/M |
3300013763|Ga0120179_1031328 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
3300014157|Ga0134078_10663284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 507 | Open in IMG/M |
3300014169|Ga0181531_10897660 | Not Available | 555 | Open in IMG/M |
3300014295|Ga0075305_1092459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 601 | Open in IMG/M |
3300014497|Ga0182008_10357236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 776 | Open in IMG/M |
3300014968|Ga0157379_10015220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6745 | Open in IMG/M |
3300015245|Ga0137409_11116416 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300015358|Ga0134089_10464896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 549 | Open in IMG/M |
3300015372|Ga0132256_102187155 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300015374|Ga0132255_106359257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 500 | Open in IMG/M |
3300016319|Ga0182033_11411127 | Not Available | 627 | Open in IMG/M |
3300016357|Ga0182032_11239654 | Not Available | 643 | Open in IMG/M |
3300017934|Ga0187803_10097593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 1155 | Open in IMG/M |
3300017937|Ga0187809_10210224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 693 | Open in IMG/M |
3300017966|Ga0187776_10034130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2841 | Open in IMG/M |
3300017966|Ga0187776_11057631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 600 | Open in IMG/M |
3300018042|Ga0187871_10319625 | Not Available | 858 | Open in IMG/M |
3300018060|Ga0187765_10005450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 5410 | Open in IMG/M |
3300018081|Ga0184625_10220984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 993 | Open in IMG/M |
3300018089|Ga0187774_11169285 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300018468|Ga0066662_12778006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
3300018469|Ga0190270_10497016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1161 | Open in IMG/M |
3300018476|Ga0190274_13496029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 530 | Open in IMG/M |
3300018482|Ga0066669_10984332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 760 | Open in IMG/M |
3300018482|Ga0066669_11832562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
3300020082|Ga0206353_10140334 | Not Available | 1157 | Open in IMG/M |
3300021080|Ga0210382_10099828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1208 | Open in IMG/M |
3300021363|Ga0193699_10317962 | Not Available | 649 | Open in IMG/M |
3300023071|Ga0247752_1026945 | Not Available | 838 | Open in IMG/M |
3300024055|Ga0247794_10089937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 900 | Open in IMG/M |
3300025906|Ga0207699_10091516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1910 | Open in IMG/M |
3300025916|Ga0207663_11281286 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300025927|Ga0207687_11034419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 705 | Open in IMG/M |
3300025928|Ga0207700_10452303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1132 | Open in IMG/M |
3300025930|Ga0207701_10894084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Iamiaceae → Aquihabitans → unclassified Aquihabitans → Aquihabitans sp. G128 | 744 | Open in IMG/M |
3300025935|Ga0207709_10527226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 925 | Open in IMG/M |
3300025940|Ga0207691_11611685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 528 | Open in IMG/M |
3300025949|Ga0207667_10607227 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
3300025960|Ga0207651_10842299 | Not Available | 815 | Open in IMG/M |
3300026058|Ga0208421_1014486 | Not Available | 697 | Open in IMG/M |
3300026070|Ga0208423_1004205 | Not Available | 1362 | Open in IMG/M |
3300026078|Ga0207702_11522894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 662 | Open in IMG/M |
3300026547|Ga0209156_10484987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 511 | Open in IMG/M |
3300026552|Ga0209577_10139577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1919 | Open in IMG/M |
3300026816|Ga0207509_104154 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300027842|Ga0209580_10545519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 576 | Open in IMG/M |
3300028709|Ga0307279_10003465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1563 | Open in IMG/M |
3300028718|Ga0307307_10259055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei → Conexibacter woesei DSM 14684 | 556 | Open in IMG/M |
3300028755|Ga0307316_10227366 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300028755|Ga0307316_10300544 | Not Available | 587 | Open in IMG/M |
3300028784|Ga0307282_10123669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1213 | Open in IMG/M |
3300028799|Ga0307284_10007299 | All Organisms → cellular organisms → Bacteria | 3179 | Open in IMG/M |
3300028824|Ga0307310_10018276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2732 | Open in IMG/M |
3300028885|Ga0307304_10508185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 553 | Open in IMG/M |
3300028889|Ga0247827_10908549 | Not Available | 592 | Open in IMG/M |
3300030006|Ga0299907_10545372 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
3300030707|Ga0310038_10466300 | Not Available | 539 | Open in IMG/M |
3300030785|Ga0102757_11362893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 798 | Open in IMG/M |
3300031231|Ga0170824_100716926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 541 | Open in IMG/M |
3300031231|Ga0170824_115119127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 638 | Open in IMG/M |
3300031366|Ga0307506_10042839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1279 | Open in IMG/M |
3300031544|Ga0318534_10658569 | Not Available | 593 | Open in IMG/M |
3300031564|Ga0318573_10178872 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
3300031564|Ga0318573_10274935 | Not Available | 900 | Open in IMG/M |
3300031716|Ga0310813_11027008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 753 | Open in IMG/M |
3300031719|Ga0306917_10606179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 861 | Open in IMG/M |
3300031723|Ga0318493_10713362 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300031748|Ga0318492_10301887 | Not Available | 833 | Open in IMG/M |
3300031768|Ga0318509_10741275 | Not Available | 544 | Open in IMG/M |
3300031770|Ga0318521_10182599 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
3300031771|Ga0318546_10280375 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
3300031771|Ga0318546_11047798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 574 | Open in IMG/M |
3300031779|Ga0318566_10418025 | Not Available | 659 | Open in IMG/M |
3300031781|Ga0318547_10426935 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300031821|Ga0318567_10255686 | Not Available | 984 | Open in IMG/M |
3300031847|Ga0310907_10476553 | Not Available | 664 | Open in IMG/M |
3300031854|Ga0310904_11131409 | Not Available | 562 | Open in IMG/M |
3300031859|Ga0318527_10346451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 633 | Open in IMG/M |
3300031897|Ga0318520_10704327 | Not Available | 631 | Open in IMG/M |
3300031996|Ga0308176_11314621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 768 | Open in IMG/M |
3300032008|Ga0318562_10840296 | Not Available | 525 | Open in IMG/M |
3300032066|Ga0318514_10396551 | Not Available | 732 | Open in IMG/M |
3300032068|Ga0318553_10647560 | Not Available | 553 | Open in IMG/M |
3300032180|Ga0307471_102803241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 619 | Open in IMG/M |
3300032180|Ga0307471_104312780 | Not Available | 502 | Open in IMG/M |
3300032205|Ga0307472_102190081 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300032770|Ga0335085_10160202 | All Organisms → cellular organisms → Bacteria | 2809 | Open in IMG/M |
3300032782|Ga0335082_10196918 | All Organisms → cellular organisms → Bacteria | 1916 | Open in IMG/M |
3300032828|Ga0335080_11665878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 626 | Open in IMG/M |
3300032954|Ga0335083_10069837 | All Organisms → cellular organisms → Bacteria | 3593 | Open in IMG/M |
3300033004|Ga0335084_11050100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 819 | Open in IMG/M |
3300033158|Ga0335077_10381373 | All Organisms → cellular organisms → Bacteria | 1520 | Open in IMG/M |
3300033550|Ga0247829_10565428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 944 | Open in IMG/M |
3300033551|Ga0247830_10658116 | Not Available | 831 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.33% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.74% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.63% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.11% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.11% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.11% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.59% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.07% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.07% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.55% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.55% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.55% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.55% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.55% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.55% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.55% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.55% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.04% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.04% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.04% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.04% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.04% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.04% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.04% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.52% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.52% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.52% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.52% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.52% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.52% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.52% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.52% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.52% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.52% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.52% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.52% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.52% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.52% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.52% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.52% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.52% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.52% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.52% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.52% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.52% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.52% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
2170459011 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect Gram positive lysis 0-10cm | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000887 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illumina | Environmental | Open in IMG/M |
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Host-Associated | Open in IMG/M |
3300012529 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06) | Environmental | Open in IMG/M |
3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300013758 | Permafrost microbial communities from Nunavut, Canada - A24_65cm_12M | Environmental | Open in IMG/M |
3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014295 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D1 | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026058 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026070 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026816 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO21-B (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028709 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118 | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300030785 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
cont_0789.00002710 | 2166559005 | Simulated | LIYLYAGLRAGASAEDVLARADADDAPFVPSEELRAWITEGLAQLSSK |
F64_04026710 | 2170459011 | Grass Soil | MYLYAGLRQGSSADEVIAQAEADGAPFAGSDELKAWVAQGLDELS |
ICChiseqgaiiDRAFT_23024551 | 3300000033 | Soil | AEEVLARAEADGAPFVASDALVAWVEQGLVELGESSA* |
ICChiseqgaiiDRAFT_23256421 | 3300000033 | Soil | VIYLYAGLRAGASADEVLARAEADDAVFCSTDELKAWVAQGL |
AL16A1W_103741512 | 3300000887 | Permafrost | VYLYAGLRAGATADEVLARAEEDDAPFCGSAELKAWVAQGLAELS* |
JGI11615J12901_103930451 | 3300000953 | Soil | SASAEEVVARAEADGATFLQSDELRAWVTNGLEQLS* |
JGI12269J14319_101364482 | 3300001356 | Peatlands Soil | SSALVYLYSGLRSGASPADVLARAEADGAPFVQAEPLKQWVVQGLAELSGN* |
Ga0055467_102825932 | 3300003996 | Natural And Restored Wetlands | AGASADEVLAQAAADDAPFAKSDELRNLVRRGLDELAND* |
Ga0063454_1009339251 | 3300004081 | Soil | RSSALVYLYAGLKDRASADDVLRQAEDDGAPFTKSDELKAWVRQGLGELAERS* |
Ga0063454_1009997691 | 3300004081 | Soil | GRSSAVIYLYAGLRAGATADEVLARAEADGALFCGSDDAKSWVTQGLAELR* |
Ga0062593_1011480382 | 3300004114 | Soil | AVVYLYSGLKAGASADEVIARAEADGAPFAQSDELKVWVAQGLEELSEK* |
Ga0062593_1015845202 | 3300004114 | Soil | LVTCRSGGRSSAVIYLYAGLRAGATADEVLARAEADGALFCGSDDAKAWVRQGLAELT* |
Ga0063455_1001606493 | 3300004153 | Soil | IYLYAGLRAGASAEDVLARADADGAPFVQSDELRAWVSDGLAQLS* |
Ga0062590_1008601171 | 3300004157 | Soil | IYLYAGLRAGATADEVLARAEADGALFCGSDDAKAWVRQGLAELT* |
Ga0066388_1013993532 | 3300005332 | Tropical Forest Soil | GLRAGATADEVLAHAEADGAAFAGSDELKTWVAQGLNELA* |
Ga0068869_1005913661 | 3300005334 | Miscanthus Rhizosphere | YLYAGLKGGASADDVLSRAAADGAPFMGSDELKAWIAQGLDELG* |
Ga0070671_1003623272 | 3300005355 | Switchgrass Rhizosphere | GLKEGATADEVLARAEADDAPFARSEELRAWVAQNLDALS* |
Ga0070711_1000476585 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | SSALIYLYAGLKSGASADDVLARAEADDAPWARSDELRAWVTDGLEQLS* |
Ga0070699_1019772641 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | RSSAVVYLYAGLRAGATADEVLARAERDSAPFTGSDDLKAWVTQGLDELS* |
Ga0070684_1007871051 | 3300005535 | Corn Rhizosphere | LIYLYAGLQAGASAEDVFARARADEAAFVQSDELRAWVADGLEQLS* |
Ga0070732_107963331 | 3300005542 | Surface Soil | RSSAVIYLYAGLEAGASAEAVLARAEADGAPFYASDELKAWVSQGLDELS* |
Ga0070695_1007041752 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VYLYSGLRSGATADEVLTRAEADDAPFTKSEELRAWVAQGLDELSGD* |
Ga0066698_104409881 | 3300005558 | Soil | GASADQVLAGAEADDAPFAGSDELRAWVAEGLDELA* |
Ga0066700_103662252 | 3300005559 | Soil | VYLYAGLRAGASAEDVLARAEADGAPFARSDELKAWVAQGLAELA* |
Ga0066699_109602852 | 3300005561 | Soil | SAVAYLYAGLRSGASAEEVLARADADGAPFTGFDDLRAFVTQGIEELASDE* |
Ga0068855_1004942663 | 3300005563 | Corn Rhizosphere | KAGASADEVIARAEADGAPFAGSEELETWVRQGLDELD* |
Ga0066705_108386731 | 3300005569 | Soil | AGAPAEDVLARAEADDASFVRSDELRAWVTDGLTQLS* |
Ga0066708_109431323 | 3300005576 | Soil | ASAEDVLARADADDAPFARSEELRAWVADGLAQLSRKPTQR* |
Ga0066654_103922901 | 3300005587 | Soil | VVYLYAGLRAGAAPDEVLACADADDAPFCGSDELRAWVTQGLDELS* |
Ga0068856_1016483481 | 3300005614 | Corn Rhizosphere | LIYLYAGLRAGSTAEEVLERAEADDALFVRSDELRAWVVDGLAQLS* |
Ga0068856_1025500801 | 3300005614 | Corn Rhizosphere | PRSSALIYLYAGLQAGASAEDVFARARADEAAFVQSDELRAWVADGLEQLS* |
Ga0066903_1023024622 | 3300005764 | Tropical Forest Soil | SSALIYLYGGLEAGASTEEVLARAAADDAAFLKSDELRAWVAEGLEQLS* |
Ga0066903_1034192782 | 3300005764 | Tropical Forest Soil | LVYLYSGLREGAQAGEVLERAHADGAPFTRSDELRAWVEHGLTELA* |
Ga0068851_101414181 | 3300005834 | Corn Rhizosphere | CRTGPRSAAVAYLYAGLRAGASADDVLAAADADGAPFAGVEAYREFVTRGLTELADE* |
Ga0068858_1002538934 | 3300005842 | Switchgrass Rhizosphere | RSSALVYLYSGLEAGAPADEVLRQAEADGAPFAKSDELREWVTQGLEELA* |
Ga0081539_103243542 | 3300005985 | Tabebuia Heterophylla Rhizosphere | GGVRSSAAAYLYAGLRSGATADEVIAKAEADQAPFAGNDALNAWIRQGLDELD* |
Ga0070717_116857951 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PRSSALVYMYAGLKAGATLGEVLARAEADEAPFTKSDEIKAWVAQGLEELSLED* |
Ga0066696_103131201 | 3300006032 | Soil | SAEDVLARAEAVGAPFMQSDELRAWVSDGLAQLS* |
Ga0075367_108002901 | 3300006178 | Populus Endosphere | AGLRAGATAEEVLARAEADGALFAGSDELRGWVAQGLDELS* |
Ga0097621_1004112262 | 3300006237 | Miscanthus Rhizosphere | SSALIYLYAGLQAGASAEDVFARAEADDAAFVKSDELRAWVANGLEQLS* |
Ga0079222_102557121 | 3300006755 | Agricultural Soil | AGLEAGAGADEVIARARADAAPFSGSEELEAWVRQGLSELS* |
Ga0066660_112038923 | 3300006800 | Soil | AVIYLYAGLRSAATAAEVLARAEADDALFTRSDELKAWVSQGLDELS* |
Ga0075434_1003021594 | 3300006871 | Populus Rhizosphere | LYAGLRSGASAEEVLERAKADGAPFVGNAEYEAWVAQGIRELR* |
Ga0079215_106441882 | 3300006894 | Agricultural Soil | AGLKAGASEEEVLARADADGAPFASNEELRAWVAQGLRELA* |
Ga0079219_119024363 | 3300006954 | Agricultural Soil | SGLRAGASAEDVLARAEADGAAFVQSEELRGWVVDGLARLS* |
Ga0066710_1002559191 | 3300009012 | Grasslands Soil | ALVYLYTGLGAGASADQVLAGAEADDAPFAGSDELRAWVAQGLDELA |
Ga0066710_1020248611 | 3300009012 | Grasslands Soil | ALIYLYAGLKAGASADDVLARAAADGAPFMGSDELKAWLTQGLEDLGDG |
Ga0066793_108830822 | 3300009029 | Prmafrost Soil | VYLYAGLKAGATADAVLARAEADDAPFCASEDLKAWVRQGLDELFVGEVSA* |
Ga0099828_114871571 | 3300009089 | Vadose Zone Soil | AGLRAGATADEVLARAERDSAPFTGSEELKAWVTQGLDELS* |
Ga0114129_107587892 | 3300009147 | Populus Rhizosphere | GLKAGASADEVLARAEADDAPFTRSDELKAWVAQNLDELS* |
Ga0114129_115642832 | 3300009147 | Populus Rhizosphere | SSAVVYLYAGLRSGASAEEVLARAEADNAPFTQSEELRAWVAQGLDELSAN* |
Ga0105243_103117903 | 3300009148 | Miscanthus Rhizosphere | GLRAGASADEVLARAEADDAPFIRSDELRSWVAQNLEELS* |
Ga0105248_111531231 | 3300009177 | Switchgrass Rhizosphere | LYSGLRSGASADEVIARAEADNAPFTESDDLKNWVRRGFDELA* |
Ga0105248_129353962 | 3300009177 | Switchgrass Rhizosphere | LYAGLESGASADDVLARAEADDAPWARSDELRAWVTDGLEQLR* |
Ga0116218_14721972 | 3300009522 | Peatlands Soil | ALVYLYSGLRSGASPADVLARAEADGAPFVQAEPLKEWVAQGLVELSAH* |
Ga0116216_108667272 | 3300009698 | Peatlands Soil | LVYLFAGLKAGASADDVLERAESDGAPFVDSDALRSWVMQGLSELAPPEV* |
Ga0116216_109988532 | 3300009698 | Peatlands Soil | ASADEVLARAEADDAPFTHAEDLKAWVLQGLDELA* |
Ga0116217_106947022 | 3300009700 | Peatlands Soil | LVYLFAGLKAGASADDVLERAESDGAPFVGSDALRSWVMQGLSELAPPEA* |
Ga0126314_111782812 | 3300010042 | Serpentine Soil | VYLYAGLRAGASADDVIARAEADGAPFTGSVELKAWVAQGLDELA* |
Ga0126384_108746651 | 3300010046 | Tropical Forest Soil | PRSSALIYLYAGLQAGASAEQVLARAEADDAPFASSDELRA* |
Ga0126373_110884451 | 3300010048 | Tropical Forest Soil | LYAGLQSGASAEEVLARAEADDAPFLRTDSLREWVVRGLAELRP* |
Ga0134062_103482201 | 3300010337 | Grasslands Soil | PRSSALVYLYAGLQSGASADEVIARAKADSAPFAQSDDLKSWVRQGLGELA* |
Ga0126376_117058702 | 3300010359 | Tropical Forest Soil | ALIYLYAGLQDGASADDVLARAEADGAPFVRSDELRGWVADGLAQLS* |
Ga0126377_123345912 | 3300010362 | Tropical Forest Soil | VALIYLYSGLQSGASKEEVLARAEADDATFLKSDELRAWVAEGLEQLS* |
Ga0126379_110193403 | 3300010366 | Tropical Forest Soil | SSAAIYLYAGLEAGATADEVLERADADDAPFAKSEELRAWVTQGLAELS* |
Ga0136449_1011622692 | 3300010379 | Peatlands Soil | AGLRSGATADEVLARAEEDDAPFAGSDELKAWITRGLDELA* |
Ga0134124_127600752 | 3300010397 | Terrestrial Soil | SSALIYLYAGLRAGSTAEEVLERAEADDALFVRSDELRAWVVDGLAQLS* |
Ga0137383_107496242 | 3300012199 | Vadose Zone Soil | LIYLYAGLQAGASADDVLARAEADDAAWTNSDELRAWVADGLEQLS* |
Ga0137365_104335462 | 3300012201 | Vadose Zone Soil | RSSALVYLYAGLKAGAPADEVLARAEADGAPFCGSDELKAWVRQGLAELA* |
Ga0137380_106374591 | 3300012206 | Vadose Zone Soil | LIYLYSGLKAGASAKDVLARAEADDAPFARSDELRTWVTEGLERLS* |
Ga0137380_116045773 | 3300012206 | Vadose Zone Soil | AADEVLARAEADDAPFSRSDDLKAWVAQGLDELS* |
Ga0137381_118010672 | 3300012207 | Vadose Zone Soil | LVYLYAGLKAGAAADEVLARAVADNAPFTGSEELKAWVRRGLDELS* |
Ga0137376_109192902 | 3300012208 | Vadose Zone Soil | GLRAGASADQVLARAEEDGAPFSSSAELKAWVTQGLAELA* |
Ga0137376_117907851 | 3300012208 | Vadose Zone Soil | VIYLYAGLRAGGTADEVLARAEADNAPFTGSDDLKAWVARGLAELS* |
Ga0137378_110394891 | 3300012210 | Vadose Zone Soil | ATADEVLARAEADGAPFCGSDELKAWVAQGLAELS* |
Ga0150985_1224836621 | 3300012212 | Avena Fatua Rhizosphere | LVYLWTGLQDGASAEDVLARAEAAGAPFTRSEELRAWVTQGLAELG* |
Ga0137387_106735252 | 3300012349 | Vadose Zone Soil | GATASEVLARAEADGAPFCGSDELKAWVAQGLDELA* |
Ga0137367_110000311 | 3300012353 | Vadose Zone Soil | VVYLYAGLRAGAAADEVLARAEADGAPFAGSDDLKAWVARGLDELF* |
Ga0137368_108265891 | 3300012358 | Vadose Zone Soil | TPDEVLARAEADGAPFAGSEDLKAWVVQGLDELS* |
Ga0137390_114632872 | 3300012363 | Vadose Zone Soil | VYLYAGLRAGASPDEVLARADADGAPFAAFADLRAFVTHSLQELAPKP* |
Ga0157326_10050874 | 3300012513 | Arabidopsis Rhizosphere | SSALVYLYAGLETGATADEVLARAEADGAPFAGSEELKAWVRQGLDELRSD* |
Ga0136630_12821872 | 3300012529 | Polar Desert Sand | VVYFYAGLRAGAAPDEVLARAEADGAPFAGSDELKAWVAQGL |
Ga0157303_103256931 | 3300012896 | Soil | KEGATADEVLARADADDAPFARSDELRAWVAQNLAALS* |
Ga0137395_110258741 | 3300012917 | Vadose Zone Soil | ALVYLYAGLRAGAEADEVLARAAADSAPFSGSDELEAWVAQGLAELS* |
Ga0137404_120482072 | 3300012929 | Vadose Zone Soil | AGLEAGASADEVLARAEADGAPFVRSDALKAWVVQALAELG* |
Ga0164298_106425261 | 3300012955 | Soil | AGLESGEPADEVLRQAEADQAPFTRSDALKAWVAKGLGELA* |
Ga0164298_109586292 | 3300012955 | Soil | RSSALVYLYAGLRTGATADEVLARAEAENAPFCDSPALKHWVEQGLDELS* |
Ga0164299_111864441 | 3300012958 | Soil | VSNGPSLLRLIYLYAGLRAGAAPDEVLARAEADEALFIASDDLRAWVRQGLEELS* |
Ga0164302_112046702 | 3300012961 | Soil | APADDVIARAEADNAPFAQSDELKAWVRQGLDELA* |
Ga0164308_105771264 | 3300012985 | Soil | SGEPADEVLRQAEADQAPFTRSDALKAWVVKGLGELA* |
Ga0164308_106035031 | 3300012985 | Soil | ALIYLYAGLQSDASAKDVFARAEGDGAAFVKSDELRAWVANGLEQLS* |
Ga0164304_105139451 | 3300012986 | Soil | SAALIYLYAGLSAGAAAEDVLARADADDAPFVGSEELRAWITEGLAQLSSK* |
Ga0164304_110882462 | 3300012986 | Soil | LRAGATPDEVLARAEADGAPFCGSDELKAWVVQGLDELS* |
Ga0164306_103983081 | 3300012988 | Soil | LRAEAPAEDVLACADADDAPFVRSEELRAWITEGLAQLSSK* |
Ga0157369_107798851 | 3300013105 | Corn Rhizosphere | SALIYLYAGLRAGASAEDLFARAEADDAMFVQSDELRAWVADGLKQLS* |
Ga0157375_126785922 | 3300013308 | Miscanthus Rhizosphere | LIYLYSGLRSGASADEVIARGEADNAPFTESDDLKNWVRQGFDELA* |
Ga0120147_10188551 | 3300013758 | Permafrost | LVYLHAGLRSGAGADEVLARAQADDAPFTHAEDLKAWVVQGINELA* |
Ga0120179_10313283 | 3300013763 | Permafrost | IYLYAGLRAGASAKDVLARAEVDDAPFARSEELRAWVTEGLEQLS* |
Ga0134078_106632841 | 3300014157 | Grasslands Soil | LYSGLQAGASAEDVFARARADDAAFVQSDELRAWVADGLEQLS* |
Ga0181531_108976601 | 3300014169 | Bog | QSHASPDEVVERAEADGAPWVHSDEITAWVRQGLDELR* |
Ga0075305_10924591 | 3300014295 | Natural And Restored Wetlands | KTGATADEVLTRAESDEAPFAGSDELKAWVTQGLSELA* |
Ga0182008_103572362 | 3300014497 | Rhizosphere | ALVYLYAGLKAGAGRDEVLARAEADGAPFSGSDELKAWVAQGLDELA* |
Ga0157379_1001522010 | 3300014968 | Switchgrass Rhizosphere | SSALVYLYSGLEAGAPADEVLRQAEADGAPFAKSDELREWVTQGLEELA* |
Ga0137409_111164161 | 3300015245 | Vadose Zone Soil | GASADDVLARAAADGALFMGSDELKAWVTQGLDDLGDD* |
Ga0134089_104648962 | 3300015358 | Grasslands Soil | RSSALVYLYTGLGAGASADQVLARAEADDAPFAGSDELRAWVAEGLDELA* |
Ga0132256_1021871552 | 3300015372 | Arabidopsis Rhizosphere | AGASAEEVLARADVDAAPFAASDELRALVSHGLADLAPDG* |
Ga0132255_1063592571 | 3300015374 | Arabidopsis Rhizosphere | DEVLAQAEADGAPFVEAEPLKAWVTQGLSELSAQ* |
Ga0182033_114111271 | 3300016319 | Soil | LYSGLRSGAGADEVMARAEADGAPFVEVDSLKGWVVQGLAELT |
Ga0182032_112396542 | 3300016357 | Soil | RGGASADEVLERAQADGAPFIDAGPLKAWVAQGLAELS |
Ga0187803_100975932 | 3300017934 | Freshwater Sediment | SSALVYLYSGLRSGASPADVLARAEADGAPFVQAEPLKQWVVQGLEELR |
Ga0187809_102102242 | 3300017937 | Freshwater Sediment | GLQAGASAEDVLARADADDAPFAKSDELRAWVSDGLRQL |
Ga0187776_100341301 | 3300017966 | Tropical Peatland | PGVPVRGARSGASADELLARAEADGAPFTQAEPLEAWVAQGLAELS |
Ga0187776_110576312 | 3300017966 | Tropical Peatland | GLRSGASAEEVLTRAEADGAPFTQAEPLKAWVVQGLAELS |
Ga0187871_103196253 | 3300018042 | Peatland | YLYAGLKAGATEQEVLAQAQSDGAPFVQSDELVAWVKQGLAELK |
Ga0187765_100054505 | 3300018060 | Tropical Peatland | RSSALIYLYAGLRSSASAEDVIARAEADDAPFVRSDELRAWVTEGLTQLA |
Ga0184625_102209843 | 3300018081 | Groundwater Sediment | VYLYAGLKAGATADEVLARAEADGAPFAGSDELRAWVTRGLDELS |
Ga0187774_111692852 | 3300018089 | Tropical Peatland | VYLYAGLLARAEADGAPFTQAEPLEAWVAQGLAELS |
Ga0066662_127780062 | 3300018468 | Grasslands Soil | GASADEVLARAEADEAPFAGSEEIRTWITESLTELS |
Ga0190270_104970163 | 3300018469 | Soil | SAVIYLYAGLQQQASAEEVLARAEQDGATFVADEGLRSWVSEGLTELA |
Ga0190274_134960292 | 3300018476 | Soil | VYLYAGLRAGASASDVLARARADGAPFVGNEALEDWVTQGLTELA |
Ga0066669_109843322 | 3300018482 | Grasslands Soil | AALIYLSAGLKAGASADDVLARAAADGAPFMGSDELKAWVTQGLDDLIDD |
Ga0066669_118325621 | 3300018482 | Grasslands Soil | GATADEVLARAERDSAPFTGSDDLKAWVTQGLDELS |
Ga0206353_101403341 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | GASADDVLARADADGAPFIGSDDLKAWVRQGLAELG |
Ga0210382_100998281 | 3300021080 | Groundwater Sediment | GAAADQVLARAEADDAPFTRSDDLKAWVAQGLDELS |
Ga0193699_103179621 | 3300021363 | Soil | RSGATADQVLAQADADDAPFSHSDELKAWVVQGLEELS |
Ga0247752_10269453 | 3300023071 | Soil | GLAAGASADEVLRRAAADDAPFAQNQELEQWVTQGLEELS |
Ga0247794_100899371 | 3300024055 | Soil | SALIYLYAGLRAGASAEDVFARAEADDAMFVQSDELRAWVADGLKQLS |
Ga0207699_100915161 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LVYLYSGLKEGATADEVLARAEADDAPFARSEELRAWVAQNLDALS |
Ga0207663_112812862 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | SSAAVYLYAGLRAGAPAEEVLASAAAEGAPFSGMPPLEAWVTQGLAELA |
Ga0207687_110344192 | 3300025927 | Miscanthus Rhizosphere | LRAGASADEVLARAEADDAPFIRSDELKSWVAQNLEELS |
Ga0207700_104523032 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ALVYLYSGLKEGATADEVLARAEADDAPFARSEELRAWVAQNLDALS |
Ga0207701_108940841 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | RSSAVIYLYAGLRSGASSDEVLARAGADDAPFTKSDELVAWVRQGLADLA |
Ga0207709_105272262 | 3300025935 | Miscanthus Rhizosphere | AGLRAGASADEVLARAEADDAPFIRSDELRSWVAQNLEELS |
Ga0207691_116116852 | 3300025940 | Miscanthus Rhizosphere | GASADDVLARAEADGAPFADADPLRAWVVQGLAELA |
Ga0207689_111064571 | 3300025942 | Miscanthus Rhizosphere | LVTCRTGGRSAALIYLYAGLKGGASADDVLSRAAADGAPFMGSDELKAWIAQGLDELG |
Ga0207667_106072271 | 3300025949 | Corn Rhizosphere | GLKAGASADEVIARAEADGAPFAGSEELETWVRQGLDELD |
Ga0207651_108422991 | 3300025960 | Switchgrass Rhizosphere | TCRTGGRSAALIYLYAGLKGGASADDVLARAAADGAPFMGSDELKTWIAQGLDELG |
Ga0208421_10144861 | 3300026058 | Natural And Restored Wetlands | NAPADEVLRRAEADDAPFAKSDELRAWVTQGLEELPELGR |
Ga0208423_10042051 | 3300026070 | Natural And Restored Wetlands | LVYLYAGLKAGATADEVLTRAEEDEAPFTGSDDLKAWVAQGLHQLS |
Ga0207702_115228943 | 3300026078 | Corn Rhizosphere | AGLRAGSTAEEVLERAEADDALFVRSDELRAWVVDGLAQLS |
Ga0209156_104849871 | 3300026547 | Soil | YAGLRAGAPAEDVLARAEADDASFVRSDELRAWVTDGLTQLS |
Ga0209577_101395771 | 3300026552 | Soil | AVVYLYAGLRAGASPDEVLARADADGAPFAGSDELRGFVVQGLHELAPDNT |
Ga0207509_1041543 | 3300026816 | Soil | LESGASADDVLARAEADDAPWARSDGLRAWVTDGLEQLR |
Ga0209580_105455192 | 3300027842 | Surface Soil | RSSAVIYLYAGLEAGASAEAVLARAEADGAPFYASDELKAWVSQGLDELS |
Ga0307279_100034653 | 3300028709 | Soil | GLRAGASADEVLERAEADDAPFIRSDELKSWVAQNLEELS |
Ga0307307_102590551 | 3300028718 | Soil | SSALVYLYAGLRAGAGPDDVLARAEADGAPFAGSDELKGWVTQGLDELS |
Ga0307316_102273661 | 3300028755 | Soil | SGLKAGASADEVIARAEADGAPFAQSDELKAWVTQGLGELSEK |
Ga0307316_103005442 | 3300028755 | Soil | RAGASAGEVLARAEADGAPFCGSDELKAWVTQGLDELA |
Ga0307282_101236693 | 3300028784 | Soil | LTAGAGPDDVLARAEADGAPFAGSDELKGWVTQGLDELS |
Ga0307504_104872031 | 3300028792 | Soil | GPRSAAVAYLYAGLRAGASADDVLARADADAAPFAGVDAFRAFVTRGLEELRTEAQ |
Ga0307284_100072995 | 3300028799 | Soil | LFRSDEVLARAEADDAPFIRSDELKSWVAQNLEELS |
Ga0307310_100182761 | 3300028824 | Soil | AGATADAVLARADADDAPFAGSDELRAWVTRGLDELS |
Ga0307304_105081852 | 3300028885 | Soil | LVYLYAGLKAGATADDVLARADADDAPFAGSDELRAW |
Ga0247827_109085491 | 3300028889 | Soil | GAAADAVLARAEADGAPFCGSDELKAWVAQGLDELS |
Ga0299907_105453721 | 3300030006 | Soil | VYLYSGLRAGASSGEVLARADADGAPFAGFDDLRAFVTEGLTELAPDA |
Ga0310038_104663001 | 3300030707 | Peatlands Soil | KAGASADDVLERAESDGAPFVGSDALRSWVMQGLSELAPPEA |
Ga0102757_113628932 | 3300030785 | Soil | AGAAADEVLARAEADDAPFSHSDDLRAWVTQGLDELS |
Ga0170824_1007169261 | 3300031231 | Forest Soil | YLYAGLRAEASVEEVLARADADDAPFVRSEELLAWITEGLAQLSSK |
Ga0170824_1151191273 | 3300031231 | Forest Soil | PRSSALVYLYAGLRAGATAEEVLARAEADDAPFFGSAELKAWVVQGLEELS |
Ga0307506_100428392 | 3300031366 | Soil | PRSSALIYLYAGLQAGAQTEDVLARAEADGAAFVQSDELRAWVADGLEQLS |
Ga0318534_106585691 | 3300031544 | Soil | PALIYLYAGLQAGATAEDVLARAEADGAVFVQSDELRAWVTDGLTQLAAT |
Ga0318573_101788721 | 3300031564 | Soil | LYSGLLSGAPADDVLARAEADGAPFTQAEPLKAWVTQGLAELS |
Ga0318573_102749351 | 3300031564 | Soil | LYAGLLAGASAEDVLARADEDDAPFVGSAELRAWITDGLTQLSSN |
Ga0310813_110270081 | 3300031716 | Soil | IYLYAGLQAGASADDVLPRAAADDAAFVQSDELRAWVADGLEQLS |
Ga0306917_106061791 | 3300031719 | Soil | GGASADEVLERAQADGAPFIDAGPLKAWVAQGLAELS |
Ga0318493_107133621 | 3300031723 | Soil | CRTGPRASALVYLYSGLLSGAPADDVLARAEADGAPFTQAEPLKAWVTQGLAELS |
Ga0318492_103018871 | 3300031748 | Soil | LYAGLRAGASVDEVLERAEADGAPFIGAEPLKAWVAQGLAELP |
Ga0318509_107412752 | 3300031768 | Soil | LIYLYAGLQAGATAEDVLARAEADGAVFVQSDELRAWVTDGLTQLAAT |
Ga0318521_101825991 | 3300031770 | Soil | PRASALVYLYSGLLSGAPADDVLARAEADGAPFTQAEPLKAWVTQGLAELS |
Ga0318546_102803751 | 3300031771 | Soil | GPRASALVYLYSGLLSGAPADDVLARAEADGAPFTQAEPLKAWVTQGLAELS |
Ga0318546_110477981 | 3300031771 | Soil | VYLYSGLRSGASADEVLARAEADGAPFVQAEPLKEWVVQGLSQLHPEVVDR |
Ga0318566_104180251 | 3300031779 | Soil | IYLYAGLLAGASAEDVLARADEDDAPFVGSAELRAWITDGLTQLSSN |
Ga0318547_104269352 | 3300031781 | Soil | VYLYAGLRSGASADQVLARAEADEAPFTQAEPLKAWVEQGLAELS |
Ga0318567_102556861 | 3300031821 | Soil | SALVYLYSGLLSGAPADDVLARAEADGAPFTQAEPLKAWVTQGLAELS |
Ga0310907_104765532 | 3300031847 | Soil | AGLKAGASAEEVLARAEADGAPFVASDALVAWVEQGLVELGESPA |
Ga0310904_111314092 | 3300031854 | Soil | KAGASAEEVLARAEADDAPFVASDELKAWVTQGLTELA |
Ga0318527_103464511 | 3300031859 | Soil | YLYAGLQAGASADDVLARAEADDAVFVKSDELRAWVADGLEQLS |
Ga0318520_107043272 | 3300031897 | Soil | GLQAGATADEVLARADADSAPFAKVEEYRALVARGLDELANDD |
Ga0308176_113146211 | 3300031996 | Soil | ALIYLYAGLRAGASPDDVLARAETDHAQFVKSDELRDWVAKGLVQLS |
Ga0318562_108402961 | 3300032008 | Soil | LYAGLRAGASADEVLERAEADGAPFIEAEPLKAWVAQGLAELS |
Ga0318514_103965513 | 3300032066 | Soil | VTCRTGPRSAALIYLYAGLLAGASAEDVLARADEDDAPFVGSAELRAWITDGLTQLSSN |
Ga0318553_106475602 | 3300032068 | Soil | ALSSSALIYLYSGLRAGASADDVLERAEADGAPWTQSDELKAWVRQGLDELA |
Ga0307471_1028032412 | 3300032180 | Hardwood Forest Soil | AGASTEDVLARAETDGAAFVQSDDLRAWVANGLEQLS |
Ga0307471_1043127802 | 3300032180 | Hardwood Forest Soil | LRSGASAHEELARAEADGAPVTEAEPLKAWVVQGLAELS |
Ga0307472_1021900813 | 3300032205 | Hardwood Forest Soil | RSSALVYLYAGLRAGATADEVLARAEADDAPFFASDELKAWVAQGLDELG |
Ga0335085_101602024 | 3300032770 | Soil | VTDFETPTDLIYLYAGLRAGVSAEAVLARAEADDAAFLKSDELRTWVATGLEQLS |
Ga0335082_101969182 | 3300032782 | Soil | VTDFETPTDLIYLYAGLRAGASAEAVLARAEADDAAFLRSDELRIWVATGLEQLS |
Ga0335080_116658782 | 3300032828 | Soil | VTDFETPTDLIYLCAGLRAGASAEDVLARAEADDAAFLKSDELRIWVATGLEQLS |
Ga0335083_100698375 | 3300032954 | Soil | YAGLRAGVSAEAVLARAEADDAAFLKSDELRTWVATGLEQLSRPPREGHA |
Ga0335084_110501002 | 3300033004 | Soil | VTDFETPTDLIYLYAGLRAGASAEAVLARAEADDAAFLKSDELRTWVATGLEQLS |
Ga0335077_103813733 | 3300033158 | Soil | VTDFETPTDLIYLYAGLRAGASAEDVLARAEADDAAFLKSDDLRTWVATGLEQLS |
Ga0247829_105654282 | 3300033550 | Soil | VYLYAGLRAGASGDEVLARAEADDAPFIRSDELKSWVAQNLEELS |
Ga0247830_106581161 | 3300033551 | Soil | SAVIYLYAGLQQRASAEEVLARAERDGAMFVADEGLKAWVTEGLTELA |
⦗Top⦘ |