| Basic Information | |
|---|---|
| Family ID | F027860 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 193 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MDRPPAPPKEDERQTRRDLRAALIFGVVAATIELAALLYFFR |
| Number of Associated Samples | 130 |
| Number of Associated Scaffolds | 193 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 30.57 % |
| % of genes near scaffold ends (potentially truncated) | 18.13 % |
| % of genes from short scaffolds (< 2000 bps) | 79.79 % |
| Associated GOLD sequencing projects | 117 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (86.010 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (10.881 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.451 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.705 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 193 Family Scaffolds |
|---|---|---|
| PF01627 | Hpt | 13.99 |
| PF02687 | FtsX | 11.40 |
| PF13540 | RCC1_2 | 10.88 |
| PF00072 | Response_reg | 2.59 |
| PF05157 | T2SSE_N | 1.55 |
| PF00069 | Pkinase | 1.55 |
| PF00005 | ABC_tran | 1.04 |
| PF00202 | Aminotran_3 | 0.52 |
| PF05193 | Peptidase_M16_C | 0.52 |
| PF01165 | Ribosomal_S21 | 0.52 |
| PF01653 | DNA_ligase_aden | 0.52 |
| PF00034 | Cytochrom_C | 0.52 |
| PF03129 | HGTP_anticodon | 0.52 |
| PF13472 | Lipase_GDSL_2 | 0.52 |
| PF10017 | Methyltransf_33 | 0.52 |
| PF12704 | MacB_PCD | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 193 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 6.22 |
| COG0124 | Histidyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG0272 | NAD-dependent DNA ligase | Replication, recombination and repair [L] | 0.52 |
| COG0423 | Glycyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG0441 | Threonyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.01 % |
| Unclassified | root | N/A | 13.99 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_116661125 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 540 | Open in IMG/M |
| 3300001535|A3PFW1_10279380 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4689 | Open in IMG/M |
| 3300001661|JGI12053J15887_10426251 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 636 | Open in IMG/M |
| 3300001661|JGI12053J15887_10607849 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 520 | Open in IMG/M |
| 3300004114|Ga0062593_100087320 | All Organisms → cellular organisms → Bacteria | 2141 | Open in IMG/M |
| 3300004156|Ga0062589_100504999 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1020 | Open in IMG/M |
| 3300004463|Ga0063356_102742437 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 758 | Open in IMG/M |
| 3300004463|Ga0063356_103160219 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 710 | Open in IMG/M |
| 3300004643|Ga0062591_100496532 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1046 | Open in IMG/M |
| 3300005093|Ga0062594_100372028 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300005327|Ga0070658_10013093 | All Organisms → cellular organisms → Bacteria | 6655 | Open in IMG/M |
| 3300005327|Ga0070658_10467288 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1088 | Open in IMG/M |
| 3300005328|Ga0070676_10160083 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300005329|Ga0070683_100029528 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4965 | Open in IMG/M |
| 3300005330|Ga0070690_100011912 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 5105 | Open in IMG/M |
| 3300005331|Ga0070670_100516966 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1063 | Open in IMG/M |
| 3300005334|Ga0068869_100768849 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 826 | Open in IMG/M |
| 3300005339|Ga0070660_100215106 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1561 | Open in IMG/M |
| 3300005347|Ga0070668_100129586 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2023 | Open in IMG/M |
| 3300005347|Ga0070668_100891118 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 795 | Open in IMG/M |
| 3300005353|Ga0070669_100022344 | All Organisms → cellular organisms → Bacteria | 4522 | Open in IMG/M |
| 3300005355|Ga0070671_100273623 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1435 | Open in IMG/M |
| 3300005437|Ga0070710_10562151 | Not Available | 789 | Open in IMG/M |
| 3300005438|Ga0070701_10160241 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1303 | Open in IMG/M |
| 3300005444|Ga0070694_101928768 | Not Available | 504 | Open in IMG/M |
| 3300005457|Ga0070662_100314715 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1275 | Open in IMG/M |
| 3300005543|Ga0070672_100679639 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 900 | Open in IMG/M |
| 3300005543|Ga0070672_101223701 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300005543|Ga0070672_101321805 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 644 | Open in IMG/M |
| 3300005563|Ga0068855_100044348 | All Organisms → cellular organisms → Bacteria | 5263 | Open in IMG/M |
| 3300005578|Ga0068854_100753101 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300005587|Ga0066654_10621338 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 599 | Open in IMG/M |
| 3300005616|Ga0068852_100060437 | All Organisms → cellular organisms → Bacteria | 3289 | Open in IMG/M |
| 3300005616|Ga0068852_100800034 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 957 | Open in IMG/M |
| 3300005616|Ga0068852_100962438 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 872 | Open in IMG/M |
| 3300005617|Ga0068859_102067553 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 629 | Open in IMG/M |
| 3300005618|Ga0068864_101148067 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 774 | Open in IMG/M |
| 3300005718|Ga0068866_10086856 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1694 | Open in IMG/M |
| 3300005718|Ga0068866_10238045 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1107 | Open in IMG/M |
| 3300005844|Ga0068862_100857098 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 891 | Open in IMG/M |
| 3300006046|Ga0066652_100000792 | All Organisms → cellular organisms → Bacteria | 15657 | Open in IMG/M |
| 3300006358|Ga0068871_100701160 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 927 | Open in IMG/M |
| 3300006606|Ga0074062_12966700 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 560 | Open in IMG/M |
| 3300006894|Ga0079215_10492285 | Not Available | 761 | Open in IMG/M |
| 3300006918|Ga0079216_11048756 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 636 | Open in IMG/M |
| 3300006949|Ga0075528_10079497 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 854 | Open in IMG/M |
| 3300006954|Ga0079219_11687365 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 586 | Open in IMG/M |
| 3300007004|Ga0079218_10139468 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
| 3300009094|Ga0111539_10538993 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1359 | Open in IMG/M |
| 3300009098|Ga0105245_12107840 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 618 | Open in IMG/M |
| 3300009137|Ga0066709_100330066 | All Organisms → cellular organisms → Bacteria | 2086 | Open in IMG/M |
| 3300009176|Ga0105242_11034167 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 831 | Open in IMG/M |
| 3300009651|Ga0105859_1064128 | Not Available | 949 | Open in IMG/M |
| 3300009789|Ga0126307_10069831 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2764 | Open in IMG/M |
| 3300009789|Ga0126307_10244455 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1442 | Open in IMG/M |
| 3300009840|Ga0126313_10027031 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3895 | Open in IMG/M |
| 3300009840|Ga0126313_10097941 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2151 | Open in IMG/M |
| 3300009840|Ga0126313_11133290 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 643 | Open in IMG/M |
| 3300010036|Ga0126305_10370297 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 941 | Open in IMG/M |
| 3300010036|Ga0126305_11015913 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 569 | Open in IMG/M |
| 3300010037|Ga0126304_10739249 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 666 | Open in IMG/M |
| 3300010039|Ga0126309_10359567 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 859 | Open in IMG/M |
| 3300010039|Ga0126309_11256394 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 511 | Open in IMG/M |
| 3300010044|Ga0126310_10123963 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1606 | Open in IMG/M |
| 3300010166|Ga0126306_10155085 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1703 | Open in IMG/M |
| 3300010166|Ga0126306_10285754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1267 | Open in IMG/M |
| 3300012046|Ga0136634_10044815 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1580 | Open in IMG/M |
| 3300012212|Ga0150985_101287199 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 510 | Open in IMG/M |
| 3300012212|Ga0150985_105756131 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 866 | Open in IMG/M |
| 3300012212|Ga0150985_108274142 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 544 | Open in IMG/M |
| 3300012285|Ga0137370_10846398 | Not Available | 567 | Open in IMG/M |
| 3300012469|Ga0150984_109347917 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 779 | Open in IMG/M |
| 3300012469|Ga0150984_121391987 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 758 | Open in IMG/M |
| 3300012530|Ga0136635_10182941 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 707 | Open in IMG/M |
| 3300012682|Ga0136611_10761705 | Not Available | 585 | Open in IMG/M |
| 3300012682|Ga0136611_10831571 | Not Available | 554 | Open in IMG/M |
| 3300012911|Ga0157301_10138264 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 762 | Open in IMG/M |
| 3300012913|Ga0157298_10322693 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 557 | Open in IMG/M |
| 3300012961|Ga0164302_11594884 | Not Available | 542 | Open in IMG/M |
| 3300012985|Ga0164308_10589679 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 944 | Open in IMG/M |
| 3300012987|Ga0164307_11096434 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 654 | Open in IMG/M |
| 3300012988|Ga0164306_10475486 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 956 | Open in IMG/M |
| 3300012989|Ga0164305_11567824 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 587 | Open in IMG/M |
| 3300013100|Ga0157373_10042634 | All Organisms → cellular organisms → Bacteria | 3243 | Open in IMG/M |
| 3300013100|Ga0157373_10062507 | All Organisms → cellular organisms → Bacteria | 2637 | Open in IMG/M |
| 3300013102|Ga0157371_10257043 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1259 | Open in IMG/M |
| 3300013102|Ga0157371_10728989 | Not Available | 743 | Open in IMG/M |
| 3300013102|Ga0157371_10986727 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 642 | Open in IMG/M |
| 3300013102|Ga0157371_11370352 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 549 | Open in IMG/M |
| 3300013104|Ga0157370_11619359 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 582 | Open in IMG/M |
| 3300013105|Ga0157369_10801679 | Not Available | 967 | Open in IMG/M |
| 3300013307|Ga0157372_10210791 | All Organisms → cellular organisms → Bacteria | 2252 | Open in IMG/M |
| 3300013307|Ga0157372_11212077 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 872 | Open in IMG/M |
| 3300013307|Ga0157372_12655579 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 575 | Open in IMG/M |
| 3300014325|Ga0163163_12077206 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 628 | Open in IMG/M |
| 3300015163|Ga0167665_1022491 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1248 | Open in IMG/M |
| 3300015167|Ga0167661_1063186 | Not Available | 687 | Open in IMG/M |
| 3300015192|Ga0167646_1037463 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1163 | Open in IMG/M |
| 3300015196|Ga0167627_1002422 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 10175 | Open in IMG/M |
| 3300015262|Ga0182007_10075791 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1103 | Open in IMG/M |
| 3300015262|Ga0182007_10375905 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 538 | Open in IMG/M |
| 3300015371|Ga0132258_10261665 | All Organisms → cellular organisms → Bacteria | 4235 | Open in IMG/M |
| 3300015371|Ga0132258_10642591 | All Organisms → cellular organisms → Bacteria | 2668 | Open in IMG/M |
| 3300015374|Ga0132255_102491208 | Not Available | 790 | Open in IMG/M |
| 3300017695|Ga0180121_10070305 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1244 | Open in IMG/M |
| 3300018433|Ga0066667_10315569 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1224 | Open in IMG/M |
| 3300018476|Ga0190274_10082259 | All Organisms → cellular organisms → Bacteria | 2483 | Open in IMG/M |
| 3300018476|Ga0190274_10173960 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1855 | Open in IMG/M |
| 3300018476|Ga0190274_11316019 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 810 | Open in IMG/M |
| 3300018476|Ga0190274_13804789 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 511 | Open in IMG/M |
| 3300018920|Ga0190273_11155455 | Not Available | 654 | Open in IMG/M |
| 3300019361|Ga0173482_10115924 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 995 | Open in IMG/M |
| 3300019362|Ga0173479_10265280 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300019877|Ga0193722_1020390 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1712 | Open in IMG/M |
| 3300021363|Ga0193699_10000587 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 15465 | Open in IMG/M |
| 3300021363|Ga0193699_10132881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 37-65-4 | 1018 | Open in IMG/M |
| 3300022756|Ga0222622_10622034 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 781 | Open in IMG/M |
| 3300022756|Ga0222622_11081591 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 590 | Open in IMG/M |
| 3300025315|Ga0207697_10021487 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2641 | Open in IMG/M |
| 3300025321|Ga0207656_10072827 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1530 | Open in IMG/M |
| 3300025481|Ga0208079_1055793 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 876 | Open in IMG/M |
| 3300025484|Ga0208587_1000376 | All Organisms → cellular organisms → Bacteria | 24657 | Open in IMG/M |
| 3300025899|Ga0207642_11029119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Agromyces → unclassified Agromyces → Agromyces sp. ISL-38 | 531 | Open in IMG/M |
| 3300025904|Ga0207647_10645683 | Not Available | 581 | Open in IMG/M |
| 3300025907|Ga0207645_10085536 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2025 | Open in IMG/M |
| 3300025907|Ga0207645_10115167 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1743 | Open in IMG/M |
| 3300025907|Ga0207645_10562692 | Not Available | 774 | Open in IMG/M |
| 3300025909|Ga0207705_10012870 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 6040 | Open in IMG/M |
| 3300025909|Ga0207705_10021942 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4555 | Open in IMG/M |
| 3300025909|Ga0207705_11172981 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 590 | Open in IMG/M |
| 3300025919|Ga0207657_11261166 | Not Available | 560 | Open in IMG/M |
| 3300025920|Ga0207649_11434508 | Not Available | 546 | Open in IMG/M |
| 3300025921|Ga0207652_10549590 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1038 | Open in IMG/M |
| 3300025925|Ga0207650_11208054 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 644 | Open in IMG/M |
| 3300025928|Ga0207700_10834483 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 825 | Open in IMG/M |
| 3300025929|Ga0207664_11015572 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 743 | Open in IMG/M |
| 3300025931|Ga0207644_10341383 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1214 | Open in IMG/M |
| 3300025934|Ga0207686_10065445 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2318 | Open in IMG/M |
| 3300025937|Ga0207669_11304749 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 617 | Open in IMG/M |
| 3300025940|Ga0207691_10016877 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 6928 | Open in IMG/M |
| 3300025940|Ga0207691_10176617 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1868 | Open in IMG/M |
| 3300025944|Ga0207661_10119003 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2246 | Open in IMG/M |
| 3300025945|Ga0207679_10325305 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1333 | Open in IMG/M |
| 3300025945|Ga0207679_10452004 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1139 | Open in IMG/M |
| 3300025945|Ga0207679_11033719 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 753 | Open in IMG/M |
| 3300026035|Ga0207703_10730431 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 943 | Open in IMG/M |
| 3300026067|Ga0207678_11503123 | Not Available | 594 | Open in IMG/M |
| 3300026121|Ga0207683_10127417 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2289 | Open in IMG/M |
| 3300026142|Ga0207698_10233950 | All Organisms → cellular organisms → Bacteria | 1670 | Open in IMG/M |
| 3300026142|Ga0207698_10435057 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1262 | Open in IMG/M |
| 3300026142|Ga0207698_10529196 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1152 | Open in IMG/M |
| 3300026285|Ga0209438_1037925 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1597 | Open in IMG/M |
| 3300026304|Ga0209240_1001394 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 9495 | Open in IMG/M |
| 3300027546|Ga0208984_1116258 | Not Available | 578 | Open in IMG/M |
| 3300027637|Ga0209818_1201765 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 582 | Open in IMG/M |
| 3300027691|Ga0209485_1028402 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1332 | Open in IMG/M |
| 3300027886|Ga0209486_10529800 | Not Available | 737 | Open in IMG/M |
| 3300028778|Ga0307288_10252212 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 692 | Open in IMG/M |
| 3300028792|Ga0307504_10298717 | Not Available | 605 | Open in IMG/M |
| 3300030496|Ga0268240_10029523 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1092 | Open in IMG/M |
| 3300031232|Ga0302323_100370826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 37-65-4 | 1505 | Open in IMG/M |
| 3300031548|Ga0307408_100426615 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1145 | Open in IMG/M |
| 3300031901|Ga0307406_11087678 | Not Available | 690 | Open in IMG/M |
| 3300031911|Ga0307412_11493021 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 614 | Open in IMG/M |
| 3300031938|Ga0308175_100004910 | All Organisms → cellular organisms → Bacteria | 9437 | Open in IMG/M |
| 3300031938|Ga0308175_100103248 | All Organisms → cellular organisms → Bacteria | 2631 | Open in IMG/M |
| 3300031938|Ga0308175_100113747 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2522 | Open in IMG/M |
| 3300031938|Ga0308175_100269982 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1718 | Open in IMG/M |
| 3300031938|Ga0308175_100419333 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1403 | Open in IMG/M |
| 3300031938|Ga0308175_100452639 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300031938|Ga0308175_100530964 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1256 | Open in IMG/M |
| 3300031938|Ga0308175_100620358 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300031938|Ga0308175_100711210 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1092 | Open in IMG/M |
| 3300031938|Ga0308175_101603493 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 728 | Open in IMG/M |
| 3300031938|Ga0308175_101812114 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 684 | Open in IMG/M |
| 3300031938|Ga0308175_102744142 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 551 | Open in IMG/M |
| 3300031938|Ga0308175_102914945 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 533 | Open in IMG/M |
| 3300031939|Ga0308174_10157629 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1695 | Open in IMG/M |
| 3300031939|Ga0308174_11249897 | Not Available | 634 | Open in IMG/M |
| 3300031939|Ga0308174_11552697 | Not Available | 568 | Open in IMG/M |
| 3300031996|Ga0308176_10155005 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2103 | Open in IMG/M |
| 3300031996|Ga0308176_10908165 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 925 | Open in IMG/M |
| 3300031996|Ga0308176_11667538 | Not Available | 680 | Open in IMG/M |
| 3300031996|Ga0308176_11880864 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 639 | Open in IMG/M |
| 3300032074|Ga0308173_10113838 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 2129 | Open in IMG/M |
| 3300032126|Ga0307415_100921132 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 807 | Open in IMG/M |
| 3300033412|Ga0310810_10023080 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 7537 | Open in IMG/M |
| 3300034384|Ga0372946_0002081 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 9032 | Open in IMG/M |
| 3300034384|Ga0372946_0076356 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1546 | Open in IMG/M |
| 3300034384|Ga0372946_0198728 | Not Available | 966 | Open in IMG/M |
| 3300034384|Ga0372946_0324979 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 746 | Open in IMG/M |
| 3300034384|Ga0372946_0533725 | Not Available | 569 | Open in IMG/M |
| 3300034384|Ga0372946_0574650 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 546 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 10.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.36% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 6.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 6.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.18% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 5.18% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.11% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 2.59% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.07% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.07% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.07% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.07% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.07% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.07% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.55% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.55% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.55% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.04% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.04% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.04% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.04% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.52% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.52% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.52% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.52% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.52% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.52% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006949 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009651 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300012046 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
| 3300012682 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ223 (23.06) | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015163 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb1b, glacier snout) | Environmental | Open in IMG/M |
| 3300015167 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015192 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2a, rock/snow interface) | Environmental | Open in IMG/M |
| 3300015196 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G2C, Ice surface) | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025481 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025484 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1166611252 | 3300000956 | Soil | KEDERQTRRDLRAALIFGIVAATIELGVILYFMR* |
| A3PFW1_102793802 | 3300001535 | Permafrost | MKEDTTQTRRDIRAAVIFGAVAAAIELAVLIYFFR* |
| JGI12053J15887_104262512 | 3300001661 | Forest Soil | MTENHDHTRRDLRAALIFGLVAAALELGALLYFFR* |
| JGI12053J15887_106078492 | 3300001661 | Forest Soil | MKEGPERMRRDLRAALIFGIVAAALELGALLYFFR* |
| Ga0062593_1000873204 | 3300004114 | Soil | MLAFGMVDAPEPVREDERQTRRDLRAALVFGIVAATIELGAILYFFR* |
| Ga0062589_1005049993 | 3300004156 | Soil | MDRAPDPSKEDQQQTRGDLRAALVFGIVAAAIELGAILYFFR* |
| Ga0063356_1027424372 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MDRAPGPVKEDERQTRRDLRAALIFGIVAATIEIGVLLYFMW* |
| Ga0063356_1031602192 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MDRVPSPLKEDERRTRRDIRAALVFGIVAATIELGIILYFMR* |
| Ga0062591_1004965322 | 3300004643 | Soil | MDRAPGPPKEDERQTRRDLRMALIFGIVAATIELGVILYFFW* |
| Ga0062594_1003720282 | 3300005093 | Soil | MDHAPSPLKEDERQTRRDVRAALVFGIVAATIELGVILYFMR* |
| Ga0070658_100130935 | 3300005327 | Corn Rhizosphere | MDRPNAPPKEDQHRTRRDLRAALIFGVVAATIELGLLLYFFR* |
| Ga0070658_104672882 | 3300005327 | Corn Rhizosphere | MDRAPDPLKEDEGQTRRDLRAALIFGIVAATIELGVILYFFW* |
| Ga0070676_101600832 | 3300005328 | Miscanthus Rhizosphere | MDRPDAPPKEDQHRTRRDLRAALIFGVVAATIELALLLYFFR* |
| Ga0070683_1000295282 | 3300005329 | Corn Rhizosphere | MDRPDVPPKEDQRQTRRDLRAALIFGVVAATIELAALLYFFR* |
| Ga0070690_1000119123 | 3300005330 | Switchgrass Rhizosphere | MDRAPDPLKEDERQTRRDLRAALIFGIVAAAIELGVILYFFW* |
| Ga0070670_1005169662 | 3300005331 | Switchgrass Rhizosphere | MGAPPPLKEDHQRTRRDIRAAIIFGIVAATLELGALIYFMR* |
| Ga0068869_1007688492 | 3300005334 | Miscanthus Rhizosphere | MDRAPDPLKEDERQTRRDLRAALIFGIVAATIELGVILYFFW* |
| Ga0070660_1002151062 | 3300005339 | Corn Rhizosphere | MDRPNVPLKEDQQRTRRDIRAAVIFGVVAATIELGVLLYFFR* |
| Ga0070668_1001295863 | 3300005347 | Switchgrass Rhizosphere | RTRKLLALGMDRPNTPPKEDQRQTTRDLRAAVIFGVVAATIELGVLLYIFR* |
| Ga0070668_1008911181 | 3300005347 | Switchgrass Rhizosphere | RPNVKSLAFGMDRPPAPPKEDERQTRRDLRAAVIFGVVAATIELAAVLYFFR* |
| Ga0070669_1000223443 | 3300005353 | Switchgrass Rhizosphere | MDRPPAPPKEDERQTRRDLRAAVIFGVVAATIELAAVLYFFR* |
| Ga0070671_1002736232 | 3300005355 | Switchgrass Rhizosphere | MDRAPGPLKEDERQTRRDLRAALIFGIMAATIELGVILYFFW* |
| Ga0070710_105621512 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRPNAPPKEDLQRTRRDIRAAVIFGVVAATIELGLLLYFFR* |
| Ga0070701_101602413 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRAPGPLKEDERQTRRDLRAALIFGIVAAAIELGVILYFFW* |
| Ga0070694_1019287681 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MDHAPSPLKEDERQTRRDVRAALVFGIVAATIELGIILYFMR* |
| Ga0070662_1003147152 | 3300005457 | Corn Rhizosphere | MDRPNTPPKEDQRQTARDLRAAVIFGVVAATIELGVLLYIFR* |
| Ga0070672_1006796392 | 3300005543 | Miscanthus Rhizosphere | MDRPDAPPKEDQHRTRRDLRAALIFGVVAAAIELALLLYFFR* |
| Ga0070672_1012237012 | 3300005543 | Miscanthus Rhizosphere | MSEDHKRTARDLRAALIFGIIAATLELAVILYFMR* |
| Ga0070672_1013218052 | 3300005543 | Miscanthus Rhizosphere | VKEDQRQTARDLRVAIIFGVVAASIELGLLVYFFR* |
| Ga0068855_1000443483 | 3300005563 | Corn Rhizosphere | MKEDPERTRRDIRAALIFGIVAATLELGALIYFFR* |
| Ga0068854_1007531011 | 3300005578 | Corn Rhizosphere | FGMDRPNAPPKEDQHRTRRDLRAALIFGVVAATIELGLLLYFFR* |
| Ga0066654_106213381 | 3300005587 | Soil | MSPPRPPPQEDQRQTRRDLRTALIFGVVAATIEIAVLLYFFR* |
| Ga0068852_1000604372 | 3300005616 | Corn Rhizosphere | MDRPPAPPEDQRQTRRNLPAALIFGVVAATLEMAALLYFFR* |
| Ga0068852_1008000341 | 3300005616 | Corn Rhizosphere | KEDPERTRRDIRAALIFGIVAATLELGALIYFFR* |
| Ga0068852_1009624382 | 3300005616 | Corn Rhizosphere | APDPPKEDERQTRRDLRAALVFGFVAATIELGVILYFFW* |
| Ga0068859_1020675531 | 3300005617 | Switchgrass Rhizosphere | PNTPPKEDQRQTTRDLRAAVIFGVVAATIELGVLLYIFR* |
| Ga0068864_1011480672 | 3300005618 | Switchgrass Rhizosphere | VKEDQRQTARDLRVAIIFGIVAASIELGLLVYFFR* |
| Ga0068866_100868562 | 3300005718 | Miscanthus Rhizosphere | MDRPNTPPKEDQRQTTRDLRAAVIFGVVAATIELGVLLYIFR* |
| Ga0068866_102380452 | 3300005718 | Miscanthus Rhizosphere | MDRAPGPPKEDERQTGRDLRTAIIFGIVAATIELGVILYFFW* |
| Ga0068862_1008570982 | 3300005844 | Switchgrass Rhizosphere | KEDERQTRRDLRAALIFGIVAAAIELGVILYFFW* |
| Ga0066652_1000007926 | 3300006046 | Soil | MERTPEPTKEDERQTRRDLRAVLVFGFVAATIELGLILYFFW* |
| Ga0068871_1007011601 | 3300006358 | Miscanthus Rhizosphere | PPKEDERQTRRDLRTALIFGVVAATIELAALLYFFR* |
| Ga0074062_129667002 | 3300006606 | Soil | MDRRSTPPQEDQRQTRRDLRRALIFGIVAATIEIAVLLYFFR* |
| Ga0079215_104922852 | 3300006894 | Agricultural Soil | MDHAPGPLKEDERQTRRDLRAALVFGIVAATIELLALLYFFR* |
| Ga0079216_110487562 | 3300006918 | Agricultural Soil | VEPLKEDHERTRRDIRAALVFGIVAATLEMAALFYFFR* |
| Ga0075528_100794972 | 3300006949 | Arctic Peat Soil | VTEEDHRQTRRDLRVAIIFGIVAASLELGVLIYFFRA* |
| Ga0079219_116873652 | 3300006954 | Agricultural Soil | MRLAFVMDRAPDPPKEDERQTRRDLRAALVFGIVAAAIELGVILYFFR* |
| Ga0079218_101394682 | 3300007004 | Agricultural Soil | MDRAPSPAREDERQTRRDVRAALVFGIVAATIELGVILYFMR* |
| Ga0111539_105389932 | 3300009094 | Populus Rhizosphere | MDRAPGPLKEDERQTRRDLRAALIFGIVAATIELGVILYFFW* |
| Ga0105245_121078401 | 3300009098 | Miscanthus Rhizosphere | KEDQRQTTRDLRAAVIFGVVAATIELGVLLYIFR* |
| Ga0066709_1003300662 | 3300009137 | Grasslands Soil | MSRPGTPPREDQRQTRRDLRAALIFGVVAATIEIGVLLYFFR* |
| Ga0105242_110341672 | 3300009176 | Miscanthus Rhizosphere | MDRPPAPPKEDERQTRRDLRAALIFGVVAATIELAALLYFFR* |
| Ga0105859_10641281 | 3300009651 | Permafrost Soil | MKQDHDRTRRDIRAALIFGVVAATIEMGILLYFFR* |
| Ga0126307_100698312 | 3300009789 | Serpentine Soil | MDRSPTPVEDQRQTRRDLLAALVFGVVAATLELGALLYFFW* |
| Ga0126307_102444552 | 3300009789 | Serpentine Soil | MDRPPTPVEEDQRQTRRDLRVALVFGIVAATLELGALLYFLW* |
| Ga0126313_100270313 | 3300009840 | Serpentine Soil | MDRPPTPLEEDQRQTRRDLRAALVFGVVAATLELGALLYFFW* |
| Ga0126313_100979412 | 3300009840 | Serpentine Soil | MDRAPGPLKEDERQTRRDLRAALVFGIVAATIELGVILYFFW* |
| Ga0126313_111332902 | 3300009840 | Serpentine Soil | MDRAPAPLKEDERQTRRDLRAAIVFGIAAATIELGVILYFFW* |
| Ga0126305_103702972 | 3300010036 | Serpentine Soil | MDRPPTPVEEDQRQTRRDLRAALVFGIVAATLELGALLYFLW* |
| Ga0126305_110159132 | 3300010036 | Serpentine Soil | MDRAPSPVKEDERQTRRDLRAALVFGIVAATIELGAVLYFMR* |
| Ga0126304_107392492 | 3300010037 | Serpentine Soil | MDRAPGPPKEDQQQTRRDLKVALVFGIVAAAIELGVILYFVW* |
| Ga0126309_103595672 | 3300010039 | Serpentine Soil | MAGPPAPLKEDERQTRRDVRAAVVFGIVAATIELAALVYFFW* |
| Ga0126309_112563942 | 3300010039 | Serpentine Soil | VEEDQRQTRRDLRAALIFGVVAAALELGALLYFFG* |
| Ga0126310_101239632 | 3300010044 | Serpentine Soil | MDRPPAPLEEDQRQTRRDLRAALVFGVVAATLELGALLYFFW* |
| Ga0126306_101550851 | 3300010166 | Serpentine Soil | MDHLPGPVQEDERQTRRDLRAALIFGVVAAAIELGALLYFFR* |
| Ga0126306_102857543 | 3300010166 | Serpentine Soil | MLAYDMDGSPTPLKEDERQTRRDLRAAIIFGVVAAAIELGAFLYFFW* |
| Ga0136634_100448152 | 3300012046 | Polar Desert Sand | MDRPPAPVKEDHARTRRDIRAASAFGVVAATLELGALLYFLR* |
| Ga0150985_1012871991 | 3300012212 | Avena Fatua Rhizosphere | STPPKEDQRQTRRDIRAAVIFGVVAATIELAVLLYFFR* |
| Ga0150985_1057561312 | 3300012212 | Avena Fatua Rhizosphere | MEWLGFGMDRPDAPPKEDQRQTRRDLRAAVIFGVVAATIELAALLYFFR* |
| Ga0150985_1082741421 | 3300012212 | Avena Fatua Rhizosphere | MDRAPDPVKEDERQTRRDLRAVLVFGFVAATIELGFILYFFW* |
| Ga0137370_108463982 | 3300012285 | Vadose Zone Soil | VKEDERQTARDLRAAIIFGIVAASIELGVLLYFFR* |
| Ga0150984_1093479171 | 3300012469 | Avena Fatua Rhizosphere | LKWLAFGMDRPPAPPKEDERQTRRDLRAALIFGVVAATIELAALLYFFR* |
| Ga0150984_1213919871 | 3300012469 | Avena Fatua Rhizosphere | PSTPPKEDQRQTRRDIRAAVIFGVVAATIELAVLLYFFR* |
| Ga0136635_101829412 | 3300012530 | Polar Desert Sand | MSPEPARREDATQTKRDLRAALIFGVVAATLELAALIYFFG* |
| Ga0136611_107617051 | 3300012682 | Polar Desert Sand | MTHDEQQQARRDIRAAVIFGVVAATLELGALLWFFT* |
| Ga0136611_108315711 | 3300012682 | Polar Desert Sand | MTHDEQQQTRRDIRAAVIFGVVAATLELGALLWFFT* |
| Ga0157301_101382643 | 3300012911 | Soil | MDRAPSPPKEDERQTRRDLRAALIFGIVAATIELGVILYFFW* |
| Ga0157298_103226931 | 3300012913 | Soil | KLVAFSMDRAPGPPKEDERQTRRDLRMALIFGIVAATIELGVILYFFW* |
| Ga0164302_115948841 | 3300012961 | Soil | MDRPSTPPKEDQHQTRRDLRAALIFGVVAATIELALLLYFFR* |
| Ga0164308_105896791 | 3300012985 | Soil | MNRPNTPPKEDQRQTTRDLRAAVIFGVVAATIELGVLLYIFR* |
| Ga0164307_110964342 | 3300012987 | Soil | LLALGMDRPNTPPKEDQRQTTRDLRAAVIFGVVAATIELGVLLYIFR* |
| Ga0164306_104754861 | 3300012988 | Soil | MDRPNAPPKEDQQRTRRDIRAAVIFGVVAATIELGLLLYFFR* |
| Ga0164305_115678241 | 3300012989 | Soil | DAPPKEDQHRTRRDLRAALIFGMVAATIELALLLYFFR* |
| Ga0157373_100426344 | 3300013100 | Corn Rhizosphere | MKEDPERTRRDIRAALIFGIVAATMELGALIWFFR* |
| Ga0157373_100625071 | 3300013100 | Corn Rhizosphere | VKEDPERTRRDIRAAFIFGIVAATLELGALIWFFR* |
| Ga0157371_102570433 | 3300013102 | Corn Rhizosphere | MKEDPERTRRDIRAAFIFGIIAATLELGALIYFFR* |
| Ga0157371_107289891 | 3300013102 | Corn Rhizosphere | VKEDPERTRRDIRAAFIFGIVAAALELGARIWFFR* |
| Ga0157371_109867271 | 3300013102 | Corn Rhizosphere | MKEDPERTRRDIRAALIFGIVAATLEHGALSYFFR* |
| Ga0157371_113703521 | 3300013102 | Corn Rhizosphere | MKEDPERTKRDLRAALIFGIVAATLELGALIYFFR* |
| Ga0157370_116193592 | 3300013104 | Corn Rhizosphere | MDAPPPPIKEDQQRTRRDIRAAIIFGVVAATLELGALLYFMR* |
| Ga0157369_108016792 | 3300013105 | Corn Rhizosphere | MDRPTTPPKEDQRQTRRDIRAALIFGVVAATIELGLLLYFFR* |
| Ga0157372_102107915 | 3300013307 | Corn Rhizosphere | MKEDPERTRKDLRAALIFGIVAATVELAVLIWFFR* |
| Ga0157372_112120772 | 3300013307 | Corn Rhizosphere | MKEDPERTRRDIRTAFIFGIIAATLELGALIYFFR* |
| Ga0157372_126555791 | 3300013307 | Corn Rhizosphere | WLGLGMDRPDAPPKEDQHRTRRDLRAALIFGVVAATIELALLLYFFR* |
| Ga0163163_120772061 | 3300014325 | Switchgrass Rhizosphere | ESLAFSMDRAPDPLKEDERQTRRDLRAALIFGIVAATIELGLILYFFW* |
| Ga0167665_10224912 | 3300015163 | Glacier Forefield Soil | VTQEDHRQTRRDIRAAIIFGIVAASLELGALLYFFR* |
| Ga0167661_10631861 | 3300015167 | Glacier Forefield Soil | MKQDYDRTRRDIRAALIFGVVAATIEMGILLYFFR* |
| Ga0167646_10374631 | 3300015192 | Glacier Forefield Soil | MSNERPPREDPRQTRRDIRAALVFGVVAATLELAAL |
| Ga0167627_10024225 | 3300015196 | Glacier Forefield Soil | VTQEDHRRTRRDVRAAIIFGIVAASLELGALLYFFR* |
| Ga0182007_100757911 | 3300015262 | Rhizosphere | MDRAPESPREDQQQTRRDLRAALVFGIVAATIELGAILYFFR* |
| Ga0182007_103759052 | 3300015262 | Rhizosphere | MDRAPDLPKEDERQTRRDLRAALAFGIIAATIELGVILYFFR* |
| Ga0132258_102616652 | 3300015371 | Arabidopsis Rhizosphere | MDRPDAPPKEDQRRTRRDLRAALIFGLVAATIELGVLLYFFR* |
| Ga0132258_106425912 | 3300015371 | Arabidopsis Rhizosphere | MDRPPAPPKEDERQTRRDLRAALIFGVVAATIEIAALLYFFR* |
| Ga0132255_1024912081 | 3300015374 | Arabidopsis Rhizosphere | MDRPNTPPKEDQQQPRRDLRAALIFGVVAATIELALLLYFFR* |
| Ga0180121_100703053 | 3300017695 | Polar Desert Sand | MSPEPARREDATQTKRDLRAALIFGVVAATLELAALIYFFG |
| Ga0066667_103155692 | 3300018433 | Grasslands Soil | MSRPGTPPREDQRQTRRDLRAALIFGVVAATIEIGVLLYFFR |
| Ga0190274_100822593 | 3300018476 | Soil | MDRAPSPLKEDERQTRRDLRAALVFGIVAATIELGAILYFMR |
| Ga0190274_101739602 | 3300018476 | Soil | MDAPPPLKEDHQRTKRDIRAAIIFGIVAATLELAALLYFMR |
| Ga0190274_113160191 | 3300018476 | Soil | MSEDEPTPPREDPRRTARDIRAVLAFGIIAATVEMGLLLYFFR |
| Ga0190274_138047891 | 3300018476 | Soil | APSPLREDERQTRRDVRAALVFGIVAATIELGVILYFMR |
| Ga0190273_111554552 | 3300018920 | Soil | MDRPPAPLKEDQGQTRRDIRAALIFGVVAATLELAALAYFFF |
| Ga0173482_101159243 | 3300019361 | Soil | MDRAPGPPKEDERQTRRDLRMALIFGIVAATIELGVILYFFW |
| Ga0173479_102652802 | 3300019362 | Soil | MDHAPSPLKEDERQTRRDVRAALVFGIVAATIELGVILYFMR |
| Ga0193722_10203902 | 3300019877 | Soil | MTENPDRTRRDLRAVLIFGVVAAALELGALLYFFR |
| Ga0193699_100005871 | 3300021363 | Soil | MSQDPTPPPEDPKRATRDIRAALIFGVIAATLELAALLYFFR |
| Ga0193699_101328812 | 3300021363 | Soil | MSQEPAPREDQRQTRRDIRAALIFGVVAATIELAALIYFFR |
| Ga0222622_106220342 | 3300022756 | Groundwater Sediment | MDRPPAPPKEDERQTRRDLRAALIFGVVAATIELAALLYFFR |
| Ga0222622_110815912 | 3300022756 | Groundwater Sediment | MKENPERTRRDLRAALIFGAVAAALELGALLYFFR |
| Ga0207697_100214872 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRAPDPLKEDERQTRRDLRAALIFGIVAAAIELGVILYFFW |
| Ga0207656_100728271 | 3300025321 | Corn Rhizosphere | MDRPDVPPKEDQRQTRRDLRAALIFGVVAATIELAALLYFFR |
| Ga0208079_10557932 | 3300025481 | Arctic Peat Soil | VTEEDHRQTRRDLRVAIIFGIVAASLELGVLIYFFRA |
| Ga0208587_10003769 | 3300025484 | Arctic Peat Soil | VTEEDHRQTRRDLRVAIIFGIVAASLELGVLIYFFRD |
| Ga0207642_110291191 | 3300025899 | Miscanthus Rhizosphere | PKEDQHRTRRDLRAALIFGVVAATIELALLLYFFR |
| Ga0207647_106456831 | 3300025904 | Corn Rhizosphere | MDRPNTPPKEDQRQTARDLRAAVIFGVVAATIELGVLLYIFR |
| Ga0207645_100855362 | 3300025907 | Miscanthus Rhizosphere | MDRPPAPPKEDERQTRRDLRAAVIFGVVAATIELAAVLYFFR |
| Ga0207645_101151671 | 3300025907 | Miscanthus Rhizosphere | MDRPDAPPKEDQHRTRRDLRAALIFGVVAATIELALLLYFFR |
| Ga0207645_105626921 | 3300025907 | Miscanthus Rhizosphere | AELLAYGMDHAPSPLKEDERQTRRDVRAALVFGIVAATIELGIILYFMR |
| Ga0207705_100128703 | 3300025909 | Corn Rhizosphere | MKEDPERTRRDIRAALIFGIVAATLELGALIYFFR |
| Ga0207705_100219424 | 3300025909 | Corn Rhizosphere | MDRPNAPPKEDQHRTRRDLRAALIFGVVAATIELGLLLYFFR |
| Ga0207705_111729811 | 3300025909 | Corn Rhizosphere | VKEDPERTRRDIRAAFIFGIVAAALELGALIWFFR |
| Ga0207657_112611661 | 3300025919 | Corn Rhizosphere | MDRPNVPLKEDQQRTRRDIRAAVIFGVVAATIELGVLLYFFR |
| Ga0207649_114345082 | 3300025920 | Corn Rhizosphere | MDRPNVPLKEDQQRTRRDIRSAVIFGVVAATIELGVLLYFFR |
| Ga0207652_105495902 | 3300025921 | Corn Rhizosphere | VKEDPERTRRDIRAAFIFGIVAATLELGALIWFFR |
| Ga0207650_112080541 | 3300025925 | Switchgrass Rhizosphere | VKEDQRQTARDLRVAIIFGIVAASIELGLLVYFFR |
| Ga0207700_108344832 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKEDPERTRRDLRAAIIFGIVAATLELGALIYFFR |
| Ga0207664_110155722 | 3300025929 | Agricultural Soil | MKEDPERTKRDLRAAIIFGIVAATLELGALIYFFR |
| Ga0207644_103413833 | 3300025931 | Switchgrass Rhizosphere | MDRAPGPLKEDERQTRRDLRAALIFGIMAATIELGVILYFFW |
| Ga0207686_100654453 | 3300025934 | Miscanthus Rhizosphere | MDRPNTPPKEDQRQTTRDLRAAVIFGVVAATIELGVLLYIFR |
| Ga0207669_113047492 | 3300025937 | Miscanthus Rhizosphere | MDRAPGPPKEDERQTGRDLRTAIIFGIVAATIELGVILYFFW |
| Ga0207691_100168772 | 3300025940 | Miscanthus Rhizosphere | VKEDQRQTARDLRVAIIFGVVAASIELGLLVYFFR |
| Ga0207691_101766172 | 3300025940 | Miscanthus Rhizosphere | MDRPDAPPKEDQHRTRRDLRAALIFGVVAAAIELALLLYFFR |
| Ga0207661_101190033 | 3300025944 | Corn Rhizosphere | MDRAPGPLEEDQAQTRRDLRAAIIFGIVAAAIELGVVLYFF |
| Ga0207679_103253052 | 3300025945 | Corn Rhizosphere | PLEEDQAQTRRDLRAAIIFGIVAAAIELGVVLYFFW |
| Ga0207679_104520041 | 3300025945 | Corn Rhizosphere | MDRAPDPSKEDQQQTRGDLRAALVFGIVAAAIELGAILYFFR |
| Ga0207679_110337192 | 3300025945 | Corn Rhizosphere | ARGILKEDQRQTARDLRVAIIFGIVAASIELGVLVYFFR |
| Ga0207703_107304312 | 3300026035 | Switchgrass Rhizosphere | APDPLKEDERQTRRDLRAALIFGIVAAAIELGVILYFFW |
| Ga0207678_115031232 | 3300026067 | Corn Rhizosphere | MDRPNAPPKEDQHRTRRDLRAALIFGVVAATIELGVLLYIFR |
| Ga0207683_101274172 | 3300026121 | Miscanthus Rhizosphere | MDRAPGPLQEDQAQTRRDLRAAIIFGIVAAAIELGAILYFFW |
| Ga0207698_102339502 | 3300026142 | Corn Rhizosphere | MDRPPAPPEDQRQTRRNLPAALIFGVVAATLEMAALLYFFR |
| Ga0207698_104350572 | 3300026142 | Corn Rhizosphere | MDRPNTPPKEDQRQTARDLRAAVIFGVVAATIELGVLLYFFR |
| Ga0207698_105291962 | 3300026142 | Corn Rhizosphere | PKEDQRQTRRDLRAALIFGVVAATIELAALLYFFR |
| Ga0209438_10379251 | 3300026285 | Grasslands Soil | MSQDPTPPPEDQKRAARDIRTALIFGVVAATLELAALLYFFR |
| Ga0209240_10013949 | 3300026304 | Grasslands Soil | VSEDQKQTARDIRVAIVFGIVAATIELGVLLYFFR |
| Ga0208984_11162582 | 3300027546 | Forest Soil | MKENREQTRRDLRAALIFGLVAAALELGALLYFFR |
| Ga0209818_12017651 | 3300027637 | Agricultural Soil | AYDMDHAPGPLKEDERQTRRDLRAALVFGIVAATIELLALLYFFR |
| Ga0209485_10284021 | 3300027691 | Agricultural Soil | MDHAPGPLKEDERQTRRDLRAALVFGIVAATIELL |
| Ga0209486_105298002 | 3300027886 | Agricultural Soil | MDRAPSPAREDERQTRRDVRAALVFGIVAATIELGVILYFMR |
| Ga0307288_102522121 | 3300028778 | Soil | QPVEEDQRQTRRDLRAALIFGVAAAALELGALLYFFW |
| Ga0307504_102987171 | 3300028792 | Soil | MHADTVKENHERTRKDIRLALIFGIVAATLEMGAVLYFMR |
| Ga0268240_100295232 | 3300030496 | Soil | MDHAPDPPREDERQTRRDLRAALIFGIVAATIELGVILYFFW |
| Ga0302323_1003708262 | 3300031232 | Fen | MKQDHDRTRRDIRAALIFGVVAATIEMGILLYFFR |
| Ga0307408_1004266152 | 3300031548 | Rhizosphere | MDHAPGPLREDERQTRRDLRAALIFGVVAATIELGALLYFFR |
| Ga0307406_110876781 | 3300031901 | Rhizosphere | MDHAPGPLREDERQTRRDLRAALIFGVVAATIELAALLYFFR |
| Ga0307412_114930212 | 3300031911 | Rhizosphere | MDPGPHPPKEDQQQTRRDLRTALVFGIAMATIEFAALLYFL |
| Ga0308175_1000049105 | 3300031938 | Soil | MDVPPPPVKEDHQRTRRDIRAAIVFGIVAATLELGALLYFFR |
| Ga0308175_1001032482 | 3300031938 | Soil | MKEDPERTRRDIRTAFIFGIIAATLELGALLYFFR |
| Ga0308175_1001137472 | 3300031938 | Soil | MDRPNTTPKEDQRQTRRDIRAAVIFGVVAATIELALLLYFFR |
| Ga0308175_1002699822 | 3300031938 | Soil | MDRPDTPPKEDQRRTRRDIRAAFIFGVVAATIELAVLLYFFR |
| Ga0308175_1004193332 | 3300031938 | Soil | MDQAPDSPREDQKQTRRDLRAALVFGIVAATIELGIILYFFR |
| Ga0308175_1004526392 | 3300031938 | Soil | MDRAPDPPKEDQRQTRRDLRAAIVFGVVAATIELGVILYFFR |
| Ga0308175_1005309641 | 3300031938 | Soil | MDRPDASPKEDQHRTRRDLRAALIFGVVAATIELALLLYFFR |
| Ga0308175_1006203582 | 3300031938 | Soil | MDRAPGPPKEDQRQTRRDLRAALVFGVVAATIELGVILYFFR |
| Ga0308175_1007112101 | 3300031938 | Soil | MDRAPGPLEEDQAQTRRDLRAAIIFGIVAAAIELGAILYFFW |
| Ga0308175_1016034933 | 3300031938 | Soil | MKEDPDRTRRDIRTAFIFGIIAATLELGALLYFFR |
| Ga0308175_1018121142 | 3300031938 | Soil | VKEDQEQTRRDIRAAIIFGVVAATLELGVILYFFR |
| Ga0308175_1027441422 | 3300031938 | Soil | MDRAPDPPREDPQQTRRDLRAALVFGIVAATIELGAILYFFR |
| Ga0308175_1029149451 | 3300031938 | Soil | FGMDGPDAPPKEDQRQTRRDIRAALIFGVVAATIELALLLYFFR |
| Ga0308174_101576292 | 3300031939 | Soil | MDRAPGPPKEDQRQTRRDLRAALVFGFVAAAIELGVILYFFR |
| Ga0308174_112498972 | 3300031939 | Soil | MDRPPPKEDQRQTRRNLRAALVFGIVAATLEMAALLYFSR |
| Ga0308174_115526971 | 3300031939 | Soil | MDRPNAPLKEDHQRTRRDIRAAVIFGVVAATIELGFLLYFFR |
| Ga0308176_101550051 | 3300031996 | Soil | MDQAPDSPGEDQKQTRRDLRAALVFGIVAATIELGAILYFFR |
| Ga0308176_109081652 | 3300031996 | Soil | MDRSPAPPKEDQRQTRRDLRAALIFGIVAATLEFAALAYFFR |
| Ga0308176_116675381 | 3300031996 | Soil | MDGPDAPPKEDQRQTRRDIRAALIFGVVAATIELALLLYFFR |
| Ga0308176_118808641 | 3300031996 | Soil | MDRPPAPPKEDQRQTRRDLRAALIFGIVAATLELAALAYFFR |
| Ga0308173_101138382 | 3300032074 | Soil | MDAPPPPIKEDQQRTRRDIRAAIIFGVVAATLELGALLYFMR |
| Ga0307415_1009211321 | 3300032126 | Rhizosphere | MDPAPGPREDERQTRRDLRVALIFGVAAATIELGALLYFFR |
| Ga0310810_100230807 | 3300033412 | Soil | MPSSSGDAEDRRTRRDLRAALIFGIVAASLELGALLYFFR |
| Ga0372946_0002081_6359_6484 | 3300034384 | Soil | MNQEPAPREDPKQTKRDLRAALIFGVVAATLEIAALLYFFL |
| Ga0372946_0076356_28_135 | 3300034384 | Soil | MEEDQHQTRRDLRRAIIFGIVAATLELGALLYFFR |
| Ga0372946_0198728_37_144 | 3300034384 | Soil | MKEDPERTRRDLRAALIFGLVAAALELGALLYFLR |
| Ga0372946_0324979_548_658 | 3300034384 | Soil | MTDDEQRQTKRDLRAALIFGVIAATLEMGALIWFFR |
| Ga0372946_0533725_147_254 | 3300034384 | Soil | MKEDQDQTRRDIRAAIIFGVVAATIEMAVLLYFFL |
| Ga0372946_0574650_440_544 | 3300034384 | Soil | MKEDPERTRRDLRAALIFGLVAAALELGALLYFFR |
| ⦗Top⦘ |