| Basic Information | |
|---|---|
| Family ID | F027858 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 193 |
| Average Sequence Length | 52 residues |
| Representative Sequence | MTCPSCTSENEMAYSALSFGFVCLEPACGFELEMEPVQAQQVLEPEEELVCC |
| Number of Associated Samples | 126 |
| Number of Associated Scaffolds | 193 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 74.74 % |
| % of genes near scaffold ends (potentially truncated) | 29.53 % |
| % of genes from short scaffolds (< 2000 bps) | 88.08 % |
| Associated GOLD sequencing projects | 120 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.65 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.446 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (18.653 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.715 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.922 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.00% β-sheet: 16.25% Coil/Unstructured: 73.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 193 Family Scaffolds |
|---|---|---|
| PF13419 | HAD_2 | 21.24 |
| PF00160 | Pro_isomerase | 6.74 |
| PF04028 | DUF374 | 5.70 |
| PF13242 | Hydrolase_like | 3.63 |
| PF12710 | HAD | 1.55 |
| PF07730 | HisKA_3 | 0.52 |
| PF07969 | Amidohydro_3 | 0.52 |
| PF05237 | Obsolete Pfam Family | 0.52 |
| PF00899 | ThiF | 0.52 |
| PF02082 | Rrf2 | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 193 Family Scaffolds |
|---|---|---|---|
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 6.74 |
| COG2121 | Uncharacterized conserved protein, lysophospholipid acyltransferase (LPLAT) superfamily | Function unknown [S] | 5.70 |
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 0.52 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.52 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 0.52 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 0.52 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.52 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.52 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 0.52 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.52 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.52 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.52 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.52 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.45 % |
| Unclassified | root | N/A | 1.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000363|ICChiseqgaiiFebDRAFT_12794025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101642138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 965 | Open in IMG/M |
| 3300000550|F24TB_13547892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1151 | Open in IMG/M |
| 3300000955|JGI1027J12803_105338705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
| 3300003267|soilL1_10055307 | All Organisms → cellular organisms → Bacteria | 6427 | Open in IMG/M |
| 3300003321|soilH1_10001692 | All Organisms → cellular organisms → Bacteria | 3482 | Open in IMG/M |
| 3300003321|soilH1_10005161 | All Organisms → cellular organisms → Bacteria | 2991 | Open in IMG/M |
| 3300004091|Ga0062387_101701408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300004114|Ga0062593_100626946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1032 | Open in IMG/M |
| 3300004268|Ga0066398_10190620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300004463|Ga0063356_100128445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2834 | Open in IMG/M |
| 3300004463|Ga0063356_101431335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
| 3300004480|Ga0062592_100711297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
| 3300004633|Ga0066395_10712502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300004798|Ga0058859_11498714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300004798|Ga0058859_11578955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300004800|Ga0058861_10010643 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300005187|Ga0066675_11070319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300005295|Ga0065707_10342125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
| 3300005295|Ga0065707_11086941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300005332|Ga0066388_100357281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2107 | Open in IMG/M |
| 3300005332|Ga0066388_101357057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1231 | Open in IMG/M |
| 3300005332|Ga0066388_101983465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1043 | Open in IMG/M |
| 3300005332|Ga0066388_102244997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
| 3300005332|Ga0066388_103836536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300005332|Ga0066388_104240057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300005332|Ga0066388_104312481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300005332|Ga0066388_105702787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300005334|Ga0068869_100387048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1147 | Open in IMG/M |
| 3300005336|Ga0070680_100573332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 968 | Open in IMG/M |
| 3300005353|Ga0070669_100919198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300005436|Ga0070713_100628733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1021 | Open in IMG/M |
| 3300005436|Ga0070713_102272006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300005447|Ga0066689_10309267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 981 | Open in IMG/M |
| 3300005531|Ga0070738_10062784 | All Organisms → cellular organisms → Bacteria | 2214 | Open in IMG/M |
| 3300005549|Ga0070704_101411449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300005558|Ga0066698_10176635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1454 | Open in IMG/M |
| 3300005577|Ga0068857_102363858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300005598|Ga0066706_10352906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1166 | Open in IMG/M |
| 3300005713|Ga0066905_100040809 | All Organisms → cellular organisms → Bacteria | 2748 | Open in IMG/M |
| 3300005713|Ga0066905_101990067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300005764|Ga0066903_100091276 | All Organisms → cellular organisms → Bacteria | 4051 | Open in IMG/M |
| 3300005764|Ga0066903_100137350 | All Organisms → cellular organisms → Bacteria | 3463 | Open in IMG/M |
| 3300005764|Ga0066903_101058085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1491 | Open in IMG/M |
| 3300005764|Ga0066903_102945270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
| 3300005764|Ga0066903_107841935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300005764|Ga0066903_109008265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300005843|Ga0068860_102318996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300005937|Ga0081455_10667758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300006031|Ga0066651_10373121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300006049|Ga0075417_10272439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300006049|Ga0075417_10324807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
| 3300006358|Ga0068871_101721418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300006806|Ga0079220_10614935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300006844|Ga0075428_100684804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1092 | Open in IMG/M |
| 3300006845|Ga0075421_100065247 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4597 | Open in IMG/M |
| 3300006845|Ga0075421_100775461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1106 | Open in IMG/M |
| 3300006845|Ga0075421_101829689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300006845|Ga0075421_102023464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300006845|Ga0075421_102095605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300006847|Ga0075431_100382819 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300006852|Ga0075433_11474799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300006852|Ga0075433_11510980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300006854|Ga0075425_101624356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300006865|Ga0073934_10234503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1218 | Open in IMG/M |
| 3300006880|Ga0075429_100322796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1351 | Open in IMG/M |
| 3300006904|Ga0075424_102105375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300006954|Ga0079219_10191461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1147 | Open in IMG/M |
| 3300006954|Ga0079219_11045892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300006969|Ga0075419_11471237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300009012|Ga0066710_100961979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1316 | Open in IMG/M |
| 3300009100|Ga0075418_12034147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300009147|Ga0114129_10367281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1903 | Open in IMG/M |
| 3300009156|Ga0111538_10625348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1365 | Open in IMG/M |
| 3300009156|Ga0111538_10640883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1347 | Open in IMG/M |
| 3300009553|Ga0105249_13479540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300009792|Ga0126374_11213174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300009826|Ga0123355_12052544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300010043|Ga0126380_10364413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1058 | Open in IMG/M |
| 3300010046|Ga0126384_10075746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2405 | Open in IMG/M |
| 3300010046|Ga0126384_11028033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
| 3300010046|Ga0126384_12000873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300010047|Ga0126382_10169538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1518 | Open in IMG/M |
| 3300010047|Ga0126382_10922571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300010048|Ga0126373_11608733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300010048|Ga0126373_11781852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300010154|Ga0127503_11160788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300010358|Ga0126370_10428197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1096 | Open in IMG/M |
| 3300010358|Ga0126370_10597985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 952 | Open in IMG/M |
| 3300010358|Ga0126370_11702144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300010359|Ga0126376_11190302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300010359|Ga0126376_12642933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300010360|Ga0126372_10040480 | All Organisms → cellular organisms → Bacteria | 3045 | Open in IMG/M |
| 3300010360|Ga0126372_10156889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1828 | Open in IMG/M |
| 3300010360|Ga0126372_11009302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300010360|Ga0126372_11347482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
| 3300010360|Ga0126372_11456809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300010362|Ga0126377_10054774 | All Organisms → cellular organisms → Bacteria | 3490 | Open in IMG/M |
| 3300010362|Ga0126377_10260359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1693 | Open in IMG/M |
| 3300010362|Ga0126377_10596096 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300010362|Ga0126377_10701518 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300010366|Ga0126379_10445785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1355 | Open in IMG/M |
| 3300010366|Ga0126379_10908706 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300010366|Ga0126379_11038006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300010366|Ga0126379_12328109 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300010397|Ga0134124_10054252 | All Organisms → cellular organisms → Bacteria | 3377 | Open in IMG/M |
| 3300010398|Ga0126383_11539396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300010399|Ga0134127_11426853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300010400|Ga0134122_12918583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300010401|Ga0134121_10485365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1135 | Open in IMG/M |
| 3300011120|Ga0150983_10966567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1059 | Open in IMG/M |
| 3300011120|Ga0150983_13784857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300011120|Ga0150983_14557193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300011332|Ga0126317_10820622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300011403|Ga0137313_1031442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
| 3300011416|Ga0137422_1018165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1648 | Open in IMG/M |
| 3300011434|Ga0137464_1000090 | All Organisms → cellular organisms → Bacteria | 27917 | Open in IMG/M |
| 3300012167|Ga0137319_1008625 | All Organisms → cellular organisms → Bacteria | 2164 | Open in IMG/M |
| 3300012173|Ga0137327_1118319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300012212|Ga0150985_112053145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300012212|Ga0150985_112548986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300012212|Ga0150985_114017877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300012212|Ga0150985_117738740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300012212|Ga0150985_119481182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
| 3300012232|Ga0137435_1049142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1238 | Open in IMG/M |
| 3300012469|Ga0150984_103426551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300012469|Ga0150984_118841879 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300012948|Ga0126375_10015810 | All Organisms → cellular organisms → Bacteria | 3369 | Open in IMG/M |
| 3300012948|Ga0126375_10792219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300012971|Ga0126369_10981733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
| 3300012971|Ga0126369_12157047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300013297|Ga0157378_11810380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300013306|Ga0163162_12370051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300013307|Ga0157372_12178977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300015371|Ga0132258_10424224 | All Organisms → cellular organisms → Bacteria | 3310 | Open in IMG/M |
| 3300015371|Ga0132258_12219861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1378 | Open in IMG/M |
| 3300015371|Ga0132258_12634826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1255 | Open in IMG/M |
| 3300015373|Ga0132257_101437431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 878 | Open in IMG/M |
| 3300015373|Ga0132257_101966792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300015374|Ga0132255_100933621 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300016294|Ga0182041_11299647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300016294|Ga0182041_11532241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300016341|Ga0182035_11974971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300016357|Ga0182032_10048934 | All Organisms → cellular organisms → Bacteria | 2728 | Open in IMG/M |
| 3300016371|Ga0182034_11586197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300016422|Ga0182039_11326065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300016445|Ga0182038_11976603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300017959|Ga0187779_10657525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300017974|Ga0187777_10889974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300019229|Ga0180116_1103724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300020580|Ga0210403_10613820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
| 3300021168|Ga0210406_10425238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1061 | Open in IMG/M |
| 3300021358|Ga0213873_10242751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300021403|Ga0210397_10252324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1281 | Open in IMG/M |
| 3300021407|Ga0210383_11145332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300021560|Ga0126371_10312049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1702 | Open in IMG/M |
| 3300021560|Ga0126371_10559550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1292 | Open in IMG/M |
| 3300021560|Ga0126371_12308266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300021560|Ga0126371_12400112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300022467|Ga0224712_10553840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300022527|Ga0242664_1133335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300022533|Ga0242662_10090765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300022718|Ga0242675_1125367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300022726|Ga0242654_10234803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300022726|Ga0242654_10246748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300024251|Ga0247679_1067369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300025923|Ga0207681_11824550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300026118|Ga0207675_102148040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300027909|Ga0209382_10179380 | All Organisms → cellular organisms → Bacteria | 2438 | Open in IMG/M |
| 3300027909|Ga0209382_11168347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300027909|Ga0209382_11581657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300027909|Ga0209382_12109564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300028146|Ga0247682_1057191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300030730|Ga0307482_1133241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300030903|Ga0308206_1187687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300030939|Ga0138303_1185231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300030997|Ga0073997_11674112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 934 | Open in IMG/M |
| 3300030998|Ga0073996_12075899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300031023|Ga0073998_11554325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300031093|Ga0308197_10462117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300031231|Ga0170824_114440725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300031231|Ga0170824_122703145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300031446|Ga0170820_13296095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300031446|Ga0170820_13521584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300031469|Ga0170819_15067336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300031716|Ga0310813_11176665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300031912|Ga0306921_10765693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1105 | Open in IMG/M |
| 3300031954|Ga0306926_11261815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
| 3300032075|Ga0310890_11084179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300034667|Ga0314792_176090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 18.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.44% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.15% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.11% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.11% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.59% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.59% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.55% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.55% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.55% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.55% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.04% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.04% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.04% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.04% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.04% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.04% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.04% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.04% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.52% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.52% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.52% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.52% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.52% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.52% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.52% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011403 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2 | Environmental | Open in IMG/M |
| 3300011416 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2 | Environmental | Open in IMG/M |
| 3300011434 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2 | Environmental | Open in IMG/M |
| 3300012167 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT333_2 | Environmental | Open in IMG/M |
| 3300012173 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300019229 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_1_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030939 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030997 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030998 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031023 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFA (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300034667 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiFebDRAFT_127940252 | 3300000363 | Soil | MTCPACRSENEMAYSTLCHSFICLEPVCGFELEMEPLEAQQVLEPEEELVCC* |
| INPhiseqgaiiFebDRAFT_1016421382 | 3300000364 | Soil | MMHCPSCRSGNEMAYSALFHGFVCLEPECGFEFEMDPESAKQVLAPEEELVCC* |
| F24TB_135478922 | 3300000550 | Soil | MICPACRSGNEMAYSTLCHSFICLESVCGFELEMEPLEAQQVLEPEEELVCC* |
| JGI1027J12803_1053387051 | 3300000955 | Soil | SMMHCPSCRSGNEMAYSALFHGFVCLEPECGFEFEMDPESAKQVLAPEEELVCC* |
| soilL1_100553076 | 3300003267 | Sugarcane Root And Bulk Soil | MICPACAAENEMAYSALSHGFVCLETDCGFELEMEPVQAQQVLEPEEELVCC* |
| soilH1_100016922 | 3300003321 | Sugarcane Root And Bulk Soil | MICPGCKSEHDMAYSALSNGFVCLEENCGCEVEMELAEAMQVLEFEEELVCC* |
| soilH1_100051613 | 3300003321 | Sugarcane Root And Bulk Soil | MICPACHTESEMAYSALSHAFTCLEPACNFELEMEPVQAQQVLEPEEELVCC* |
| Ga0062387_1017014081 | 3300004091 | Bog Forest Soil | MKCPVCSSENEMAYSALFHGFACLEQNCAFELEMEPAEAMQVLEFEEELVCC* |
| Ga0062593_1006269462 | 3300004114 | Soil | MICPACHTETEMAYSALSHAFVCLEPVCNFELEMEPVQAQLVLEPEEELVCC* |
| Ga0066398_101906201 | 3300004268 | Tropical Forest Soil | GNEMAYSTLCHSFICLESACGFELEMEPREAQQVLEPEEELVCC* |
| Ga0063356_1001284451 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTCPTCANEMGYSALSMGFMCLEPACGFEIEMEPVQAQQVLEPEEELVCC* |
| Ga0063356_1014313352 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MNCPACSCENEMAYSALSHGFVCLEENCGFELEMEPVQAQLVLEPEEELVCC* |
| Ga0062592_1007112973 | 3300004480 | Soil | MTCPTCANEMGYSALSMGFMCLEPACGFEIEMEPVQAQQVLE |
| Ga0066395_107125022 | 3300004633 | Tropical Forest Soil | MTCPVCRSGNEMAYSTLCHSFVCLEPVCGFELEMEPREAQQVLEPEEELVCC* |
| Ga0058859_114987142 | 3300004798 | Host-Associated | RNAHEFSEVESMTCPTCANEMGYSALSMGFMCLEPACGFEIEMEPVQAQQVLEPEEELVCC* |
| Ga0058859_115789552 | 3300004798 | Host-Associated | ITMICPACHTETEMAYSALSHAFVCLEPVCNFELEMEPVQAQLVLEPEEELVCC* |
| Ga0058861_100106432 | 3300004800 | Host-Associated | DVQCDLKEGNVMTCPGCRSEHEMAYSALSNGFVCLEENCGFEIEMEQADAMQVLEFEEELVCC* |
| Ga0066675_110703192 | 3300005187 | Soil | MTCPRCTGENEMAYSVLSNGFVCLETNCGFELEMEPVQAQQILELEEELVCC* |
| Ga0065707_103421252 | 3300005295 | Switchgrass Rhizosphere | MTCPACRSGNEMAYSTLCHSFICLETVCGFELEMEPLEAQQVLEPEEEFVCC* |
| Ga0065707_110869411 | 3300005295 | Switchgrass Rhizosphere | MICPACHTESEMAYSALSHAFCCLEPECNFEIEMEPVQAQLVLEPEEELVCC* |
| Ga0066388_1003572814 | 3300005332 | Tropical Forest Soil | MTCPVCRSGNEMAYSTLCHSFICLESACGFELEMEPLEAQQVLEPEEELVCC* |
| Ga0066388_1013570573 | 3300005332 | Tropical Forest Soil | MICPACASENEMAYSTLSLSFICLEPACGYEVEMEPDQALKVLEPEEELVCC* |
| Ga0066388_1019834652 | 3300005332 | Tropical Forest Soil | MICPACRSHNEMAYSILCHSFICLEPACGFEVEMEPVQAQQVLEPEEELVCC* |
| Ga0066388_1022449972 | 3300005332 | Tropical Forest Soil | MICPTCHSDEMAYSVLSYSFVCLEPACGFELEMTPPEAQRVLEPEEELVCC* |
| Ga0066388_1038365362 | 3300005332 | Tropical Forest Soil | MVCPGCGSENEMAYSGFSNALICLEDNCGFELEMPLNEALQVIEATPELACA* |
| Ga0066388_1042400572 | 3300005332 | Tropical Forest Soil | MICPACRSHDEMAYSILCHSFICLDPTCGFELEMEPVQAQEVLEPEEELVCC* |
| Ga0066388_1043124812 | 3300005332 | Tropical Forest Soil | MICPTCRGDEMAYSVLSYSFVCLEPACGFELEMAPPEAQQVLEPEQELVCC* |
| Ga0066388_1057027872 | 3300005332 | Tropical Forest Soil | NEMAYSTLCYSFVCLEPACGFELEIEPLEAQQVLEPEEELVCC* |
| Ga0068869_1003870483 | 3300005334 | Miscanthus Rhizosphere | MICPGCRSEGDMAYSVISNGFICMESGCGFELEMEPVQAQQVLEHEEQLVCC* |
| Ga0070680_1005733322 | 3300005336 | Corn Rhizosphere | MTCPGCRSEHEMAYSALSNGFVCLEENCGFEIEMEQADAMQVLEFEEELVCC* |
| Ga0070669_1009191982 | 3300005353 | Switchgrass Rhizosphere | DSRSEMAYSTLSYSFICMEPACGYEVEMEPLEAQQVLEPEEELVCC* |
| Ga0070713_1006287333 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MICPGCNSEHEMAYSALSHGFLCLEPNCGFELEMEPHQAMQVLEFEE |
| Ga0070713_1022720061 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MFFQEVRSMTCPGCSTENEMAYSTLSNSFICLEPNCGFELEMEPAQALQVLEVEEELVCC |
| Ga0066689_103092672 | 3300005447 | Soil | MTCPLCAGKNEMAYSALSNGFVCLEANCGFELEMEPVEAQQILELEEEVVCC* |
| Ga0070738_100627843 | 3300005531 | Surface Soil | MTCPGCNSENEMAYSALSHAFVCLEPSCGFELEMEPVEAMQVLEFEEELVCC* |
| Ga0070704_1014114491 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MTCPACSSKDEMAYSVLSNGFVCLESDCGFELEMEPVQAQLVLEPEAELVCC* |
| Ga0066698_101766352 | 3300005558 | Soil | MICPACGSENEMAYSTLSLSFICLEPACGFELEMEPRQAQQVLEPEEELVCC* |
| Ga0068857_1023638581 | 3300005577 | Corn Rhizosphere | MTCPTCANEMGYSDLSMGFMCLEPACGLEIEMEPVQAQQVLEPEE |
| Ga0066706_103529062 | 3300005598 | Soil | MTCPVCAKGNEMAYSTLSYSFVCLEPNCGFELEMEPEIAQQILAPEEELVCC* |
| Ga0066905_1000408093 | 3300005713 | Tropical Forest Soil | MTCPTCRSGNEMAYSTLGHSFICLEPACGFELEMDPLEAQEVLEPEEELVCC* |
| Ga0066905_1019900672 | 3300005713 | Tropical Forest Soil | MTCPACRSHDEMAYSVLCHSFICLETACGFELEMDPVQAQEVLEPEEELVCC* |
| Ga0066903_1000912761 | 3300005764 | Tropical Forest Soil | MTCPGCSSKRDMAYSALSHGFVCLEPNCGFELEMEPRQAMQVLEFEEELVCC* |
| Ga0066903_1001373504 | 3300005764 | Tropical Forest Soil | MTCPACRSRNEMAYSILSHSFMCLESDCGFELEMEPLEAQQVLEPEEELVCC* |
| Ga0066903_1010580853 | 3300005764 | Tropical Forest Soil | MTCPGCNTQNEMAYSALSNSFICLEPNCGFELEMEPAQAMQVLELEEELVCC* |
| Ga0066903_1029452702 | 3300005764 | Tropical Forest Soil | MICPTCRGDEMAYSVLSYSFVCLEPTCGFELEMAPPEAQQVLEPEGELVCC* |
| Ga0066903_1078419351 | 3300005764 | Tropical Forest Soil | MICPACRSHNEMAYSLLSNGFICLEPACGFEVEMEPVQAQQVLEPEEELVCC* |
| Ga0066903_1090082651 | 3300005764 | Tropical Forest Soil | MICPGCKSENEMAYSALSNGFVCLESNCGFELEMEPAQAMQVLEFEEELVCC* |
| Ga0068860_1023189962 | 3300005843 | Switchgrass Rhizosphere | MICPGCRTENEMAYSILSYGFVCLEPSCGFELEMEPVQAQEVLEPEEELVCCY* |
| Ga0081455_106677582 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MICPACRSGNEMAYSTLCHSFICLEPVCGFELEMDPLEAQQVLEPEEELVCC* |
| Ga0066651_103731212 | 3300006031 | Soil | MICPGCRSENEMAYSVLSNGFVCLEPTCGFELEMEPVQAQEVLEPEKELVCC* |
| Ga0075417_102724392 | 3300006049 | Populus Rhizosphere | MTCPACRSGNEMAYSTLCHSFICLEPVCGFELEMEPLEAQQVLEPEEELVCC* |
| Ga0075417_103248072 | 3300006049 | Populus Rhizosphere | MICPTCRSHDEMAYSILCHSFICLDPTCGFELEMEPVQAQEVLEPEEELVCC* |
| Ga0068871_1017214181 | 3300006358 | Miscanthus Rhizosphere | MTCPGCNSENEMAYSALSNSFICLEPNCGFELEMEPAQAMQVLEVEEELVCC* |
| Ga0079220_106149351 | 3300006806 | Agricultural Soil | MTCPGCNSENEMAYSALSNSFICLEPNCGFELEMEPAQAMQVL |
| Ga0075428_1006848042 | 3300006844 | Populus Rhizosphere | MTCPVCRSGNEMAYSTLCHSFVCLESDCGFELEMEPLEAQQLLEPEEELVCC* |
| Ga0075421_1000652473 | 3300006845 | Populus Rhizosphere | MTCPSCSSENEMAYSALSHGFICLEPACGMELEMEPIQAQQVLECEEELVCC* |
| Ga0075421_1007754612 | 3300006845 | Populus Rhizosphere | MTCPVCRSGNEMAYSTLCHSFICLEPVCGFELEMEPLEAQQVLEPEEELVCC* |
| Ga0075421_1018296892 | 3300006845 | Populus Rhizosphere | MNCPACSNEKEMAYSALSLSFVCLEPTCGFEVEMEPVQAHEVLEPEEELVCC* |
| Ga0075421_1020234642 | 3300006845 | Populus Rhizosphere | MQMTCPSCRSGHEMAYSALCHGFVCLESECGFELEMEPVQAQEVLEPEAELVCC* |
| Ga0075421_1020956051 | 3300006845 | Populus Rhizosphere | MTCPACRSHNEMAYSTLCHSFICLEPACGFELEMEPYLAQQVLEPEEELVC |
| Ga0075431_1003828191 | 3300006847 | Populus Rhizosphere | MTCPACRSENEMAYSTLSHSFICLEHACGFELEMEPLEAQQVLEPEEELVCC* |
| Ga0075431_1010454663 | 3300006847 | Populus Rhizosphere | MTCPVCRSGNEMAYSTLCHSFVCLESDCGFELEMEPLEAQQ |
| Ga0075433_114747992 | 3300006852 | Populus Rhizosphere | MICPACRSHDEMAYSILCHSFVCLDPVCGFELEMEPVQAQEVLEPEEELVCC* |
| Ga0075433_115109802 | 3300006852 | Populus Rhizosphere | MMHCPSCRSGNEMAYSALFHGFVCLEPECGFELEMDPESAKQVLAPEEELVCC* |
| Ga0075425_1016243562 | 3300006854 | Populus Rhizosphere | MICPACRRENEMAYSVLSFGFVCLEADCGFEVEVDPEEAQLVVAPEEELVCC* |
| Ga0073934_102345031 | 3300006865 | Hot Spring Sediment | MTCPACGTYDEMAYSVLSHGFVCTDSNCGFELEMEPVQALQVLEPEAELVCC* |
| Ga0075429_1003227963 | 3300006880 | Populus Rhizosphere | MICPTCCRENEMAYSVLSNGFICLESDCGFEVEMDPVQAREVLEPEEELVCC* |
| Ga0075424_1021053752 | 3300006904 | Populus Rhizosphere | GRNIMTCPACRSENEMAYSTLSHSFICLEHACGFELEMEPLEAQQVLEPEEELVCC* |
| Ga0079219_101914613 | 3300006954 | Agricultural Soil | MTCPGCNIENEMAYSGLSNSFICLEPNCGFELEMEPAQALQVLEVEEELVCC* |
| Ga0079219_110458922 | 3300006954 | Agricultural Soil | MTCPACESVNEMAYSVLSNGFVCLEPACGFELEMEPM |
| Ga0075419_114712372 | 3300006969 | Populus Rhizosphere | MTCPVCHSGNEMAYSTLCHSFICLEPVCGFELEMEPLEAQQVLEPEEELVCC* |
| Ga0066710_1009619792 | 3300009012 | Grasslands Soil | MICPACGSENEMAYSTLSLSFICLEPACGFELEMEPRQAQQVLEPEEELVCC |
| Ga0075418_120341472 | 3300009100 | Populus Rhizosphere | GRNIMTCPACRSGNEMAYSTLCHSFICLETVCGFELEMEPLEAQQVLEPEEEFVCC* |
| Ga0114129_103672813 | 3300009147 | Populus Rhizosphere | MTCPACRSHNEMAYSTLCHSFICLEPACGFELEMEPYLAQQVLEPEEELVCC* |
| Ga0111538_106253482 | 3300009156 | Populus Rhizosphere | MTCPVCRSGNEMAYSTLCHSFVCLESDCGFELAMEPLEAQQLLEPEEELVCC* |
| Ga0111538_106408833 | 3300009156 | Populus Rhizosphere | MTCPACEKEMAYSALSMGFICMEPPCGFELEMEPVQAQQVLEPEEELVCC* |
| Ga0105249_134795402 | 3300009553 | Switchgrass Rhizosphere | MTCPTCASENEMAYSVLSYGFICLEPGCGFEVEMEPAQAQQVLEPEEELVCC* |
| Ga0126374_112131741 | 3300009792 | Tropical Forest Soil | MTCPSCRSGNEMAYSTLCHSFICLESTCGFELEMEPLEAQQVLEPEEELVCC* |
| Ga0123355_120525442 | 3300009826 | Termite Gut | MTCPGCSSKHEMAYSALSHGFVCLDPNCGFEFEMEPPQAMQVLEFEEELVCC* |
| Ga0126380_103644132 | 3300010043 | Tropical Forest Soil | MTCPGCSSKHEMAYSALSHAFVCLESNCGFELEMEPPQAMQALEFEEELVCC* |
| Ga0126384_100757463 | 3300010046 | Tropical Forest Soil | MTCPVCRSGNEMAYSTLCHSFVCLEPVCGFELEMEPLEAKQVLEPEEELVCC* |
| Ga0126384_110280331 | 3300010046 | Tropical Forest Soil | MTCPSCRSGNEMAYSTLCHSFICLESACGFELEMEPLEAQQVLEPEEELVCC* |
| Ga0126384_120008732 | 3300010046 | Tropical Forest Soil | PACRSHNEMAYSLLSNGFICLEPACGFEVEMEPVQAQQVLEPEEELVCC* |
| Ga0126382_101695383 | 3300010047 | Tropical Forest Soil | MTCPSCRSGNEMAYSTLCHSFICLESACGFELEMEPREAQQVLEPEEELVCC* |
| Ga0126382_109225712 | 3300010047 | Tropical Forest Soil | MTCPVCRSGNEMAYSTLCHSFICLEPVCGFELEMGPLEAQQVLEPEEELVCC* |
| Ga0126373_116087332 | 3300010048 | Tropical Forest Soil | MICPRCDSAEMAYSALSNGFVCLEPFCGFELEMEPVEAQQVLEFEEELVCC* |
| Ga0126373_117818522 | 3300010048 | Tropical Forest Soil | MTCPGCNSENEMAYSGLSNSFICLEPNCGFELEMEPAQAMQVLEVEEELVCC* |
| Ga0127503_111607882 | 3300010154 | Soil | FKEVRSMTCPGCKTENEMAYSALSNSFICLEPICGFELEMEPAQAMQVLEVEEELVCC* |
| Ga0126370_104281973 | 3300010358 | Tropical Forest Soil | MTCPVCRSGNEMAYSTLCHSFVCLEPVCGFELEME |
| Ga0126370_105979852 | 3300010358 | Tropical Forest Soil | MTCPGCSSKHEMAYSALSHGFVCLEPSCGFELEMEPLQAMQVLEFEEELVCC* |
| Ga0126370_117021441 | 3300010358 | Tropical Forest Soil | MICPGCKTENEMAYSNLSNSFMCLEPNCGFELEMEPAQAMQVLEVEEELVCC* |
| Ga0126376_111903022 | 3300010359 | Tropical Forest Soil | MICPACRSGNEMAYSNLCHSFICLEQACGFELEMEPLEAQQVLAPEEELVCC* |
| Ga0126376_126429332 | 3300010359 | Tropical Forest Soil | KSFKEVRSMTCPGCNTDNEMAYSTLSNAFICLEPSCGFELEMEPAQAKQLLEVEEELVCC |
| Ga0126372_100404803 | 3300010360 | Tropical Forest Soil | MTCPGCSSKHEMAYSALSHGFVCLEPSCGFELEMEPPQAMQVLEFEEELVCC* |
| Ga0126372_101568893 | 3300010360 | Tropical Forest Soil | MTCPVCRSGNEMAYSTLCHSFVCLEPVCGFELEMEPREAQQVLEPEEEFVCC* |
| Ga0126372_110093022 | 3300010360 | Tropical Forest Soil | MTCPSCCSGNEMAYSVLSHGFICLDSTCGFELEMEPVQAQLVLEPEEELVCC* |
| Ga0126372_113474822 | 3300010360 | Tropical Forest Soil | MTCPGCNTENEMAYSSLSNSFICLESNCGFELEMEPAEATQVLEVEEELVCC* |
| Ga0126372_114568092 | 3300010360 | Tropical Forest Soil | MTCPGCNTQNEMAYSALSNSFICLESNCGFELEMEPAQATQVLELEEELECC* |
| Ga0126377_100547744 | 3300010362 | Tropical Forest Soil | MICPACRSHDEMAYSILCHSFICLDPTCGFELEMEPGQAQEVLEPEEELVCC* |
| Ga0126377_102603593 | 3300010362 | Tropical Forest Soil | MTCPVCRCQNEMAYSALSHAFTCLESNCGFELEMEPLEAQEVLAPEEELVCC* |
| Ga0126377_105960961 | 3300010362 | Tropical Forest Soil | MTCPGCSSKHEMAYSALSHGFVCLEPSCGFELEMEPPEAMQVLEFEEELVCC* |
| Ga0126377_107015181 | 3300010362 | Tropical Forest Soil | MTCPACRSGNEMAYSTLCHSFICLEPPCGFELEMEPLEAQQVLEPEEELVCC* |
| Ga0126379_104457853 | 3300010366 | Tropical Forest Soil | MICPACRSGNEMAYSNLCHSFICLEQACGFELEMEPVEAQQVLAPEEELVCC* |
| Ga0126379_109087061 | 3300010366 | Tropical Forest Soil | SGNEMAYSTLCHSFICLESACGFELEMEPLEAQQVLEPEEELVCC* |
| Ga0126379_110380061 | 3300010366 | Tropical Forest Soil | VRRMTCPGCKTENEMAYSNLSNSFMCLEPNCGFELEMEPAQAMQVLEVEEELVCC* |
| Ga0126379_123281091 | 3300010366 | Tropical Forest Soil | EMAYSALSHGFVCLEPSCGFELEMEPPQAMQVLEFEEELVCC* |
| Ga0134124_100542522 | 3300010397 | Terrestrial Soil | MTHCPSCKSENEMAYSALFHGFVCLEPGCGFEVEMDPESAQQVLAPEEELVCC* |
| Ga0126383_115393963 | 3300010398 | Tropical Forest Soil | MTCPVCRSGNEMAYSTLCHSFVCLEPVCGFELEMEP |
| Ga0134127_114268532 | 3300010399 | Terrestrial Soil | MTCPTCASENEMAYSVLSYGFICLEPGCGFEVEMEPVQAQQVLEPEEELVCC* |
| Ga0134122_129185831 | 3300010400 | Terrestrial Soil | MICPACHNESEMAYSALSHAFVCLESACNFELEMEPVQAQQVIEPEEELVCC* |
| Ga0134121_104853652 | 3300010401 | Terrestrial Soil | MKCPGCISENEMAYSALSNGFVCLEPACGFELEMEPVQAQQVLELEEELVCC* |
| Ga0150983_109665673 | 3300011120 | Forest Soil | QEVMMICPICTSENEMAYSVISNGFVCLESNCGFELEMEPALAHQVLESEEELVCC* |
| Ga0150983_137848572 | 3300011120 | Forest Soil | ICPICTSENEMAYSAMSNGFVCLEPNCGFELEMEPALAQQVLESEEELVCC* |
| Ga0150983_145571931 | 3300011120 | Forest Soil | MICPICTSENEMAYSALSNGFVCLEPSCGFELEMEPALAQQLLETQEELVCC* |
| Ga0126317_108206222 | 3300011332 | Soil | IGNAQGFLEVNTMTCPGCTSENEMAYSALSNGFVCLEPQCGFELEMEPVQALLVLEPEEELVCC* |
| Ga0137313_10314422 | 3300011403 | Soil | MNCPSCHCENEMAYSALSHGFVCLEDDCGFEIEMEPVQAQLVLEPEEELVCC* |
| Ga0137422_10181653 | 3300011416 | Soil | MNCPSCHCENEMAYSALSHGFVCLEEDCGFELEMEPVQAQLVLEPEEELVCC* |
| Ga0137464_100009018 | 3300011434 | Soil | MNCPSCRCENEMAYSALSHGFVCLEEDCGFELEMEPVQAQLVLEPEEELVCC* |
| Ga0137319_10086252 | 3300012167 | Soil | MNCPSCRCENEMAYSALSHGFVCLEENCGFELEMEPVQAQLVLEPEEELVCC* |
| Ga0137327_11183192 | 3300012173 | Soil | RFRKEKTMNCPSCRCENEMAYSALSHGFVCLEEDCGFELEMEPVQAQLVLEPEEELVCC* |
| Ga0150985_1120531451 | 3300012212 | Avena Fatua Rhizosphere | MTCPQCKNENEMAYSILSNGFICLEPNCGFELEMEPAQAMQVLELEEELVCC* |
| Ga0150985_1125489862 | 3300012212 | Avena Fatua Rhizosphere | ENEMAYSALSLGFVCLASDCGFELEMEPVQAQQVLEPEEELVCC* |
| Ga0150985_1140178772 | 3300012212 | Avena Fatua Rhizosphere | ALTNRRVIKMKCPACIGENEMAYSALSNGFICLEEYCGFEVEMEPLQAQELLELQEELVCC* |
| Ga0150985_1177387401 | 3300012212 | Avena Fatua Rhizosphere | SRRARISQGGEIMNCPSCRSENEMAYSALSHGFICLESDCGFEVEMHPADAEEVLAIEEELVCC* |
| Ga0150985_1194811821 | 3300012212 | Avena Fatua Rhizosphere | MTCPGCHNENDMAYSALSNAFVCLDAHCGFELEMEPAQAIEVLEFEEELVCC* |
| Ga0137435_10491422 | 3300012232 | Soil | MTCPSCTSENEMAYSALSFGFVCLEPACGFELEMEPVQAQQVLEPEEELVCC* |
| Ga0150984_1034265512 | 3300012469 | Avena Fatua Rhizosphere | TMICPGCRSEGDMAYSVISNGFICMESGCGFELEMEPVQAQQVLEHEEQLVCC* |
| Ga0150984_1188418791 | 3300012469 | Avena Fatua Rhizosphere | VGSALAFLEVNTMTCPGCSSENEMAYSALSNGFVCLESQCGFELEMEPVQALLVLEPEEELVCC* |
| Ga0126375_100158103 | 3300012948 | Tropical Forest Soil | MTCPVCRSANEMAYSTLSHSFVCLESVCGFELEMEPLEAQQVLEPEEELVCC* |
| Ga0126375_107922192 | 3300012948 | Tropical Forest Soil | MICPACKNENEMAYSVLSNGFICLEPACGFELEMDAVQAREVLEPEEELVCC* |
| Ga0126369_109817332 | 3300012971 | Tropical Forest Soil | MTCPGCSSKHEMAYSALSHGFVCLESSCGFELEMEPPQAMQVLEFEEELVCC* |
| Ga0126369_121570472 | 3300012971 | Tropical Forest Soil | MICPGCKTENEMAYSTLSNSFTCLEPNCGFELEMEPAQALQVLEVEEELVCC* |
| Ga0157378_118103802 | 3300013297 | Miscanthus Rhizosphere | MLSKYSEGNMICPACRRENEMAYSVLSFGFVCLEADCGFEVEVDPEEAQLVVAPEEELVCC* |
| Ga0163162_123700512 | 3300013306 | Switchgrass Rhizosphere | MTCPRCDSRSEMAYSTLSYSFICMEPFCGYEVEMEPLEAQQVLEPEEELVCC* |
| Ga0157372_121789773 | 3300013307 | Corn Rhizosphere | MTCPRCKNENEMAYSILSNGFICLEPNCGFELEMEPAQAMQVLELEEELVCC* |
| Ga0132258_104242244 | 3300015371 | Arabidopsis Rhizosphere | MTCPVCRCQNEMAYSALSHAFTCLESNCGFELEMEPLEAEQVLAPEEELVCC* |
| Ga0132258_122198613 | 3300015371 | Arabidopsis Rhizosphere | MTCPGCDSRSEMAYSTLSYSFICTEPACGYEVEMEPLEAQQVLEPEEELVCC* |
| Ga0132258_126348262 | 3300015371 | Arabidopsis Rhizosphere | MICPACNTENEMAYSALSHGFICLEPACNFEVEMEPVQAQLVLEPEEELVCC* |
| Ga0132257_1014374312 | 3300015373 | Arabidopsis Rhizosphere | TILVAEVLTNFEEANHMTCPACTRESEMAYSSLSHSFVCLESLCGFEVEMDPVEAEQVLEPEEELVCC* |
| Ga0132257_1019667922 | 3300015373 | Arabidopsis Rhizosphere | MICPACHTENEMAYSALSHGFICLEPACNFEVEMEPVQAQLVLEPEEELVCC* |
| Ga0132255_1009336211 | 3300015374 | Arabidopsis Rhizosphere | SEMAYCTLSYSFICLEPSCGFEVEMEPLEAQQVLEPEEELVCC* |
| Ga0182041_112996472 | 3300016294 | Soil | MTCPGCNSENEMAYSGLSNSFICLEPNCGFELEMEPAQAMQVLEVEEELVCC |
| Ga0182041_115322412 | 3300016294 | Soil | MTCPRCTSENEMAYSALSHGFVCLEANCGFEFEMDAAEAMQVLEFEEELVCC |
| Ga0182035_119749712 | 3300016341 | Soil | EVLNHSREVVKMTCPGCNCESEMAYSALSHGFVCLEQNCGFEFEMDPVEAMQVLEFEDELVCC |
| Ga0182032_100489344 | 3300016357 | Soil | MMHCPSCRSGNEMAYSALFHGFVCLEPECGFELEMDPESAKQVLAPEEELVCC |
| Ga0182034_115861972 | 3300016371 | Soil | EVVKMTCPGCNCESEMAYSALSHGFVCLEQNCGFEFEMDPVEAMQVLEFEDELVCC |
| Ga0182039_113260652 | 3300016422 | Soil | MTCPGCKTENEMAYSNLSNSFMCLESNCGFELEMEPAQAMQVLEVEEELVCC |
| Ga0182038_119766032 | 3300016445 | Soil | MTCPGCKTENEMAYSNLSNSFICLEPNCGFELEMEPAQAVQVLEVEEELVCC |
| Ga0187779_106575252 | 3300017959 | Tropical Peatland | MMICPACNSENEMAYSALCHGFVCLEPNCGFELEMEPAQAMQVLDFEEELVCC |
| Ga0187777_108899742 | 3300017974 | Tropical Peatland | MTCPGCNGENEMAYSTLSNGFICLEPNCGFELEMEPSQAMQVLEVEEELVCC |
| Ga0180116_11037242 | 3300019229 | Groundwater Sediment | PSCTSQNEMAYSALSLGFVCLEPACGFELEMEPVQAQQVLELEEELVCC |
| Ga0210403_106138202 | 3300020580 | Soil | MTCPGCNSENEMAYSALSHGFLCLETNCGFELEMDPVEAMQVLEFEDELVCC |
| Ga0210406_104252382 | 3300021168 | Soil | MTCPGCKTENEMAYSGLSNSFICLEPNCGFELEMEPVQALQVLEVEEELVCC |
| Ga0213873_102427511 | 3300021358 | Rhizosphere | MICPGCNSETEMAYSALSHAFVCLEPNCGFELEMEVAEALQVVEFEEE |
| Ga0210397_102523244 | 3300021403 | Soil | MTCPGCNSHHEMAYSGLSHAFVCLEPNCGFELEMEPSQAVQVLEFEEELVCC |
| Ga0210383_111453322 | 3300021407 | Soil | MTCPGCNSHHEMAYSGLSHAFVCLEPNCGFELEMEPSQAVQVLEFEEE |
| Ga0126371_103120493 | 3300021560 | Tropical Forest Soil | MTCPGCSSKHDMAYSALSHGFVCLEPNCGFELEMEPPQAMQVLEFEEELVCC |
| Ga0126371_105595502 | 3300021560 | Tropical Forest Soil | MTCPGCNTENEMAYSGLSNSFICLEPNCGFELEMEPAQAMQVLEVEEELVCC |
| Ga0126371_123082661 | 3300021560 | Tropical Forest Soil | MTCPGCNSGTEMAYSALSHAFACLEPNCGFELEMEPREAMQVLE |
| Ga0126371_124001122 | 3300021560 | Tropical Forest Soil | MVCPGCGSENEMAYSAFSNALICLEDNCGFELEMPLNEALQVIEATPELVCA |
| Ga0224712_105538402 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | AVDVQCDLKEGNVMTCPGCRSEHEMAYSALSNGFVCLEENCGFEIEMEQADAMQVLEFEEELVCC |
| Ga0242664_11333351 | 3300022527 | Soil | TNMTCPGCNSHHEMAYSGLSHAFVCLEPNCGFELEMEPSQAVQVLEFEEELVCC |
| Ga0242662_100907651 | 3300022533 | Soil | LKCSVILRGGTNMICPGCNSEHEMAYSALSHGFVCLEPNCGFELEMEPHQAMQVLEFEEELVCC |
| Ga0242675_11253671 | 3300022718 | Soil | TCPGCNSHHEMAYSGLSHAFVCLEPNCGFEFEMEPSQAVQVLEFEEELVCC |
| Ga0242654_102348032 | 3300022726 | Soil | FFKEVRSMTCPGCKTENEMAYSGLSNSFICLEPNCGFELEMEPVQALQVLEVEEELVCC |
| Ga0242654_102467481 | 3300022726 | Soil | EMLIHFGGGTNMICPGCNSEHEMAYSALSHGFVCLEPNCGFELEMEPHQAMQVLEFEEELVCC |
| Ga0247679_10673691 | 3300024251 | Soil | MTCPGCNTENEMAYSGLSNSFICLEPNCGFELEMEPAEAMQ |
| Ga0207681_118245502 | 3300025923 | Switchgrass Rhizosphere | CPGCDSRSEMAYSTLSYSFICMEPACGYEVEMEPLEAQQVLEPEEELVCC |
| Ga0207661_121619471 | 3300025944 | Corn Rhizosphere | MICPGCNSEHEMAYSALSHGFVCLEPNCGFELEME |
| Ga0207675_1021480402 | 3300026118 | Switchgrass Rhizosphere | MKCPGCISENEMAYSALSNGFVCLEPACGFELEMEPVQAQQVLELEEELVCC |
| Ga0209382_101793803 | 3300027909 | Populus Rhizosphere | MTCPSCSSENEMAYSALSHGFICLEPACGMELEMEPIQAQQVLECEEELVCC |
| Ga0209382_111683472 | 3300027909 | Populus Rhizosphere | MNCPACSNEKEMAYSALSLSFVCLEPTCGFEVEMEPVQAHEVLEPEEELVCC |
| Ga0209382_115816571 | 3300027909 | Populus Rhizosphere | MTCPACRSHNEMAYSTLCHSFICLEPACGFELEMEPYLAQQVLEPEEELVCC |
| Ga0209382_121095641 | 3300027909 | Populus Rhizosphere | MTCPVCRSGNEMAYSTLCHSFICLEPVCGFELEMEPLEAQQVLEPEEELVCC |
| Ga0247682_10571912 | 3300028146 | Soil | MTCPGCNIENEMAYSGLSNSFICLEPNCGFELEMEPAEAMQVLEVEEELVCC |
| Ga0307482_11332412 | 3300030730 | Hardwood Forest Soil | MICPECAGHDEMVYSVLSHGFVCLDPSCGFELEMEPVEAQQVFESEEELVCC |
| Ga0308206_11876871 | 3300030903 | Soil | LNMICPVCKSTNEMAYSALSNGFICLERECGFELEMEFPDAELIQHPEEELVFA |
| Ga0138303_11852312 | 3300030939 | Soil | MICPICTSENEMAYSALSNGFVCLEPNCGFELEMEPALAQQVLETEEELVCC |
| Ga0073997_116741122 | 3300030997 | Soil | MTCPRCTGENEMAYSVLSNGFVCLETNCGFELEMEPVQAQQILELEEELVCC |
| Ga0073996_120758991 | 3300030998 | Soil | PKCPSGNEMAYSALSNGFVCLEYNCGFELEMEPVLARQVLETEEELVCS |
| Ga0073998_115543252 | 3300031023 | Soil | VMMICPICTSENEMAYSALSNGFVCLEPNCGFELEMEPVLAQQVLETEEELVCC |
| Ga0308197_104621171 | 3300031093 | Soil | ICPACSIEDEMAYSTLSHTFICMNADCGFELEMEPEEALVFLKIEHELVYA |
| Ga0170824_1144407251 | 3300031231 | Forest Soil | VHMFFKEVRSMTCPGCKTENEMAYSGLSNSFICLEPNCGFELEMEPVQALQVLEVEEELVCC |
| Ga0170824_1227031452 | 3300031231 | Forest Soil | MICPRCTREDEMAYSALSHGFVCLAADCGFELEMEPDQAELVLETEEELVCC |
| Ga0170820_132960951 | 3300031446 | Forest Soil | MTCPGCKNENEMAYSTLSNGFICLEPNCGFELEMEPAQALQVLEVEEELVCC |
| Ga0170820_135215842 | 3300031446 | Forest Soil | FKEVRSMTCPGCKTENEMAYSGLSNSFICLEPNCGFELEMEPVQALQVLEVEEELVCC |
| Ga0170819_150673361 | 3300031469 | Forest Soil | KFSQGVTSMTCPGCKNENEMAYSILSNGFICLEPNCGFELEMEPAQAMQVLELEEELVCC |
| Ga0310813_111766652 | 3300031716 | Soil | MICPACRRENEMAYSVLSFGFVCLEADCGFEVEVDPEEAQLVIAPEEELVCC |
| Ga0306921_107656933 | 3300031912 | Soil | MTCPGCNCESEMAYSALSHGFVCLEQNCGFEFEMDPVEAMQVLEFEDELVCC |
| Ga0306926_112618152 | 3300031954 | Soil | MTCPGCNRENNMAYSAISHGFVCLEPHCGFELEMDPVEAMQVLEFEDELVCC |
| Ga0306926_129121032 | 3300031954 | Soil | MTCPGCSSKHDMAYSALSHGFVCLEPNCGFELEMEPPQ |
| Ga0310890_110841792 | 3300032075 | Soil | MNCPACRCENEMAYSALSHGFVCLEENCGFEIEMEPVQAQLVLEPEEELVCC |
| Ga0314792_176090_400_558 | 3300034667 | Soil | MICPACHTETEMAYSALSHAFVCLEPVCNFELEMEPVQAQLVLEPEEELVCC |
| ⦗Top⦘ |