NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F027847

Metagenome / Metatranscriptome Family F027847

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F027847
Family Type Metagenome / Metatranscriptome
Number of Sequences 193
Average Sequence Length 40 residues
Representative Sequence MNPFTAVIDWLDENADFGAPIGAFIGVGIALALCFILGA
Number of Associated Samples 125
Number of Associated Scaffolds 193

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 82.90 %
% of genes near scaffold ends (potentially truncated) 16.58 %
% of genes from short scaffolds (< 2000 bps) 68.91 %
Associated GOLD sequencing projects 113
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (46.114 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake
(14.508 % of family members)
Environment Ontology (ENVO) Unclassified
(55.440 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(61.658 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 52.24%    β-sheet: 0.00%    Coil/Unstructured: 47.76%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 193 Family Scaffolds
PF03237Terminase_6N 5.70
PF06067DUF932 3.11
PF12957DUF3846 2.59
PF136402OG-FeII_Oxy_3 1.55
PF01464SLT 1.55
PF01555N6_N4_Mtase 1.04
PF02945Endonuclease_7 1.04
PF01471PG_binding_1 1.04
PF01391Collagen 1.04
PF07098DUF1360 0.52
PF01370Epimerase 0.52
PF04586Peptidase_S78 0.52
PF07553Lipoprotein_Ltp 0.52
PF02675AdoMet_dc 0.52
PF04488Gly_transf_sug 0.52
PF01521Fe-S_biosyn 0.52
PF02086MethyltransfD12 0.52
PF00850Hist_deacetyl 0.52
PF13828DUF4190 0.52
PF13392HNH_3 0.52
PF07728AAA_5 0.52

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 193 Family Scaffolds
COG0123Acetoin utilization deacetylase AcuC or a related deacetylaseSecondary metabolites biosynthesis, transport and catabolism [Q] 1.04
COG0863DNA modification methylaseReplication, recombination and repair [L] 1.04
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 1.04
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 1.04
COG0316Fe-S cluster assembly iron-binding protein IscAPosttranslational modification, protein turnover, chaperones [O] 0.52
COG0338DNA-adenine methylaseReplication, recombination and repair [L] 0.52
COG1586S-adenosylmethionine decarboxylaseAmino acid transport and metabolism [E] 0.52
COG3392Adenine-specific DNA methylaseReplication, recombination and repair [L] 0.52
COG3740Phage head maturation proteaseMobilome: prophages, transposons [X] 0.52
COG3774Mannosyltransferase OCH1 or related enzymeCell wall/membrane/envelope biogenesis [M] 0.52
COG4841Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF familyFunction unknown [S] 0.52


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms74.61 %
UnclassifiedrootN/A25.39 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352005|2200032659All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage709Open in IMG/M
3300000736|JGI12547J11936_1050580All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage844Open in IMG/M
3300000736|JGI12547J11936_1056155Not Available782Open in IMG/M
3300000756|JGI12421J11937_10006097All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4743Open in IMG/M
3300000756|JGI12421J11937_10010780All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3509Open in IMG/M
3300000756|JGI12421J11937_10011787All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium3342Open in IMG/M
3300000756|JGI12421J11937_10022660All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2305Open in IMG/M
3300000756|JGI12421J11937_10053241All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1300Open in IMG/M
3300000882|FwDRAFT_10185244All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage570Open in IMG/M
3300000928|OpTDRAFT_10405246All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium846Open in IMG/M
3300001275|B570J13894_1016769All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage698Open in IMG/M
3300001282|B570J14230_10048762All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1414Open in IMG/M
3300002372|B570J29634_100931All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1260Open in IMG/M
3300002835|B570J40625_100047441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1026208Open in IMG/M
3300002835|B570J40625_100167134All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium2465Open in IMG/M
3300002835|B570J40625_100459878All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1211Open in IMG/M
3300002835|B570J40625_100467548All Organisms → Viruses → Predicted Viral1197Open in IMG/M
3300002835|B570J40625_100472109All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1189Open in IMG/M
3300003413|JGI25922J50271_10055750All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage879Open in IMG/M
3300003490|JGI25926J51410_1021301All Organisms → Viruses → Predicted Viral1260Open in IMG/M
3300004112|Ga0065166_10418540All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage561Open in IMG/M
3300005517|Ga0070374_10002930Not Available7688Open in IMG/M
3300005517|Ga0070374_10173264Not Available1116Open in IMG/M
3300005517|Ga0070374_10284327All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage841Open in IMG/M
3300005517|Ga0070374_10292726All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage827Open in IMG/M
3300005517|Ga0070374_10488774All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage615Open in IMG/M
3300005527|Ga0068876_10091139Not Available1824Open in IMG/M
3300005580|Ga0049083_10043295All Organisms → Viruses → Predicted Viral1597Open in IMG/M
3300005581|Ga0049081_10258472All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage609Open in IMG/M
3300005583|Ga0049085_10000720Not Available12940Open in IMG/M
3300005584|Ga0049082_10008425Not Available3459Open in IMG/M
3300005662|Ga0078894_10101232All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2544Open in IMG/M
3300005662|Ga0078894_10468880All Organisms → Viruses → Predicted Viral1133Open in IMG/M
3300005662|Ga0078894_10964705Not Available736Open in IMG/M
3300005941|Ga0070743_10058591All Organisms → Viruses → Predicted Viral1309Open in IMG/M
3300005941|Ga0070743_10116075All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage896Open in IMG/M
3300006484|Ga0070744_10028055All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1667Open in IMG/M
3300006484|Ga0070744_10038279All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1415Open in IMG/M
3300006484|Ga0070744_10049568Not Available1232Open in IMG/M
3300006484|Ga0070744_10122922Not Available748Open in IMG/M
3300006484|Ga0070744_10135580All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium708Open in IMG/M
3300006641|Ga0075471_10001987Not Available13579Open in IMG/M
3300006805|Ga0075464_10686017All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage633Open in IMG/M
3300007162|Ga0079300_10071449All Organisms → Viruses → Predicted Viral1046Open in IMG/M
3300007544|Ga0102861_1160711Not Available611Open in IMG/M
3300007549|Ga0102879_1061963All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1187Open in IMG/M
3300007551|Ga0102881_1176064All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage591Open in IMG/M
3300007559|Ga0102828_1130885All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage622Open in IMG/M
3300007600|Ga0102920_1029059All Organisms → Viruses → Predicted Viral1683Open in IMG/M
3300007603|Ga0102921_1257475Not Available624Open in IMG/M
3300007622|Ga0102863_1005175All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium3489Open in IMG/M
3300007625|Ga0102870_1144431All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage686Open in IMG/M
3300007636|Ga0102856_1093539All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage501Open in IMG/M
3300007639|Ga0102865_1117949Not Available794Open in IMG/M
3300007670|Ga0102862_1029456Not Available1294Open in IMG/M
3300007708|Ga0102859_1128878All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage737Open in IMG/M
3300007708|Ga0102859_1189554Not Available610Open in IMG/M
3300007716|Ga0102867_1040917All Organisms → Viruses → Predicted Viral1213Open in IMG/M
3300007973|Ga0105746_1356246Not Available511Open in IMG/M
3300007974|Ga0105747_1259912Not Available582Open in IMG/M
3300007992|Ga0105748_10091559Not Available1209Open in IMG/M
3300008107|Ga0114340_1000035All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales108590Open in IMG/M
3300008107|Ga0114340_1003613Not Available8585Open in IMG/M
3300008107|Ga0114340_1059553Not Available2697Open in IMG/M
3300008110|Ga0114343_1191394All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage603Open in IMG/M
3300008116|Ga0114350_1154479All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage634Open in IMG/M
3300008261|Ga0114336_1010042Not Available9449Open in IMG/M
3300008962|Ga0104242_1062180Not Available625Open in IMG/M
3300008962|Ga0104242_1081372Not Available538Open in IMG/M
3300008964|Ga0102889_1070974All Organisms → Viruses → Predicted Viral1045Open in IMG/M
3300009026|Ga0102829_1066386All Organisms → Viruses → Predicted Viral1097Open in IMG/M
3300009026|Ga0102829_1196950Not Available653Open in IMG/M
3300009086|Ga0102812_10779858All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage529Open in IMG/M
3300009152|Ga0114980_10000403Not Available31360Open in IMG/M
3300009152|Ga0114980_10014313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1025034Open in IMG/M
3300009152|Ga0114980_10018739All Organisms → Viruses → Predicted Viral4345Open in IMG/M
3300009152|Ga0114980_10079504All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1967Open in IMG/M
3300009152|Ga0114980_10127278All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1515Open in IMG/M
3300009155|Ga0114968_10010812Not Available6548Open in IMG/M
3300009155|Ga0114968_10125847All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1543Open in IMG/M
3300009158|Ga0114977_10204770All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1155Open in IMG/M
3300009158|Ga0114977_10542511Not Available633Open in IMG/M
3300009158|Ga0114977_10602294All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage592Open in IMG/M
3300009159|Ga0114978_10191783All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1295Open in IMG/M
3300009161|Ga0114966_10080447All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium2228Open in IMG/M
3300009161|Ga0114966_10694458All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage558Open in IMG/M
3300009180|Ga0114979_10770228All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage541Open in IMG/M
3300009183|Ga0114974_10062789Not Available2457Open in IMG/M
3300009183|Ga0114974_10325469Not Available897Open in IMG/M
3300009183|Ga0114974_10613869All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage598Open in IMG/M
3300009183|Ga0114974_10684944Not Available558Open in IMG/M
3300009183|Ga0114974_10688436Not Available556Open in IMG/M
3300009419|Ga0114982_1027253All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1869Open in IMG/M
3300009419|Ga0114982_1034617All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1631Open in IMG/M
3300009419|Ga0114982_1280142Not Available522Open in IMG/M
3300010885|Ga0133913_10885870All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium2318Open in IMG/M
3300010885|Ga0133913_13287089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021064Open in IMG/M
3300011268|Ga0151620_1000125Not Available27929Open in IMG/M
3300011268|Ga0151620_1062344All Organisms → Viruses → Predicted Viral1212Open in IMG/M
3300012665|Ga0157210_1000240All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage26565Open in IMG/M
3300013004|Ga0164293_10019977All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5595Open in IMG/M
3300013004|Ga0164293_10040955Not Available3790Open in IMG/M
3300013005|Ga0164292_10045122Not Available3492Open in IMG/M
3300013005|Ga0164292_10264792All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1190Open in IMG/M
3300013014|Ga0164295_10134753All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1834Open in IMG/M
3300013372|Ga0177922_10477451All Organisms → Viruses → Predicted Viral4559Open in IMG/M
3300017722|Ga0181347_1072442All Organisms → Viruses → Predicted Viral1014Open in IMG/M
3300017761|Ga0181356_1227465Not Available540Open in IMG/M
3300019784|Ga0181359_1019750Not Available2541Open in IMG/M
3300019784|Ga0181359_1061571All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1436Open in IMG/M
3300020141|Ga0211732_1290514Not Available8740Open in IMG/M
3300020141|Ga0211732_1370100All Organisms → Viruses → Predicted Viral1475Open in IMG/M
3300020151|Ga0211736_10463593All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2059Open in IMG/M
3300020151|Ga0211736_10575077All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3706Open in IMG/M
3300020151|Ga0211736_10765884All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium745Open in IMG/M
3300020159|Ga0211734_10481503All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage742Open in IMG/M
3300020159|Ga0211734_10649806All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4607Open in IMG/M
3300020160|Ga0211733_10759396All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage580Open in IMG/M
3300020161|Ga0211726_10208115All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3282Open in IMG/M
3300020161|Ga0211726_10878105All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium552Open in IMG/M
3300020162|Ga0211735_11526727All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2144Open in IMG/M
3300020172|Ga0211729_10681528All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium573Open in IMG/M
3300020482|Ga0208464_101184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021875Open in IMG/M
3300020492|Ga0208483_1006567All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1524Open in IMG/M
3300020498|Ga0208050_1015582All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage813Open in IMG/M
3300020525|Ga0207938_1044497All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage644Open in IMG/M
3300020527|Ga0208232_1002826All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3037Open in IMG/M
3300020533|Ga0208364_1018026All Organisms → Viruses → Predicted Viral1010Open in IMG/M
3300020553|Ga0208855_1034870All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage690Open in IMG/M
3300020553|Ga0208855_1052749All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage527Open in IMG/M
3300020554|Ga0208599_1018696All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1129Open in IMG/M
3300020566|Ga0208222_1015627All Organisms → Viruses → Predicted Viral1538Open in IMG/M
3300020572|Ga0207909_1002115All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium4980Open in IMG/M
3300020572|Ga0207909_1051676All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage638Open in IMG/M
3300020572|Ga0207909_1068378All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage523Open in IMG/M
3300021141|Ga0214163_1055547All Organisms → Viruses → Predicted Viral1011Open in IMG/M
3300021519|Ga0194048_10011809All Organisms → Viruses → Predicted Viral3955Open in IMG/M
3300021961|Ga0222714_10480798Not Available641Open in IMG/M
3300021962|Ga0222713_10085948All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2286Open in IMG/M
3300021963|Ga0222712_10115453All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1856Open in IMG/M
3300021963|Ga0222712_10243041All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1156Open in IMG/M
3300022543|Ga0212119_1060649All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage595Open in IMG/M
3300023174|Ga0214921_10456044All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium628Open in IMG/M
3300024343|Ga0244777_10011577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1025598Open in IMG/M
3300024346|Ga0244775_10014843Not Available7250Open in IMG/M
3300024346|Ga0244775_10127566All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2154Open in IMG/M
3300024346|Ga0244775_10135468All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2083Open in IMG/M
3300024346|Ga0244775_10696125All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage819Open in IMG/M
3300024346|Ga0244775_10865803All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage719Open in IMG/M
3300024346|Ga0244775_11389246All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage540Open in IMG/M
3300024346|Ga0244775_11398072Not Available538Open in IMG/M
3300024346|Ga0244775_11423283All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage532Open in IMG/M
3300027211|Ga0208307_1016461All Organisms → Viruses → Predicted Viral1215Open in IMG/M
3300027246|Ga0208931_1043163All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage879Open in IMG/M
3300027418|Ga0208022_1089465All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage644Open in IMG/M
3300027518|Ga0208787_1059334All Organisms → Viruses → Predicted Viral1035Open in IMG/M
3300027586|Ga0208966_1000092Not Available27611Open in IMG/M
3300027601|Ga0255079_1050768All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage882Open in IMG/M
3300027627|Ga0208942_1151605All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage624Open in IMG/M
3300027689|Ga0209551_1038922All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1587Open in IMG/M
3300027720|Ga0209617_10011683All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium3934Open in IMG/M
3300027733|Ga0209297_1061942All Organisms → Viruses → Predicted Viral1666Open in IMG/M
3300027733|Ga0209297_1094059All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1291Open in IMG/M
3300027754|Ga0209596_1013114All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium5320Open in IMG/M
3300027754|Ga0209596_1023920All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium3587Open in IMG/M
3300027754|Ga0209596_1115548All Organisms → Viruses → Predicted Viral1242Open in IMG/M
3300027763|Ga0209088_10000223Not Available41835Open in IMG/M
3300027769|Ga0209770_10000300Not Available28059Open in IMG/M
3300027769|Ga0209770_10018748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1023057Open in IMG/M
3300027782|Ga0209500_10177033All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage981Open in IMG/M
3300027797|Ga0209107_10006481All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6572Open in IMG/M
3300027797|Ga0209107_10463085Not Available568Open in IMG/M
3300027805|Ga0209229_10398785All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage597Open in IMG/M
3300027892|Ga0209550_10173631All Organisms → Viruses → Predicted Viral1504Open in IMG/M
3300028025|Ga0247723_1002168All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage10712Open in IMG/M
3300028178|Ga0265593_1099793Not Available775Open in IMG/M
3300031787|Ga0315900_10654138All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage755Open in IMG/M
3300033979|Ga0334978_0530308Not Available546Open in IMG/M
3300033993|Ga0334994_0035640All Organisms → Viruses → Predicted Viral3193Open in IMG/M
3300033994|Ga0334996_0000903All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes19481Open in IMG/M
3300033995|Ga0335003_0305835All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage712Open in IMG/M
3300034018|Ga0334985_0330608All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage941Open in IMG/M
3300034050|Ga0335023_0061915All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium2183Open in IMG/M
3300034066|Ga0335019_0113225All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1811Open in IMG/M
3300034101|Ga0335027_0093177All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2316Open in IMG/M
3300034101|Ga0335027_0151369All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1702Open in IMG/M
3300034102|Ga0335029_0001481Not Available18694Open in IMG/M
3300034102|Ga0335029_0284806All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1050Open in IMG/M
3300034105|Ga0335035_0288359All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage973Open in IMG/M
3300034107|Ga0335037_0130315All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1372Open in IMG/M
3300034107|Ga0335037_0588869All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage588Open in IMG/M
3300034200|Ga0335065_0007899Not Available7556Open in IMG/M
3300034284|Ga0335013_0077137All Organisms → Viruses → Predicted Viral2366Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake14.51%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater11.40%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine11.40%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater10.36%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake10.36%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater7.77%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine7.77%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment3.63%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic3.11%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton3.11%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface2.59%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.07%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment1.55%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.55%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.55%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater1.04%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.04%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.52%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.52%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.52%
Freshwater And MarineEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine0.52%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.52%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.52%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.52%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.52%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.52%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.52%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352005Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnionEnvironmentalOpen in IMG/M
3300000736Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011EnvironmentalOpen in IMG/M
3300000756Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011EnvironmentalOpen in IMG/M
3300000882Freshwater microbial communities from the Columbia RiverEnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300001275Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnionEnvironmentalOpen in IMG/M
3300001282Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300002372Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003413Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DDEnvironmentalOpen in IMG/M
3300003490Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SNEnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005580Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRFEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005583Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRFEnvironmentalOpen in IMG/M
3300005584Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300007162Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11EnvironmentalOpen in IMG/M
3300007544Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3EnvironmentalOpen in IMG/M
3300007549Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02EnvironmentalOpen in IMG/M
3300007551Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3EnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007600Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3EnvironmentalOpen in IMG/M
3300007603Estuarine microbial communities from the Columbia River estuary - metaG 1568-02EnvironmentalOpen in IMG/M
3300007622Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02EnvironmentalOpen in IMG/M
3300007625Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02EnvironmentalOpen in IMG/M
3300007636Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3EnvironmentalOpen in IMG/M
3300007639Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02EnvironmentalOpen in IMG/M
3300007670Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3EnvironmentalOpen in IMG/M
3300007708Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02EnvironmentalOpen in IMG/M
3300007716Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3EnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008261Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NAEnvironmentalOpen in IMG/M
3300008962Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5EnvironmentalOpen in IMG/M
3300008964Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009419Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FTEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011268Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555EnvironmentalOpen in IMG/M
3300012665Freshwater microbial communities from Talbot River, Ontario, Canada - S11EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013014Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaGEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300017722Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020141Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1EnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020482Freshwater microbial communities from Lake Mendota, WI - 13SEPL2008 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020492Freshwater microbial communities from Lake Mendota, WI - 01JUN2011 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300020498Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020525Freshwater microbial communities from Lake Mendota, WI - 05MAR2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020527Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020533Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020553Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020554Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020566Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020572Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021141Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnionEnvironmentalOpen in IMG/M
3300021519Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5mEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022543Indian_combined assemblyEnvironmentalOpen in IMG/M
3300023174Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300027211Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027246Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027418Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes)EnvironmentalOpen in IMG/M
3300027518Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 (SPAdes)EnvironmentalOpen in IMG/M
3300027586Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027601Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8hEnvironmentalOpen in IMG/M
3300027627Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027689Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027763Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300028178Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36mEnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300033979Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300033994Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300034018Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021EnvironmentalOpen in IMG/M
3300034050Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M
3300034107Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
22002420152199352005FreshwaterMNPFTSLIDWLDENADYAPIGAFIGLGIALVLAFTLGA
JGI12547J11936_105058043300000736Freshwater And SedimentMNPFTALQDFLDENVAYGIIGAFVGVAIAVILCFTLGA*
JGI12547J11936_105615513300000736Freshwater And SedimentMNPFTALQDFLDENVAYGIIGAFIGVAIAVILCFTLGA*
JGI12421J11937_1000609713300000756Freshwater And SedimentMNPFTALIDWLDEYADVAGPIGAFIGVAVAVILCFTLGA*
JGI12421J11937_1001078073300000756Freshwater And SedimentMNPFTALIDWXDESADFMAPVGAFIGVGIAIALCFINGGN*
JGI12421J11937_1001178773300000756Freshwater And SedimentMTNPFTAVIDWLDENADFGAPIGAFIGVGIALALCFIFGA*
JGI12421J11937_1002266063300000756Freshwater And SedimentMNPFTALIDWIDESADFMAPVGAFIGVGIAIALCFINGGN*
JGI12421J11937_1005324153300000756Freshwater And SedimentMAVIDWIDENADFGAPVGAFIGLGIALVLAFTLGA*
FwDRAFT_1018524423300000882Freshwater And MarineSITTKRKGYKMNPFTALIDWLDENADYAPIGAFVGLGIALVLAFTLGA*
OpTDRAFT_1040524623300000928Freshwater And MarineMTNPIMAVIDWIDENADFGGPFAAFIGVAIAIALCFIFGGN*
B570J13894_101676923300001275FreshwaterMNPFTSLIDWLDENADYAPIGAFIGLGIALVLAFTLGA*
B570J14230_1004876233300001282FreshwaterMNPFTYAIDWLDENADYAPIGAFIGVVIAIALCFIFGGN*
B570J29634_10093123300002372FreshwaterMNPFTYAIDWLDXXADYAPIGAFIGVVIAIALCFIFGGN*
B570J40625_10004744173300002835FreshwaterMNPFTSIIDWLDENADYAPIGAFIGLGIAIALAFIFGGN*
B570J40625_10016713423300002835FreshwaterMTNPFTAVIDWLDENGDVGGPIGAFIGVGIAVTLCFIFGA*
B570J40625_10045987823300002835FreshwaterMNPFTYVQDWLDENADYAPIGAFIGLGIAIVLAFILGGN*
B570J40625_10046754833300002835FreshwaterMNPFTYVQDWLDENADYAPIGAFIGLGIAIALAFILGGN*
B570J40625_10047210943300002835FreshwaterMNPFTALIDWLDENADYAPIGAFIGLGIAIALAFAFGA*PKSQK*
JGI25922J50271_1005575023300003413Freshwater LakeMNPFTYIQDWLDENADYAPIGAFIGLGIAIALAFILGGN*
JGI25926J51410_102130123300003490Freshwater LakeMNPFTAVIDWIDENGDFGAPIGAFIGVGVAITLCFIFGGN*
Ga0065166_1041854013300004112Freshwater LakeMNPFTYIQDWLDENADYAPIGAFIGLGIAIALAFIFGGN*
Ga0070374_10002930223300005517Freshwater LakeMNPFTALIDWLDENADYAPIGAFIGLGIALILAFTLGG*
Ga0070374_1017326423300005517Freshwater LakeMTNPFTYLIDLLDEYGDVAGPIGAFIGVAIALITCFIVGA*
Ga0070374_1028432723300005517Freshwater LakeMNPFTALIDWLDENADYAPIGAFIGLGIALVLAFTLGA*
Ga0070374_1029272623300005517Freshwater LakeMNPFTALIDWLDENADYAPIGAFIGVGIALILCFTLGM*
Ga0070374_1048877423300005517Freshwater LakeMNPFTALIDWLDENADYAPIGAFIGLGIALVLAFTLGG*
Ga0068876_1009113923300005527Freshwater LakeMNPFTAIIDWLDENADFGAPVGAFIGVAVAVALCFILGA*
Ga0049083_1004329533300005580Freshwater LenticMNPFTALIDWLDENADYAPIGAFVGLGIALVLAFTLGA*
Ga0049081_1025847213300005581Freshwater LenticVNPFTAVIDWIDENADFGAPIGAFIGVGIAVALCFIFGA*
Ga0049085_10000720353300005583Freshwater LenticMTNPIMAVIDWIDENADYAPIGAFIGLGIALVLAFTLGA*
Ga0049082_1000842573300005584Freshwater LenticMNPFTALQDFLDENVAYGIIGAFIGVGISVALCFILGA*
Ga0078894_1010123223300005662Freshwater LakeMNPFTYAIDWLEDNADYAPIGAFIGLGIALVLAFTLGA*
Ga0078894_1046888033300005662Freshwater LakeMNPFTYVQDWLDDNADYAPIGAFIGVGIAIALCFIFGGN*
Ga0078894_1096470523300005662Freshwater LakeMNPFTAVMDWLDDNADVGAPIGAFIGVGIALALCFILGA*
Ga0070743_1005859123300005941EstuarineMNPFTAVIDWIDENGDFGAPIGAFIGVAIAITLCFIFGA*
Ga0070743_1011607523300005941EstuarineMNPFTAVIDWIDENGDFGAPIGAFIGVGIAITLCFIFGGN*
Ga0070744_1002805563300006484EstuarineMNPFTALIDWLDENADYAPIGAFVGLGIALVLAFTLGG*
Ga0070744_1003827913300006484EstuarineMNPFTALIDWIDDNADFMAPVGAFIGVGIAIALCFINGGN*
Ga0070744_1004956833300006484EstuarineMNPFTAAQDWIDENCDYALLGAGIGIVISIALCFIFGGN*
Ga0070744_1012292223300006484EstuarineMNPFTYMIDWLDENADVGAPIGAFIGVAISIALCFIFGGN*
Ga0070744_1013558023300006484EstuarineMTNPIMAVIDWIDENGDVGGPIGAFIGVGIAVALCFIFGA*
Ga0075471_10001987353300006641AqueousMNPFTAFIDWLDMYADVAGPIGAFIGVAIAVVTAFILG*
Ga0075464_1068601713300006805AqueousMNPFTAVIDWLDENADFGAPIGAFIGVAVAVALCFIFGA*
Ga0079300_1007144913300007162Deep SubsurfaceMNPFTAVMDWLDDNADVGAPIGAFIGVAVAELLASFGG
Ga0102861_116071123300007544EstuarineMTNPIMAVIDWIDENADFGAPSGAFIGVGIAVALCFIFGA*
Ga0102879_106196343300007549EstuarineMTNPIMAVIDWIDENADFGGPFAAFIGVAISVALCFIFGGN*
Ga0102881_117606423300007551EstuarineMNPFTYVQDWLDDNADYAPIGAFIGVVVAVALCFIFGGN*
Ga0102828_113088523300007559EstuarineMNLFTYAIDWLEDNADYAPIGAFIGLGIALVLAFTLGA*
Ga0102920_102905943300007600EstuarineMNPFTAVIDWIDENGDFGAPIGAFIGVAIAITLCFIFG*
Ga0102921_125747523300007603EstuarineMTNPIMAVIDWIDENADFGAPIGAFIGVGIAVALCFIFGA*
Ga0102863_100517563300007622EstuarineMTNPIMAVIDWIDENADFGGPFAAFIGVGIAVALCFIFGA*
Ga0102870_114443113300007625EstuarineMNPFTAFIDWLDENADYAPIGAFIGLGIALVLAFTLGG*
Ga0102856_109353913300007636EstuarineKVTKMNPFTALQDFLDENVAYGIIGAFVGVGIALVIAFTLGA*
Ga0102865_111794913300007639EstuarinePIMAVIDLIDENGDVGGPIGAFIGVGIAVALCFIFGA*
Ga0102862_102945643300007670EstuarineTNPIMAVIDWIDENGDVGGPIGAFIGVGIAVALCFIFGA*
Ga0102859_112887813300007708EstuarineMNPFTAVIDWLDENADYAPIGAFIGLGIAIALAFAFGA*
Ga0102859_118955423300007708EstuarineMNPFTALQDFLDENVAYGIIGAFVGVGIALVIAFTLGA*
Ga0102867_104091723300007716EstuarineMNPFTAVIDWIDENGDFGEPIGAFIGVAIAITLCFIFGA*
Ga0105746_135624633300007973Estuary WaterFTYAIDWLDDNADFMAPVGAFIGVGIAIALCFINGGN*
Ga0105747_125991233300007974Estuary WaterVIIILTTTKGTKMTNPIMAVIDWIDENGDVGGPIGAFIGVGIAVALCFIFGA*
Ga0105748_1009155913300007992Estuary WaterMTNPFTAVIDWLDENADFGAPIGAFIGVGIAVALCFIFGA*
Ga0114340_1000035953300008107Freshwater, PlanktonMNPFTALQDFLDENVAYGLIGAFVGVAIAVILCFTLGA*
Ga0114340_100361353300008107Freshwater, PlanktonMNPFTALIDWLDENADYAPIGAFVGLGIAIALAFAFGA*
Ga0114340_105955353300008107Freshwater, PlanktonMNPFTAIIDWLDENADFGAPVGAFVGVAVAVALCFILGA*
Ga0114343_119139413300008110Freshwater, PlanktonMNPFTYIQDWLDENADYAPIGAVIGLGIAISLAFIFGGN*
Ga0114350_115447933300008116Freshwater, PlanktonMNPFTSLIDWVDENADVAGPLGAFIGLGLAITIAVIGAK*
Ga0114336_1010042233300008261Freshwater, PlanktonMNPFTALIDWLDENADYAPIGAFVGLGIALILAFTLGG*
Ga0104242_106218023300008962FreshwaterMNPFTYAIDWLDDNADFAGPIGAFIGIGIAITLLVIGAK*
Ga0104242_108137233300008962FreshwaterMNPFTYMIDFLDDNADFMAPVGAFIGLAIAFTIAIIGAK*
Ga0102889_107097433300008964EstuarineTALIDWLDENADYAPIGAFIGVGIALILCFTLGM*
Ga0102829_106638643300009026EstuarineMNPFTYLIDLLDEYGDVGGPIGAFIGVGVAIALCVIFGA*
Ga0102829_119695013300009026EstuarineKGMKMTNPIMAVIDWIDENGDVGWPIGAFIGVGIAVALCFIFGA*
Ga0102812_1077985823300009086EstuarineMNPFTAVIDWIDENGDFGAPIGAFIGVGIAIALCFIFGA*
Ga0114980_1000040353300009152Freshwater LakeMNPFTAVIDWIDENGDFGAPIGAFIGVGIAIALCFIFGGN*
Ga0114980_1001431393300009152Freshwater LakeMNPFTYMIDWLDENADVGAPIGAFIGVAIAIGLCFIFGGN*
Ga0114980_1001873923300009152Freshwater LakeMNPFTAVIDWIDENGDFGAPIGAFIGVGIAITLCFIFGA*
Ga0114980_1007950463300009152Freshwater LakeMNPFTAVIDWIDENGDFGAPIGAFIGVAIAITLCFVFG*
Ga0114980_1012727843300009152Freshwater LakeMTNPIMAVIDWIDENADFGAPIGAFIGVAISVALCFIFGGN*
Ga0114968_1001081243300009155Freshwater LakeMTNPFTALIDWIDDNADFGAPIGAFIGVGIAIALCFIFGA*
Ga0114968_1012584733300009155Freshwater LakeMTEGKKMNPFTAVIDWLDEYADVAGPIGAFIGVGIAIALCFILGA*
Ga0114977_1020477023300009158Freshwater LakeMNPFTYMIDWLDENADVGAPIGAFIGVAIALGLCFIFGGK*
Ga0114977_1054251133300009158Freshwater LakeMNPFTYMIDFLEDNADFMAPVGAFIGLAIAFTIAIIGAK*
Ga0114977_1060229413300009158Freshwater LakeMTNPIMAVIDWIDENADFGAPVGAFIGLGIALVLAFTLGA*
Ga0114978_1019178333300009159Freshwater LakeMTNPIMAVIDWIDENADFGAPVGAFIGLGIALILAFTLGG*
Ga0114966_1008044733300009161Freshwater LakeMTNPIMAVIDWIDENADFGGPFAAFIGVGIAVALCFIFGT*
Ga0114966_1069445823300009161Freshwater LakeMVNPFWVVTNWIDENADYAPIGAFIGLGIAVLLAVIFGG*
Ga0114979_1077022823300009180Freshwater LakeMNPFTAVIDWIDENGDFGAPIGAFIGVVIAIALCFIFGGN*
Ga0114974_1006278923300009183Freshwater LakeMNPFTAVMDWLDDNADVGAPIGAFIGVAVAVIACFIWG*
Ga0114974_1032546923300009183Freshwater LakeMFILDWIDENADVMGPLGAFLGVAVAVALCFIFG*
Ga0114974_1061386913300009183Freshwater LakeMNPFTYMIDLLDEYDYMGPIGAFIGVVISVALCFIFGGN*
Ga0114974_1068494423300009183Freshwater LakeIIILTTTKGTKMTNPIMAVIDWIDENGDVGGPIGAFIGVGIAVALCFIFGA*
Ga0114974_1068843623300009183Freshwater LakeIIILTTTKGTKMTNPIMAVIDWIDENGDVGGPIGAFIGVGIAVALCFIFGT*
Ga0114982_102725323300009419Deep SubsurfaceMNPFTAVIDWLDEYADVAAPVGAFVGVAIAVAIAFILG*
Ga0114982_103461713300009419Deep SubsurfaceMNPFTAVIDWLDEYADVAGPVGAFVGVAIAVAIAFILG*
Ga0114982_128014213300009419Deep SubsurfaceMNPFTYAIDWLDDNADFMAPVGAFIGVGIAIALCFINGGN*
Ga0133913_1088587023300010885Freshwater LakeMTEGKKMNPFTAVIDWLDEYADVAGPIGAFIGVGIAVALCFILGA*
Ga0133913_1328708913300010885Freshwater LakeTNKGQTMNPFTYMIDWLDENADYAPIGAFIGVVIAIALCFIFGGN*
Ga0151620_1000125403300011268FreshwaterMEIQMFILDWIDENADVAGPVGAFIGVAIAVALCFILGA*
Ga0151620_106234443300011268FreshwaterMNPFTALIDWLDENADYAPIGAFIGLGIAIALAFAFGA*
Ga0157210_100024053300012665FreshwaterMNPFTAVIDWLDENADFGAPIGAFIGVGIALALCFILGA*
Ga0164293_1001997733300013004FreshwaterMNPFTALQDFLDENVAYGLIGAFIGVAVAVILCLTLGA*
Ga0164293_1004095523300013004FreshwaterMNPFTAVIDWLDEYADVAGPVGAFIGVGVAVALCFIFGA*
Ga0164292_1004512273300013005FreshwaterMNPFTAVIDWLDEYADVAGPIGAFIGVGVAVALCFIFGA*
Ga0164292_1026479213300013005FreshwaterTTKGTKMTNPFTALIDWIDDNADFGAPIGAFIGVGIAIALCFIFGA*
Ga0164295_1013475333300013014FreshwaterMIDWLDENADVGAPIGAFIGVAIAIGLCFIFGGN*
Ga0177922_1047745133300013372FreshwaterMNPFTYMIDWLDDNADYAPIGAFIGVVIAIALCFIFGGK*
Ga0181347_107244243300017722Freshwater LakeMNPFTALIEWLDENADYAPIGAFIGLGIALVLAFTLGA
Ga0181356_122746513300017761Freshwater LakeMTNPIMAVIDWIDENADFGAPIGAFIGVGIAVALCFIFGA
Ga0181359_101975033300019784Freshwater LakeMNPFTALIDWLDENADYAPIGAFIGLGIALVLAFTLGA
Ga0181359_106157123300019784Freshwater LakeMNPFTAVIDWIDENGDFGAPIGAFIGVGVAITLCFIFGGN
Ga0211732_129051443300020141FreshwaterMNPFTAVIDWLDENADYAPIGAFVGVVIAIALCFIFGGN
Ga0211732_137010043300020141FreshwaterMNPFTALIDWLDENADYAPIGAFIGLGIALVLAFTLGG
Ga0211736_1046359313300020151FreshwaterMNPFTALIDWLDENADYAPIGAFIGLGIALVLAFALGG
Ga0211736_1057507753300020151FreshwaterMNPFTALIDWIDENADFMAPVGAFIGVGIAIALCFINGGN
Ga0211736_1076588423300020151FreshwaterMNPFTAAQDWLEDNADFGAPLAAFIGVGIAIALCFIFGA
Ga0211734_1048150323300020159FreshwaterMNPFTALIDWLDENADYAPIGAFVGLGIALILAFTLGA
Ga0211734_1064980683300020159FreshwaterMNPFTALIDWLDEYADVAGPIGAFIGVAVAVILCFTLGA
Ga0211733_1075939613300020160FreshwaterVNMNPFTYAIDWLDDNADYAPIGAFIGLGIAIALCFIFGGN
Ga0211726_1020811553300020161FreshwaterMNPFTSLIDWVDENADVAGPLGAFIGLGLAITIAVIGAK
Ga0211726_1087810513300020161FreshwaterMTNPFTALIDWIDENADFGAPLAAFIGVGIAVALCFIFGA
Ga0211735_1152672713300020162FreshwaterMNPFTALQDFLDENVAYGLIGAFVGIGIALILCFTLGA
Ga0211729_1068152823300020172FreshwaterMTNPIMAVIDWIDENGDVGGPIGAFIGVGIAVALCFIFGA
Ga0208464_10118423300020482FreshwaterMNPFTYVQDWLDENADYAPIGAFIGLGIAIVLAFILGGN
Ga0208483_100656723300020492FreshwaterMNPFTSIIDWLDENADYAPIGAFIGLGIAIALAFIFGGN
Ga0208050_101558223300020498FreshwaterMNPFTYAIDWLDENADYAPIGAFIGVVIAIALCFIFGGN
Ga0207938_104449713300020525FreshwaterMNPFTALIDWIDESADFMAPVGAFIGVGIAIALCFINGGN
Ga0208232_100282643300020527FreshwaterMNPFTALIDWLDENADYAPIGAFIGLGIAIALAFAFGA
Ga0208364_101802623300020533FreshwaterMNPFTAVIDWLDEYADVAGPVGAFVGVAIAVAIAFILG
Ga0208855_103487023300020553FreshwaterVNKMNPFTYAIDWLDENADYAPIGAFIGVVIAIALCFIFGGN
Ga0208855_105274933300020553FreshwaterTNKGQKMNPFTALIDWIDDNADFMAPVGAFIGVGIAIALCFINGGN
Ga0208599_101869623300020554FreshwaterMNPFTYAIDWLDDNADFMAPVGAFIGVGIAIALCFINGGN
Ga0208222_101562753300020566FreshwaterMNPFTALIDWLDENADYAPIGAFVGLGIAIALAFTLGA
Ga0207909_100211583300020572FreshwaterMTNPFTAVIDWLDENGDVGGPIGAFIGVGIAVTLCFIFGA
Ga0207909_105167633300020572FreshwaterPFTALIDWLDENADYAPIGAFVGLGIALVLAFTLGA
Ga0207909_106837833300020572FreshwaterNKGQKMNPFTALIDWIDESADFMAPVGAFIGVGIAIALCFINGGN
Ga0214163_105554733300021141FreshwaterMNPFTALIDWLDENADYAPIGAFVGLGIALVLAFTLGA
Ga0194048_1001180993300021519Anoxic Zone FreshwaterMNPFTYMIDWLDDNADYAPIGAFIGVAIAIVICIVAG
Ga0222714_1048079823300021961Estuarine WaterMEIQMFILDWIDENADVAGPVGAFIGVAIAVALCFILGA
Ga0222713_1008594853300021962Estuarine WaterMNPFTAFIDWLDMYADVAGPIGAFIGVAIAVVTAFILG
Ga0222712_1011545343300021963Estuarine WaterMNPFTAVIDWIDENADFGAPIGAFIGVVIAITLCFIFGGK
Ga0222712_1024304123300021963Estuarine WaterMTNPIMAVIDWIDENADFGGPFAAFIGVGIAVALCFIFGT
Ga0212119_106064923300022543FreshwaterMNPFTYVQDWLDENADYAPIGAFIGLGIAIALAFILGGN
Ga0214921_1045604423300023174FreshwaterMTNPFTAVIDWLDENADFGAPIGAFIGVGIAVALCFILGA
Ga0244777_1001157783300024343EstuarineMNPFTAVIDWIDENGDFGAPIGAFIGVAIAITLCFIFGA
Ga0244775_1001484383300024346EstuarineMNPFTYAIDWLEDNADYAPIGAFIGLGIALVLAFTLGA
Ga0244775_1012756673300024346EstuarineMNPFTAAQDWIDENCDYALLGAGIGIVISIALCFIFGGN
Ga0244775_1013546843300024346EstuarineMNPFTALIDWIDDNADFMAPVGAFIGVGIAIALCFINGGN
Ga0244775_1069612533300024346EstuarineMNPFTYLIDLLDEYGDVGGPIGAFIGVGVAIALCVIFGA
Ga0244775_1086580323300024346EstuarineMNPFTALIDWLDENADYAPIGAFVGLGIALVLAFTLGAXPI
Ga0244775_1138924613300024346EstuarineMNPFTALIDWLDENADYAPIGAFVGLGIALVLAFTLGG
Ga0244775_1139807223300024346EstuarineMNPFTYMIDWLDENADVGAPIGAFIGVAISIALCFIFGGN
Ga0244775_1142328313300024346EstuarineNPFTAIIDWLDENADYAPIGAFIGLGIALVLAFTLGA
Ga0208307_101646123300027211EstuarineMTNPIMAVIDWIDENADFGAPVGAFIGLGIALVLAFTLGA
Ga0208931_104316333300027246EstuarineTTKRKGYKMNPFTALIDWLDENADYAPIGAFVGLGIALVLAFTLGA
Ga0208022_108946523300027418EstuarineMNPFTAVIDWIDENGDFGAPIGAFIGVGIAITLCFIFGGN
Ga0208787_105933433300027518Deep SubsurfaceMNPFTAVMDWLDDNADVGAPIGAFIGVAVAVIACF
Ga0208966_1000092213300027586Freshwater LenticMNPFTALQDFLDENVAYGIIGAFIGVGISVALCFILGA
Ga0255079_105076813300027601FreshwaterTKRKGYKMNPFTALIDWLDENADYAPIGAFVGLGIALVLAFTLGA
Ga0208942_115160513300027627Freshwater LenticMTNPIMAVIDWIDENADYAPIGAFIGLGIALVLAFTLGA
Ga0209551_103892243300027689Freshwater LakeMNPFTALIDWLDENADYAPIGAFVGLGIALILAFTLGG
Ga0209617_1001168333300027720Freshwater And SedimentMTNPFTAVIDWLDENADFGAPIGAFIGVGIAVALCFIFGA
Ga0209297_106194223300027733Freshwater LakeMNPFTYMIDWLDENADYAPIGAFIGVVIAIALCFIFGGN
Ga0209297_109405923300027733Freshwater LakeMTNPIMAVIDWIDENADFGAPIGAFIGVAISVALCFIFGGN
Ga0209596_101311493300027754Freshwater LakeMTEGKKMNPFTAVIDWLDEYADVAGPIGAFIGVGIAIALCFILGA
Ga0209596_102392063300027754Freshwater LakeMTNPFTALIDWIDDNADFGAPIGAFIGVGIAIALCFIFGA
Ga0209596_111554823300027754Freshwater LakeMNPFTAVIDWIDENGDFGAPIGAFIGVGIAITLCFIFGA
Ga0209088_10000223283300027763Freshwater LakeMNPFTYMIDWLDENADVGAPIGAFIGVAIAIGLCFIFGGN
Ga0209770_10000300113300027769Freshwater LakeMNPFTALIDWLDENADYAPIGAFIGLGIALILAFTLGG
Ga0209770_1001874893300027769Freshwater LakeMNPFTYIQDWLDENADYAPIGAFIGLGIAIALAFILGGN
Ga0209500_1017703313300027782Freshwater LakeMNPFTAVIDWIDENGDFGAPIGAFIGVAIAITLCFVFG
Ga0209107_10006481143300027797Freshwater And SedimentMNPFTALQDFLDENVAYGIIGAFVGVAIAVILCFTLGA
Ga0209107_1046308513300027797Freshwater And SedimentLPVIIILTTTKGTKMTNPFTAVIDWLDENADFGAPIGAFIGVGIALALCFIFGA
Ga0209229_1039878513300027805Freshwater And SedimentIRMNPFTALIDWLDENADYAPIGAFIGLGIAIVLAFTLGA
Ga0209550_1017363113300027892Freshwater LakeMNPFTYMIDWLDENADYAPIGAFIGVGIAIALCFIFGGN
Ga0247723_1002168243300028025Deep Subsurface SedimentMNPFTAVIDWLDENADFGAPIGAFIGVGIALALCFILGA
Ga0265593_109979333300028178Saline WaterERLIKMTNPIMAVIDWIDENADYCAPVGAFIGLGIALVLAFTLGA
Ga0315900_1065413813300031787FreshwaterMNPFTALIDWLDENADYAPIGAFVGLGIAIALAFAFGAXPKS
Ga0334978_0530308_411_5453300033979FreshwaterTTEGKKMNPFTAVIDWLDEYADVAGPVGAFVGVAIAVAIAFILG
Ga0334994_0035640_27_1433300033993FreshwaterMNPFTALQDFLDENVAYGLIGAFIGVAVAVILCLTLGA
Ga0334996_0000903_16181_163033300033994FreshwaterMTNPFTAVIDWIDDNADFGAPIGAFIGVGIAITLCFIFGA
Ga0335003_0305835_82_1983300033995FreshwaterMNPFTYAIDWLDDNADFMAPVGAFIGVAIAIALCFINA
Ga0334985_0330608_827_9403300034018FreshwaterNPFTALIDWLDENADYAPIGAFIGLGIALVLAFTLGA
Ga0335023_0061915_368_4903300034050FreshwaterMTNPFTAVIDWLDENGDVGGPIGAFIGVGIALALCFIFGA
Ga0335019_0113225_855_9713300034066FreshwaterMNPFTALIDWLDENADYAPIGAFVGLGIAIALAFAFGA
Ga0335027_0093177_1456_15723300034101FreshwaterMNPFTALIDLLDEYEYAGPIGAFVGLGIALILAFTLGG
Ga0335027_0151369_579_6953300034101FreshwaterMNPFTALIDFLDENADYAPIGAFIGLGIALVIAFTLGA
Ga0335029_0001481_14219_143413300034102FreshwaterMNPFTAVIDWIDENGDFGAPIGAFIGVVIAIALCFIFGGN
Ga0335029_0284806_593_7123300034102FreshwaterMNPFTYMIDWLDENADYAPIGAFIGVVIAIALCFILGGK
Ga0335035_0288359_2_1333300034105FreshwaterGQKMNPFTALIDWIDESADFMAPVGAFIGVGIAIALCFINGGN
Ga0335037_0130315_1_1143300034107FreshwaterPFTAVIDWLDENADFGAPIGAFIGVGIAVALCFIFGA
Ga0335037_0588869_2_1483300034107FreshwaterNPTTKGTKMTNPFTALIDWIDDNADFGAPIGAFIGVGIAIALCFIFGA
Ga0335065_0007899_7106_72223300034200FreshwaterMNPFTALIDWLDENADYAPIGALIGLGIALVLAFTLGG
Ga0335013_0077137_291_4103300034284FreshwaterMNPFTAVIDWLDEYADVAGPVGAFIGVGVAVALCFIFGA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.