| Basic Information | |
|---|---|
| Family ID | F027824 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 193 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MRTLVRSVGRKDIGGEPLPSVFKTFESNKIIFRRAEVSMLAGTP |
| Number of Associated Samples | 148 |
| Number of Associated Scaffolds | 193 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 95.34 % |
| % of genes near scaffold ends (potentially truncated) | 98.45 % |
| % of genes from short scaffolds (< 2000 bps) | 92.23 % |
| Associated GOLD sequencing projects | 141 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (56.477 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (20.725 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.959 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (57.513 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.28% β-sheet: 13.89% Coil/Unstructured: 70.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 193 Family Scaffolds |
|---|---|---|
| PF12705 | PDDEXK_1 | 28.50 |
| PF13578 | Methyltransf_24 | 3.63 |
| PF13481 | AAA_25 | 0.52 |
| PF05257 | CHAP | 0.52 |
| PF02467 | Whib | 0.52 |
| PF01930 | Cas_Cas4 | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 193 Family Scaffolds |
|---|---|---|---|
| COG1468 | CRISPR/Cas system-associated exonuclease Cas4, RecB family | Defense mechanisms [V] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.75 % |
| Unclassified | root | N/A | 7.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002091|JGI24028J26656_1026873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300002298|B570J29599_1010093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300002471|metazooDRAFT_1473191 | Not Available | 747 | Open in IMG/M |
| 3300002835|B570J40625_100627214 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 978 | Open in IMG/M |
| 3300002835|B570J40625_101221101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300002835|B570J40625_101693083 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300003393|JGI25909J50240_1012675 | All Organisms → Viruses → Predicted Viral | 2023 | Open in IMG/M |
| 3300003393|JGI25909J50240_1048600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Salinispora | 886 | Open in IMG/M |
| 3300004096|Ga0066177_10265219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
| 3300004128|Ga0066180_10034594 | All Organisms → Viruses → Predicted Viral | 1681 | Open in IMG/M |
| 3300004128|Ga0066180_10201677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
| 3300004461|Ga0066223_1069321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
| 3300004764|Ga0007754_1377364 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 632 | Open in IMG/M |
| 3300004768|Ga0007762_1649670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 955 | Open in IMG/M |
| 3300004769|Ga0007748_10107970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300004786|Ga0007753_1002261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
| 3300005517|Ga0070374_10402989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
| 3300005527|Ga0068876_10184216 | All Organisms → Viruses → Predicted Viral | 1216 | Open in IMG/M |
| 3300005527|Ga0068876_10791851 | Not Available | 501 | Open in IMG/M |
| 3300005662|Ga0078894_11127171 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
| 3300006641|Ga0075471_10096097 | All Organisms → Viruses → Predicted Viral | 1594 | Open in IMG/M |
| 3300006805|Ga0075464_10224724 | All Organisms → Viruses → Predicted Viral | 1119 | Open in IMG/M |
| 3300006805|Ga0075464_10378700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 858 | Open in IMG/M |
| 3300006869|Ga0075477_10131698 | All Organisms → Viruses → Predicted Viral | 1053 | Open in IMG/M |
| 3300006917|Ga0075472_10393386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
| 3300007234|Ga0075460_10072234 | All Organisms → Viruses → Predicted Viral | 1268 | Open in IMG/M |
| 3300007304|Ga0102689_1271972 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 558 | Open in IMG/M |
| 3300007321|Ga0102692_1629208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
| 3300007540|Ga0099847_1099239 | Not Available | 887 | Open in IMG/M |
| 3300007548|Ga0102877_1241307 | Not Available | 509 | Open in IMG/M |
| 3300007860|Ga0105735_1057704 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 775 | Open in IMG/M |
| 3300008107|Ga0114340_1256794 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 530 | Open in IMG/M |
| 3300008108|Ga0114341_10172999 | All Organisms → Viruses → Predicted Viral | 1233 | Open in IMG/M |
| 3300008108|Ga0114341_10381113 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 693 | Open in IMG/M |
| 3300008113|Ga0114346_1218410 | All Organisms → Viruses → Predicted Viral | 1279 | Open in IMG/M |
| 3300008120|Ga0114355_1062457 | All Organisms → Viruses → Predicted Viral | 1625 | Open in IMG/M |
| 3300008120|Ga0114355_1085943 | All Organisms → Viruses → Predicted Viral | 1280 | Open in IMG/M |
| 3300008120|Ga0114355_1206357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 626 | Open in IMG/M |
| 3300008120|Ga0114355_1206532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
| 3300008259|Ga0114841_1069964 | All Organisms → Viruses → Predicted Viral | 1627 | Open in IMG/M |
| 3300008259|Ga0114841_1255484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300008261|Ga0114336_1240327 | Not Available | 730 | Open in IMG/M |
| 3300008262|Ga0114337_1165544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1825 | Open in IMG/M |
| 3300008266|Ga0114363_1210555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300008450|Ga0114880_1155242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 819 | Open in IMG/M |
| 3300009081|Ga0105098_10060244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1566 | Open in IMG/M |
| 3300009085|Ga0105103_10090958 | All Organisms → Viruses → Predicted Viral | 1577 | Open in IMG/M |
| 3300009086|Ga0102812_10527075 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 646 | Open in IMG/M |
| 3300009160|Ga0114981_10520773 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300009163|Ga0114970_10328846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 864 | Open in IMG/M |
| 3300009164|Ga0114975_10278475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 930 | Open in IMG/M |
| 3300009164|Ga0114975_10319892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 857 | Open in IMG/M |
| 3300009165|Ga0105102_10146738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1147 | Open in IMG/M |
| 3300009165|Ga0105102_10256785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 892 | Open in IMG/M |
| 3300009165|Ga0105102_10762476 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 548 | Open in IMG/M |
| 3300009168|Ga0105104_10071754 | All Organisms → Viruses → Predicted Viral | 1870 | Open in IMG/M |
| 3300009168|Ga0105104_10684775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
| 3300009169|Ga0105097_10142908 | All Organisms → Viruses → Predicted Viral | 1315 | Open in IMG/M |
| 3300009184|Ga0114976_10382744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
| 3300010157|Ga0114964_10261738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 823 | Open in IMG/M |
| 3300010160|Ga0114967_10371351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
| 3300010334|Ga0136644_10452233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 722 | Open in IMG/M |
| 3300010885|Ga0133913_10683817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2686 | Open in IMG/M |
| 3300010885|Ga0133913_10764324 | All Organisms → Viruses → Predicted Viral | 2522 | Open in IMG/M |
| 3300010970|Ga0137575_10028841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 894 | Open in IMG/M |
| 3300011011|Ga0139556_1073658 | Not Available | 515 | Open in IMG/M |
| 3300011268|Ga0151620_1049616 | All Organisms → Viruses → Predicted Viral | 1385 | Open in IMG/M |
| 3300012000|Ga0119951_1088206 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 767 | Open in IMG/M |
| 3300012013|Ga0153805_1076438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| 3300012352|Ga0157138_1075546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300012754|Ga0138278_1138670 | Not Available | 529 | Open in IMG/M |
| 3300012968|Ga0129337_1256790 | All Organisms → Viruses → Predicted Viral | 1139 | Open in IMG/M |
| 3300012968|Ga0129337_1419823 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 688 | Open in IMG/M |
| 3300013004|Ga0164293_11048100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10827517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300013295|Ga0170791_10871358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300013295|Ga0170791_12082575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 928 | Open in IMG/M |
| 3300013372|Ga0177922_10568857 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
| 3300017716|Ga0181350_1124112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
| 3300017722|Ga0181347_1107680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
| 3300017723|Ga0181362_1112900 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 535 | Open in IMG/M |
| 3300017736|Ga0181365_1065325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 900 | Open in IMG/M |
| 3300017766|Ga0181343_1053404 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1185 | Open in IMG/M |
| 3300017766|Ga0181343_1115155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
| 3300017774|Ga0181358_1289574 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 502 | Open in IMG/M |
| 3300017777|Ga0181357_1049642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1638 | Open in IMG/M |
| 3300017784|Ga0181348_1036517 | All Organisms → Viruses → Predicted Viral | 2049 | Open in IMG/M |
| 3300017784|Ga0181348_1212072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
| 3300017784|Ga0181348_1332041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300017785|Ga0181355_1247259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
| 3300017785|Ga0181355_1264525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
| 3300017788|Ga0169931_10243512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1477 | Open in IMG/M |
| 3300020196|Ga0194124_10134384 | All Organisms → Viruses → Predicted Viral | 1351 | Open in IMG/M |
| 3300020205|Ga0211731_11455300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300021093|Ga0194123_10081925 | All Organisms → Viruses → Predicted Viral | 1935 | Open in IMG/M |
| 3300021108|Ga0214162_1052997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
| 3300021376|Ga0194130_10018708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6004 | Open in IMG/M |
| 3300021438|Ga0213920_1082086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 627 | Open in IMG/M |
| 3300021961|Ga0222714_10532738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
| 3300021962|Ga0222713_10416575 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 823 | Open in IMG/M |
| 3300022057|Ga0212025_1065638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
| 3300022179|Ga0181353_1053596 | All Organisms → Viruses → Predicted Viral | 1052 | Open in IMG/M |
| 3300022190|Ga0181354_1124804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
| 3300022200|Ga0196901_1269686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300022407|Ga0181351_1143801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 866 | Open in IMG/M |
| 3300022747|Ga0228703_1138236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300023179|Ga0214923_10094981 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2036 | Open in IMG/M |
| 3300023179|Ga0214923_10428413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
| 3300023184|Ga0214919_10573856 | Not Available | 673 | Open in IMG/M |
| 3300023184|Ga0214919_10577081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
| 3300024536|Ga0256338_1131416 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 560 | Open in IMG/M |
| 3300024565|Ga0255273_1077991 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 761 | Open in IMG/M |
| 3300025585|Ga0208546_1008927 | All Organisms → Viruses → Predicted Viral | 2681 | Open in IMG/M |
| 3300025647|Ga0208160_1056361 | All Organisms → Viruses → Predicted Viral | 1101 | Open in IMG/M |
| 3300025872|Ga0208783_10150756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 987 | Open in IMG/M |
| 3300025889|Ga0208644_1033309 | All Organisms → Viruses → Predicted Viral | 3054 | Open in IMG/M |
| 3300027488|Ga0255084_1019639 | All Organisms → Viruses → Predicted Viral | 1316 | Open in IMG/M |
| 3300027563|Ga0209552_1091267 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 823 | Open in IMG/M |
| 3300027586|Ga0208966_1076071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 936 | Open in IMG/M |
| 3300027598|Ga0255121_1011333 | All Organisms → Viruses → Predicted Viral | 2111 | Open in IMG/M |
| 3300027608|Ga0208974_1090182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 828 | Open in IMG/M |
| 3300027642|Ga0209135_1152973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
| 3300027644|Ga0209356_1119943 | Not Available | 754 | Open in IMG/M |
| 3300027732|Ga0209442_1162854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 851 | Open in IMG/M |
| 3300027734|Ga0209087_1043369 | All Organisms → Viruses → Predicted Viral | 2088 | Open in IMG/M |
| 3300027749|Ga0209084_1205031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
| 3300027754|Ga0209596_1089196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1482 | Open in IMG/M |
| 3300027754|Ga0209596_1174277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
| 3300027756|Ga0209444_10137398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 951 | Open in IMG/M |
| 3300027777|Ga0209829_10266958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
| 3300027782|Ga0209500_10035400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2778 | Open in IMG/M |
| 3300027782|Ga0209500_10198176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 908 | Open in IMG/M |
| 3300027785|Ga0209246_10141201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 947 | Open in IMG/M |
| 3300027793|Ga0209972_10398823 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 584 | Open in IMG/M |
| 3300027797|Ga0209107_10364757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
| 3300027808|Ga0209354_10007611 | All Organisms → Viruses → Predicted Viral | 4353 | Open in IMG/M |
| 3300027816|Ga0209990_10294924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
| 3300027832|Ga0209491_10309194 | All Organisms → Viruses → Predicted Viral | 1214 | Open in IMG/M |
| 3300028286|Ga0256331_1116378 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 604 | Open in IMG/M |
| 3300028392|Ga0304729_1218392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300028393|Ga0304728_1282409 | Not Available | 544 | Open in IMG/M |
| 3300029933|Ga0119945_1007833 | All Organisms → Viruses → Predicted Viral | 1433 | Open in IMG/M |
| 3300031707|Ga0315291_11146597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
| 3300031707|Ga0315291_11150812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
| 3300031746|Ga0315293_11080668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300031758|Ga0315907_10122403 | All Organisms → Viruses → Predicted Viral | 2219 | Open in IMG/M |
| 3300031758|Ga0315907_10958796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
| 3300031787|Ga0315900_10183189 | All Organisms → Viruses → Predicted Viral | 1882 | Open in IMG/M |
| 3300031787|Ga0315900_11122388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300031857|Ga0315909_10481168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 863 | Open in IMG/M |
| 3300031951|Ga0315904_11201974 | Not Available | 582 | Open in IMG/M |
| 3300031951|Ga0315904_11348149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
| 3300031951|Ga0315904_11427455 | Not Available | 514 | Open in IMG/M |
| 3300031963|Ga0315901_10205701 | All Organisms → Viruses → Predicted Viral | 1700 | Open in IMG/M |
| 3300031963|Ga0315901_10647587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
| 3300031963|Ga0315901_10797595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
| 3300031963|Ga0315901_11063512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
| 3300031963|Ga0315901_11151033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300032018|Ga0315272_10478648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300032050|Ga0315906_11163557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300032050|Ga0315906_11165196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300032050|Ga0315906_11347249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
| 3300032050|Ga0315906_11349155 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 505 | Open in IMG/M |
| 3300032093|Ga0315902_10417896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1204 | Open in IMG/M |
| 3300032093|Ga0315902_11153968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300032116|Ga0315903_10180940 | All Organisms → Viruses → Predicted Viral | 1896 | Open in IMG/M |
| 3300032116|Ga0315903_10251939 | All Organisms → Viruses → Predicted Viral | 1525 | Open in IMG/M |
| 3300032116|Ga0315903_10981718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
| 3300032116|Ga0315903_11140916 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 531 | Open in IMG/M |
| 3300033233|Ga0334722_10852962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
| 3300033979|Ga0334978_0090123 | All Organisms → Viruses → Predicted Viral | 1562 | Open in IMG/M |
| 3300033996|Ga0334979_0249006 | All Organisms → Viruses → Predicted Viral | 1028 | Open in IMG/M |
| 3300034012|Ga0334986_0287769 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 876 | Open in IMG/M |
| 3300034018|Ga0334985_0399575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
| 3300034060|Ga0334983_0107591 | All Organisms → Viruses → Predicted Viral | 1791 | Open in IMG/M |
| 3300034061|Ga0334987_0373372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 914 | Open in IMG/M |
| 3300034062|Ga0334995_0569926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| 3300034092|Ga0335010_0022587 | All Organisms → Viruses → Predicted Viral | 4901 | Open in IMG/M |
| 3300034092|Ga0335010_0550491 | Not Available | 595 | Open in IMG/M |
| 3300034093|Ga0335012_0581322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300034102|Ga0335029_0609403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300034116|Ga0335068_0443101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300034118|Ga0335053_0759181 | Not Available | 539 | Open in IMG/M |
| 3300034120|Ga0335056_0570711 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300034121|Ga0335058_0461238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
| 3300034168|Ga0335061_0027280 | All Organisms → Viruses → Predicted Viral | 3050 | Open in IMG/M |
| 3300034200|Ga0335065_0184363 | All Organisms → Viruses → Predicted Viral | 1372 | Open in IMG/M |
| 3300034200|Ga0335065_0305855 | All Organisms → Viruses → Predicted Viral | 1002 | Open in IMG/M |
| 3300034272|Ga0335049_0823641 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 547 | Open in IMG/M |
| 3300034272|Ga0335049_0880379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300034279|Ga0335052_0353025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
| 3300034355|Ga0335039_0467597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
| 3300034356|Ga0335048_0186360 | All Organisms → Viruses → Predicted Viral | 1155 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 20.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 15.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 11.92% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 10.36% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.77% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.15% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.59% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.59% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.59% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.07% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.04% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.04% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.04% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.04% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.52% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.52% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.52% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.52% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.52% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.52% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.52% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
| 3300002298 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002471 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAY 2013 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004128 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2) | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300004764 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004768 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004786 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007304 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007321 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007860 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012754 | Freshwater microbial communities from Lake Montjoie, Canada - M_130821_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
| 3300021108 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024536 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024565 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027488 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027598 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027642 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027832 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300028286 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| 3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24028J26656_10268731 | 3300002091 | Lentic | MRTLARSVGKASIGGEPLPVPFKAFENTQIAVRRSELTMVAAVPGAGKSMLALA |
| B570J29599_10100931 | 3300002298 | Freshwater | MRTLVRSVGRASIGGEPLPSCFKSFEASKIIIRRSEVSMFAGAPGAGKSTLALAIA |
| metazooDRAFT_14731912 | 3300002471 | Lake | LKTLVRSVGRSDIGGEPLPSVFKAFENNKIILRRAEVSMLAGTPGVGKST |
| B570J40625_1006272141 | 3300002835 | Freshwater | MRTLARAVGSKDIGGEPLPTVFRTFELNKVVFRRAEISMIAGTPGA |
| B570J40625_1012211012 | 3300002835 | Freshwater | LKTLVRSVGRADIGGEPLPSVFKAFDSNKIIFRRAEVSMLAGTPGVGKSTLA |
| B570J40625_1016930832 | 3300002835 | Freshwater | MRTLTRSVGRASIGGEPLPSCFKAFESNQIVIRRSEVSMFAGA |
| JGI25909J50240_10126751 | 3300003393 | Freshwater Lake | VRTLXRSVGRSDIGGEPLPAVFKTFNTNKIVCRRAEVSMFAGVPGVGKSTLALAL |
| JGI25909J50240_10486003 | 3300003393 | Freshwater Lake | MRTLIRSVGKQDIGGEPIPTVFTTLSNNNIIFRRAEVSLVAGT |
| Ga0066177_102652193 | 3300004096 | Freshwater Lake | MKTLVRSIGRRDIGGEPLPSVFKTFESNKIIFRRAEVSML |
| Ga0066180_100345944 | 3300004128 | Freshwater Lake | MRTLVRSVGRASIGGEPLPSSFKAFEANKIIIRRSEVSMFAGAPGAGKSTLAL |
| Ga0066180_102016773 | 3300004128 | Freshwater Lake | MRTLVRSVGRASIGGEPLPSCFKSFESSKIVMRRSEVSMFAGAP |
| Ga0066223_10693212 | 3300004461 | Marine | MRTLVRSVGRADIGGEPLPSCFKTFDANKIIFRRAEVSMLAGVP |
| Ga0007754_13773641 | 3300004764 | Freshwater Lake | VRTLARAVGSKDIGGEPLPSVFRTFDVNKIVIRRAEVSMIA |
| Ga0007762_16496701 | 3300004768 | Freshwater Lake | MRTLVRSVGRASIGGEPLPSCFKSFETSKIIIRRSEVSMFAGAPGAG |
| Ga0007748_101079701 | 3300004769 | Freshwater Lake | MRTLVRSVGRASIGGEPLPSSFKAFEANKIIIRRSEVSMFAG |
| Ga0007753_10022612 | 3300004786 | Freshwater Lake | MRTLVRSVGRASIGGEPLPSCFKSFEASKIIMRRSEVSMFAGAPGAGKSTLALA |
| Ga0070374_104029891 | 3300005517 | Freshwater Lake | MRTLVRSVGRASIGGEPLPSCFKAFESNKIIIRRSEVSMFAA |
| Ga0068876_101842161 | 3300005527 | Freshwater Lake | MRTLVRSVGRASIGGEPLPSCFKSFEASKIIIRRSE |
| Ga0068876_107918512 | 3300005527 | Freshwater Lake | MRTLVRSVGKASIGGEPLPSCFKSFEASKIIIRRSEVSMFAGAPGAGKSTLALAIALKT |
| Ga0078894_111271711 | 3300005662 | Freshwater Lake | MRTLVRSVGRSSIGGEPLPSCFKAFESNKIIIRRSEVSMFA |
| Ga0075471_100960975 | 3300006641 | Aqueous | MRTLVRSVGRSDIGGEPLPAVFKTFNTNKIVCRRSEVSMFAGVPGVGKSTLALGLALKMQVP |
| Ga0075464_102247241 | 3300006805 | Aqueous | VRTLVRSVGRSDIGGEPLPSVFRSFESNKIIFRSAEVSMLAGTPGVGKSTLALALALKMK |
| Ga0075464_103787003 | 3300006805 | Aqueous | MRTLVRSVGRSDIGGEPLPAVFKTFNTNKIVCRRS |
| Ga0075477_101316981 | 3300006869 | Aqueous | MKTLARSIGRADIGGEPLPHIFKSFESNKIIFRRAEVSMLAG |
| Ga0075472_103933862 | 3300006917 | Aqueous | MRTLVRSVGSPSIGGEPLRSCFKAFESNKIIIRRSEVSMFAAA |
| Ga0075460_100722343 | 3300007234 | Aqueous | MKTLSRAVGRPDIGGEPMPTVFRTFDANQIVLRRAEVSMIAGTP |
| Ga0102689_12719721 | 3300007304 | Freshwater Lake | MRTLARAVGSKDIGGEPLPSVFRTFDVNKIVIRRAEVSMIA |
| Ga0102692_16292081 | 3300007321 | Freshwater Lake | MRTLVRSVGRASIGGEPLPSCFKAFESNKIILRRSEVSMFAAAPGV |
| Ga0099847_10992393 | 3300007540 | Aqueous | MKTLSRSVGRSDIGGEPMPSVFRTFEQNKIIFRRSEVSLI |
| Ga0102877_12413072 | 3300007548 | Estuarine | MKTLSRAVGRPDIGGEPMPTVFRTFENNQIVLRRAEVS |
| Ga0105735_10577041 | 3300007860 | Estuary Water | MRTLARAVGSKDIGGEPLPTVFRTFEVNKVVFRRAEISM |
| Ga0114340_12567941 | 3300008107 | Freshwater, Plankton | MKTLSRSVGRSDIGGEPMPSVFRTFEENKIIFRRSEVSLIAGTPGAGKSTLALALALRMQAPTLYV |
| Ga0114341_101729991 | 3300008108 | Freshwater, Plankton | MRTLVRSVGRASIGGEPLPSCFKSFEASKIIIRRSEVSMFAGAPGA |
| Ga0114341_103811133 | 3300008108 | Freshwater, Plankton | MRTLARAVGSKDIGGEPLPTVFRTFEVNKVVFRRAEISMIA |
| Ga0114346_12184103 | 3300008113 | Freshwater, Plankton | MRTLVRSVGRADIGGEPLPSVFKTFDANKIIFRRAEVSMLAGTPGVGK |
| Ga0114355_10624571 | 3300008120 | Freshwater, Plankton | MRTLVRSVGRASIGGEPLPSSFKAFEANKIIIRRSEVSMFAGAPGAGK |
| Ga0114355_10859431 | 3300008120 | Freshwater, Plankton | MRTLVRSVGRASIGGEPLPSCFKSFEASKIIIRRSEVSMFAGAPGAGKSTLALAIALKTN |
| Ga0114355_12063572 | 3300008120 | Freshwater, Plankton | LKTLVRSVGRADIGGEPLPSVFKAFDTHKIIFRRAEVSMLAGTPGVGKSTLALALALKM |
| Ga0114355_12065321 | 3300008120 | Freshwater, Plankton | MKTLVRSVGRADIGGEPLPSVFKAFDTHKIIFRRAEVSMLAGTPGVGKSTLALALALKM |
| Ga0114841_10699645 | 3300008259 | Freshwater, Plankton | MRTLVRAVGRTDIGGEPLPSVFRAFDSNKIILRRAEVSMLAGTPGVGKST |
| Ga0114841_12554842 | 3300008259 | Freshwater, Plankton | MRTLVRSVGRSDIGGEPLPSCFKTFDANKIIFRRAEVS |
| Ga0114336_12403272 | 3300008261 | Freshwater, Plankton | MKTLSRAVGRPDIGGEPMPTVFRTFDANQIVLRRAEVSMIAG |
| Ga0114337_11655442 | 3300008262 | Freshwater, Plankton | MRTLVRSVGRASIGGEPLPSCFKSFEASKIIIRRSEVSMFAGAPGAGKSTLALAKT* |
| Ga0114363_12105551 | 3300008266 | Freshwater, Plankton | VRTLVRAVGRTDIGGEPLPSVFRAFDSNKIILRRAEVSMLAG |
| Ga0114880_11552422 | 3300008450 | Freshwater Lake | MRTLVRSIGRTDIGGEPLPSVFKAFDANKIILRRAEVSMLAGTPGVGKSTL |
| Ga0105098_100602443 | 3300009081 | Freshwater Sediment | MKTLSRSIGRSDIGGEPLPPVFKVFENNKIIFRRAEVSMLAGTPGVGKSTL |
| Ga0105103_100909581 | 3300009085 | Freshwater Sediment | MRTLVRSVGRADIGGEPLPSVFRAFDNNKIILRRAEVSMLAGTPGV |
| Ga0102812_105270751 | 3300009086 | Estuarine | MRTLARAVGSKDIGGEPLPTVFRTFEVNKVVFRRAEISMIAGTPGAGKS |
| Ga0114981_105207732 | 3300009160 | Freshwater Lake | MRTLVRSVGRASIGGEPLPSCFKSFEASKIIIRRAEVSMFAGAPG |
| Ga0114970_103288461 | 3300009163 | Freshwater Lake | MRTLVRSVGRKDIGGEPLPSVFKTFESNKIIFRRAEVSMLAGTP |
| Ga0114975_102784753 | 3300009164 | Freshwater Lake | MRTLVRSVGRADIGGEPLPSVFRAFESNKIIFRRAEVSM |
| Ga0114975_103198921 | 3300009164 | Freshwater Lake | MRTLVRSVGRASIGGEPLPSCFKSFESSKIVMSRSEVSMFAGAPGVGKSTLA |
| Ga0105102_101467383 | 3300009165 | Freshwater Sediment | LRTLVRSVGRADIGGEPLPSVFKAFESNKIILRRAEVSMLAGTPGVGKSTLAL |
| Ga0105102_102567853 | 3300009165 | Freshwater Sediment | VRTLVRSVGRADIGGEPLPSVFRAFDNNKIILRRAEVSMLA |
| Ga0105102_107624762 | 3300009165 | Freshwater Sediment | VRTLARAVGSKDIGGEPLPNVFRTFEANKVVIRRAEISMIAGTPGAGK |
| Ga0105104_100717541 | 3300009168 | Freshwater Sediment | MRTLVRSVGRADIGGEPLPSVFRAFDNNKIILRRAEVSMLAGTPGVG* |
| Ga0105104_106847751 | 3300009168 | Freshwater Sediment | LRTLVRSVGRASIGGEPLPSSFKAFEQNKIIIRRSE |
| Ga0105097_101429083 | 3300009169 | Freshwater Sediment | VRTLVRSVGREDIGGEPLPSVFRAFDSNKIIIRRAEVTMLAGTPGVGKSTLALALAL |
| Ga0114976_103827441 | 3300009184 | Freshwater Lake | MRTLVRSVGRASIGGEPLPSSFKAFEQNKIIIRRSEV |
| Ga0114964_102617381 | 3300010157 | Freshwater Lake | VRTLVRSVGRADIGGEPLPSCFKTFDANKIIFRRAEVSMLAGV |
| Ga0114967_103713511 | 3300010160 | Freshwater Lake | VRTLVRSIGRADIGGEPLPSVFKALENNKIIIRRAEVSM |
| Ga0136644_104522331 | 3300010334 | Freshwater Lake | VRTLVRSVGRADIGGEPLPSCFKTFDANKIIFRRAEVSMLAGVPGVGK |
| Ga0133913_106838171 | 3300010885 | Freshwater Lake | MRTLVRSVGRASIGGEPLPSCFKAFESNKIIIRRSEVSMF |
| Ga0133913_107643247 | 3300010885 | Freshwater Lake | MKTLTRSVGRPEIGGESLPSVFRTFENNQVSLRRSELSMIAGEP |
| Ga0137575_100288413 | 3300010970 | Pond Fresh Water | MRTLVRSVGRASIGGEPLPSCFKAFAQNQIVIRRSEVSMFAAAPGA |
| Ga0139556_10736581 | 3300011011 | Freshwater | VRTLVRSVGRSDIGGEPLPAVFKTFNTNKIVCRRAEVSM |
| Ga0151620_10496164 | 3300011268 | Freshwater | MKTLSRAVGRPDIGGEPMPTVFRTFDNNQIVLRRAEVSMIAGTPGVW* |
| Ga0119951_10882062 | 3300012000 | Freshwater | MRTLARAVGSKDIGGEPLPTVFRTFEVNKVVFRRAEISMIAG |
| Ga0153805_10764382 | 3300012013 | Surface Ice | MKVKMKTLVRSIGRRDIGGEPLPSVFKTFESNKIIFRRAEVSMLAGTPGVGKSTLALALALN |
| Ga0157138_10755461 | 3300012352 | Freshwater | LKTLVRTVGRSDSGGEPLPSVFKAFDANKITPRRAEVSMFAGVPGVGKSTLSLAMALHMK |
| Ga0138278_11386701 | 3300012754 | Freshwater Lake | MRTLVRSVGRASIGGEPLPSCFKSFEASKIIIRRAEVSMFAGAPGAGKSTLALAIALKTN |
| Ga0129337_12567903 | 3300012968 | Aqueous | MKTLVRSVGRTDIGGEPLPAVFKAFENNKIIFRRAEVSMMAGTPGVGKSTLALAL |
| Ga0129337_14198233 | 3300012968 | Aqueous | MRTLARAVGSKDIGGEPLPTVFRTFDTNKVVIRRAEVSMIAG |
| Ga0164293_110481001 | 3300013004 | Freshwater | VRTLTRSVGRADIGGEPLPSVFKAFDSNKIIIRRAEVTMLAGTPGV |
| (restricted) Ga0172373_108275171 | 3300013131 | Freshwater | MRTLIRSVGRASIGGEPLPSCFKAFESNKIIIRRSEVSMFAAAPGVGKSTLALALA |
| Ga0170791_108713581 | 3300013295 | Freshwater | MRTLVRSVGRASIGGEPLPSCFKSFEASKIIIRRAEVSMFAGAPGAGKSTLAL |
| Ga0170791_120825753 | 3300013295 | Freshwater | MRTLVRSVGRADIGGEPLPSSFKTFDANKIIFRRA |
| Ga0177922_105688571 | 3300013372 | Freshwater | MKTLVRSVGRTDIGGEPLPAVFKAFESNKIIFRRAEVSMMAGTPGVGKSTLA |
| Ga0181350_11241121 | 3300017716 | Freshwater Lake | MRTLVRSVGRASIGGEPLPSCFKAFEANKIIIRRSEVSMFAGAPGAGKSTLALALALKTN |
| Ga0181347_11076803 | 3300017722 | Freshwater Lake | MRTLVRSVGKASIGGEPLPSCFKAFEANKIIIRRSEVSMFAGAP |
| Ga0181362_11129002 | 3300017723 | Freshwater Lake | MKTLSRSVGRSDIGGEPMPSVFRTFEQNKIIFRRSEVSLIAGTPGAGKSTLALALALRMQAP |
| Ga0181365_10653251 | 3300017736 | Freshwater Lake | MRTLVRSVGRASIGGEPLPSCFKAFESNKIIIRRSEVSMFAAAPGVGKST |
| Ga0181343_10534041 | 3300017766 | Freshwater Lake | MRTLARAVGSKDIGGEPLPTVFRTFDVNKIIIRRAEVSMIAG |
| Ga0181343_11151553 | 3300017766 | Freshwater Lake | MRTLIRSVGRSDIGGEPLPAVFKTFNVNKIVCRRSE |
| Ga0181358_12895741 | 3300017774 | Freshwater Lake | MKTLSRSVGRSDIGGEPMPSVFRTFEQNKIIFRRSEVSLIAGTPGAGKSTLALALALRMQAPTLYV |
| Ga0181357_10496424 | 3300017777 | Freshwater Lake | MRTLVRSVGKASIGGEPLPSCFKAFEANKIIIRRSEVSMFAGAPGAGKSTLALALALKT |
| Ga0181348_10365176 | 3300017784 | Freshwater Lake | MRTLVRSVGRASLGGEPLPSPFKAFENNQIIIRRAEVSMF |
| Ga0181348_12120721 | 3300017784 | Freshwater Lake | MRTLVRSVGRPSIGGEPLPSCFKAFEANKIIIRRSEVSM |
| Ga0181348_13320412 | 3300017784 | Freshwater Lake | MRTLVRSVGRSSIGGEPLPSCFKAFESNKIIIRRSEVSMFAAAPGVGKST |
| Ga0181355_12472591 | 3300017785 | Freshwater Lake | MRTLVRSVGRASIGGEPLPSCFKSFEASKIIMRRSEVSMFAGAPGAGKSTLALAL |
| Ga0181355_12645251 | 3300017785 | Freshwater Lake | MRTLVRSVGKASIGGEPLPSCFKAFEANKIIIRRSEVSMFAGA |
| Ga0169931_102435124 | 3300017788 | Freshwater | MRTLVRSVGRASIGGEPLPSCFKAFESNQIIIRRAEVSMFAAAP |
| Ga0194124_101343843 | 3300020196 | Freshwater Lake | MKTLSRSVGRTDIGGEPLPSVFKSFEINKIIFRRAEVSMMAGTPGIG |
| Ga0211731_114553002 | 3300020205 | Freshwater | MRTLVRSVGRASIGGEPLPSSFKAFEQNKIIIRRSEVSMFAGAPGA |
| Ga0194123_100819251 | 3300021093 | Freshwater Lake | MKTLSRSVGRTDIGGEPLPSVFKSFEINKIIFRRAEV |
| Ga0214162_10529971 | 3300021108 | Freshwater | MRTLVRSVGRASIGGEPLPSSFKAFEANKIIIRRSEVSMFAGAPGAGKSTLA |
| Ga0194130_100187081 | 3300021376 | Freshwater Lake | MRTLVRSVGRASIGGEPLPSCFRAFESNQIIIRRAEVSMFAATPGA |
| Ga0213920_10820861 | 3300021438 | Freshwater | MRTLVRSVGRADIGGEPLPSCFKTFDANKIIFRRAEVSMLAGVPGVGKSTLALALALRM |
| Ga0222714_105327381 | 3300021961 | Estuarine Water | MRTLVRAVGRTDIGGEPLPSVFRAFDSNKIILRRAEVSMLAGTPGVGKSTLALALALKMKVPS |
| Ga0222713_104165753 | 3300021962 | Estuarine Water | MRTLARAVGSKDIGGEPLPSVFRTFDVNKIVIRRAEVSMIAGTPG |
| Ga0212025_10656381 | 3300022057 | Aqueous | MKTLARSIGRADIGGEPLPHIFKSFESNKIIFRRAEVSMLAGTPGVG |
| Ga0181353_10535964 | 3300022179 | Freshwater Lake | LKTLVRSVGRADIGGEPLPSVFKAFDSNKIIFRRAEVSMLAGTPGVGKSTLALALALKI |
| Ga0181354_11248043 | 3300022190 | Freshwater Lake | MRTLVRSVGRSDIGGEPLPSVFRSFESNKIIFRRAEVSMLAGTPGVGKSTLALALALKM |
| Ga0196901_12696862 | 3300022200 | Aqueous | MKTLARSIGRADIGGEPLPHIFKSFESNKIIFRRAEVSMLAGTPGVGKS |
| Ga0181351_11438013 | 3300022407 | Freshwater Lake | VRTLVRSVGRASIGGEPLPSCFKSFETSKIIIRRSEVSMFAGAPGAGKSTLALALALN |
| Ga0228703_11382361 | 3300022747 | Freshwater | MRTLVRSVGRASIGGEPLPSCFKAFDSNKIIVRRSEVSMFAAAPGVGKSTLALAL |
| Ga0214923_100949811 | 3300023179 | Freshwater | MRTLTRAVGSKDIGGEPLPPVFRTFEANKIVIRRAEV |
| Ga0214923_104284132 | 3300023179 | Freshwater | MRTLVRSVGRASIGGEPLPSCFKAFEASKIIVRRTEV |
| Ga0214919_105738561 | 3300023184 | Freshwater | MRTLVRSVGRASIGGEPLPSCFKAFENNKIIIRRSE |
| Ga0214919_105770811 | 3300023184 | Freshwater | MRTLVRSVGRADIGGEPLPSVFRAFESNKIVFRRAEVS |
| Ga0256338_11314162 | 3300024536 | Freshwater | MRTLARAVGSADIGGEPLPSVFRTFDNNKIIFRRAEVSMIAGTPGAG |
| Ga0255273_10779911 | 3300024565 | Freshwater | MRTLARAVGRKDIGGEPLPSVFKTFDVNKVVIRRAEISMIAGTPGAGKSTLALAIALRAKVPT |
| Ga0208546_10089277 | 3300025585 | Aqueous | MRTLVRSVGRADIGGEPLPSVFKAFDNNKIIFRRAEVSMLAGT |
| Ga0208160_10563613 | 3300025647 | Aqueous | MKTLSRSVGRSDIGGEPMPSVFRTFEQNKIIFRRSEVSLIAGTPGAGKS |
| Ga0208783_101507561 | 3300025872 | Aqueous | MRTLVRSVGRSDIGGEPLPAVFKTFNTNKIVCRRSEVSMFAGVPGVGKSTLALGLAL |
| Ga0208644_10333098 | 3300025889 | Aqueous | MKTLVRSVGRTDIGGEPLPAVFKAFESNKIIFRRAEVSMMAGT |
| Ga0255084_10196394 | 3300027488 | Freshwater | MKTLARSVGRSDIGGEPLPSVFKAFETNKIIFRRAEVSMMAGTPGVGKSTLALGLALKMKVP |
| Ga0209552_10912671 | 3300027563 | Freshwater Lake | VRTLTRTIGKTESGGEPLPPVFRTFEYAQIVLRRSEVSMFAGAPGAGKSTLALALATWMKVPT |
| Ga0208966_10760711 | 3300027586 | Freshwater Lentic | VRTLLRSVGRSDIGGEPLPAVFKTFNTNKIVCRRAEVSMFAGVPGVGKSTLAL |
| Ga0255121_10113331 | 3300027598 | Freshwater | MKTLSRAVGRPDIGGEPMPTVFRTFDNNQIVLRRAEVSMIAG |
| Ga0208974_10901823 | 3300027608 | Freshwater Lentic | MKTLARSVGRSDIGGEPLPSVFKAFETNKIIFRRAEVSMMAGTPGVGKSTLALGLALKMKVPS |
| Ga0209135_11529732 | 3300027642 | Freshwater Lake | VRTLVRSVGRASIGGEPLPSCFKSFETSKIIIRRSEVSMFAGAPGAGKSTLALALA |
| Ga0209356_11199433 | 3300027644 | Freshwater Lake | MRTLIRSVGKQDIGGEPIPTVFTTLSNNNIIFRRAEVSLVAGTPGAG |
| Ga0209442_11628541 | 3300027732 | Freshwater Lake | MRTLVRSVGRASIGGEPLPSSFKAFEANKIIIRRSEVSMFAGAPGAG |
| Ga0209087_10433694 | 3300027734 | Freshwater Lake | MKTLVRSIGRRDIGGEPLPSVFKTFESNKIIFRRAEVSMLAGTPGVGKSTLALALALNMK |
| Ga0209084_12050312 | 3300027749 | Freshwater Lake | VRTLVRSVGRSDIGGEPLPAVFKTFNTNKIVCRRAEVS |
| Ga0209596_10891961 | 3300027754 | Freshwater Lake | MRTLVRSVGRPSIGGEPLPSCFKAFEANKIIIRRSEVSMFAAAP |
| Ga0209596_11742771 | 3300027754 | Freshwater Lake | MRTLVRSVGRSDIGGEPLPSVFKSFESNKIILRRAEVSM |
| Ga0209444_101373983 | 3300027756 | Freshwater Lake | MRTLVRSVGRSSIGGEPLPSCFKAFESNKIIIRRSE |
| Ga0209829_102669581 | 3300027777 | Freshwater Lake | MKTLSRSVGRPDIGGEPMPTVFRTFENNQIILRRAEVSMIAGTP |
| Ga0209500_100354001 | 3300027782 | Freshwater Lake | MRTLVRSVGRASIGGEPLPSCFKSFEASKIIIRRAEVSMFAGAPGAGKSTLALAIALKTNVPTL |
| Ga0209500_101981763 | 3300027782 | Freshwater Lake | MRTLTRSIGRADIGGEPLPSVFKSLESNKIIFRRAEVSMLAGTPGVGKSTLALA |
| Ga0209246_101412013 | 3300027785 | Freshwater Lake | MRTLVRSVGRASIGGEPLPSSFKAFEVNKIIIRRS |
| Ga0209972_103988232 | 3300027793 | Freshwater Lake | MKTLTRSVGRPEIGGEPLPFVFRTFDGNQIAIRRSEVSMIAG |
| Ga0209107_103647571 | 3300027797 | Freshwater And Sediment | MRTLVRSVGRASIGGEPLPSSFKAFEANKIIIRRSEVSMFAGAPGAGKS |
| Ga0209354_1000761110 | 3300027808 | Freshwater Lake | MRTLVRSIGRQDIGGEPLPHCFKAFESNKIIFRRAEVSMLAG |
| Ga0209990_102949241 | 3300027816 | Freshwater Lake | VRTLVRAVGRTDIGGEPLPSVFRAFDSNKIILRRA |
| Ga0209491_103091943 | 3300027832 | Freshwater | MKTLSRSIGRSDIGGEPMPAVFRVFEDSKIIFRRSEVSLIAGTPGA |
| Ga0256331_11163781 | 3300028286 | Freshwater | MRTLARAVGSADIGGEPLPSVFRTFDNNKIIFRRAEVSMIAGTPG |
| Ga0304729_12183922 | 3300028392 | Freshwater Lake | MRTLVRSVGRSDIGGEPLPSVFKSFESNKIILRRAEVSMLAGTPGVGKSTLALALALKM |
| Ga0304728_12824091 | 3300028393 | Freshwater Lake | VKTLSRSVGRPDIGGEPMPTVFRTFENNQIILRRAEVSMIAGT |
| Ga0119945_10078334 | 3300029933 | Aquatic | MRTLIRSVGKQDIGGEPIPTVFTTLATNNIIFRRAEVSLIAGTPGAGKST |
| Ga0315291_111465971 | 3300031707 | Sediment | MRTLVRSVGRASIGGEPLPSCFKAFEANKIIIRRSEVSMFA |
| Ga0315291_111508122 | 3300031707 | Sediment | MRTLVRSVGKASIGGEPLPSCFKAFEASKIVIRRSEVSMF |
| Ga0315293_110806682 | 3300031746 | Sediment | MRTLVRSVRRASIGGEPLPSCFKSFESSKIVMRRSEVSMFAG |
| Ga0315907_101224031 | 3300031758 | Freshwater | MRTLVRSVGRASIGGEPLPSCFKAFESNKIIIRRSEVSMFAAAPG |
| Ga0315907_109587961 | 3300031758 | Freshwater | MRTLVRSVGRASIGGEPLPSCFKAFESNKIIIRRSEVSMFA |
| Ga0315900_101831896 | 3300031787 | Freshwater | VRTLVRAVGRTDIGGEPLPSVFRAFDSNKIILRRAEVSMLAGT |
| Ga0315900_111223881 | 3300031787 | Freshwater | MRTLVRSVGRSDIGGEPLPSCFKTFDANKIIFRRAEVSMLAGVPGVGKSTLALA |
| Ga0315909_104811682 | 3300031857 | Freshwater | MRTLVRSIGRTDIGGEPLPSVFKAFDANKIILRRAEVSMLAGTPGVGKSTLALAL |
| Ga0315904_112019743 | 3300031951 | Freshwater | MRTLVRSVGRQDIGGEPLPSCFKTFDANKIIFRRSEVSMLAGTPGVGKSTLAIALALK |
| Ga0315904_113481491 | 3300031951 | Freshwater | LRTLVRSVGRPSIGGEPLPSCFKAFESNKIILRRSEVSMFAAAPGVG |
| Ga0315904_114274553 | 3300031951 | Freshwater | VRTLVRAVGRTDIGGEPLPSVFRAFDSNKIILRRAEVSMLAGTPGVGKSTLALALALKMK |
| Ga0315901_102057011 | 3300031963 | Freshwater | MRTLVRSVGRKDIGGEPLPSVFKTFESNKIIFRRAEVSMLAGTPGVGKSTLALALALNMK |
| Ga0315901_106475873 | 3300031963 | Freshwater | MRTLVRSVGRASIGGEPLPSCFKAFESNKIIIRRSEVSMFAAAPGVGKSTLA |
| Ga0315901_107975952 | 3300031963 | Freshwater | MRTLVRSVGRSDIGGEPLPSVFRAFESNKIILRRAEVSMLAGTPGV |
| Ga0315901_110635121 | 3300031963 | Freshwater | MRTLVRSVGRASIGGEPLPSCFKSFEASKIIIRRSEVSMFA |
| Ga0315901_111510331 | 3300031963 | Freshwater | MRTLVRSVGRSDIGGEPLPAVFKTFNTNKIVCRRSEVSMFAGVPGVGKS |
| Ga0315272_104786481 | 3300032018 | Sediment | MRTLVRSVGRASIGGEPLPSCFKSFESSKIVMRRSEVSMF |
| Ga0315906_111635573 | 3300032050 | Freshwater | VRTLVRAVGRTDIGGEPLPSVFRAFDSNKIILRRAEVSM |
| Ga0315906_111651962 | 3300032050 | Freshwater | MRTLVRSVGRASIGGEPLPSCFKAFDSNKIIVRRSEVSMF |
| Ga0315906_113472491 | 3300032050 | Freshwater | MRTLVRSVGRQDIGGEPLPSCFKTFDNNKIIFRRSEVSMLAGTPG |
| Ga0315906_113491551 | 3300032050 | Freshwater | MKTLSRSVGRSDIGGEPMPSVFRTFEENKIIFRRSEVSLIAGTPGAGKSTLALALALR |
| Ga0315902_104178961 | 3300032093 | Freshwater | MRTLVRSVGRKDIGGEPLPSVFKTFESNKIIFRRAEVSMLAGTPGVGKSTLALALAL |
| Ga0315902_111539681 | 3300032093 | Freshwater | VRTLVRAVGRTDIGGEPLPSVFRAFDSNKIILRRAEV |
| Ga0315903_101809401 | 3300032116 | Freshwater | MRTLVRSVGRTSIGGEPLPSCFKAFEASKIIIRRSEVSMFAGAPGVGKSTLALA |
| Ga0315903_102519391 | 3300032116 | Freshwater | MKTLSRSVGRSDIGGEPMPSVFRTFEENKIIFRRSEVSLIA |
| Ga0315903_109817182 | 3300032116 | Freshwater | VRTLVRAVGRTDIGGEPLPSVFRAFDSNKIILRRAEVSMLA |
| Ga0315903_111409162 | 3300032116 | Freshwater | MRTLARAVGSVDIGGEPLPSVFRTFDANKVVIRRSEISMIAGTPGAGK |
| Ga0334722_108529622 | 3300033233 | Sediment | MRTLVRSVGRASIGGEPLPSCFKAFEANKIIIRRSEVSMFAG |
| Ga0334978_0090123_1427_1561 | 3300033979 | Freshwater | MRTLVRSVGRASIGGEPLPSCFKAFDSNKIIVRRSEVSMFAAAPG |
| Ga0334979_0249006_3_146 | 3300033996 | Freshwater | MKTLARSVGRSDIGGEPLPSVFKAFETNKIIFRRAEVSMMAGTPGVGK |
| Ga0334986_0287769_1_126 | 3300034012 | Freshwater | MRTLARAVGGKDIGGEPLPSVFRTFDVNKIVIRRSEVSMIAG |
| Ga0334985_0399575_2_181 | 3300034018 | Freshwater | MRTLVRSVGRASIGGEPLPSSFRAFEQNKIIIRRSEVSMFAGAPGAGKSTLALALALKTN |
| Ga0334983_0107591_3_185 | 3300034060 | Freshwater | MKTLSRSVGRSDIGGEPMPPVFRTFEQNKIIFRRSEVSLIAGTPGAGKSTLALALALRMQ |
| Ga0334987_0373372_1_144 | 3300034061 | Freshwater | MRTLIRSVGKQDIGGEPIPTVFTTLATNNIVFRRAEVSLVAGTPGAGK |
| Ga0334995_0569926_1_168 | 3300034062 | Freshwater | MRTLVRSVGRASIGGEPLPSCFKSFEASKIIIRRAEVSMFAGAPGAGKSTLALAIA |
| Ga0335010_0022587_4785_4901 | 3300034092 | Freshwater | MRTLVRSVGRADIGGEPLPSVFRAFESNKIVFRRAEVSM |
| Ga0335010_0550491_1_153 | 3300034092 | Freshwater | MRTLIRSVGKQDIGGEPIPTVFTTLSNNNIIFRRAEVSLVAGTPGAGKSTL |
| Ga0335012_0581322_1_156 | 3300034093 | Freshwater | MRTLVRSVGRADIGGEPLPSVFRAFENNKIILRRAEVSMLAGTPGVGKSTLA |
| Ga0335029_0609403_3_125 | 3300034102 | Freshwater | MRTLTRSVGRASIGGEPLPSCFKAFESNKIIIRRSEVSMFA |
| Ga0335068_0443101_444_611 | 3300034116 | Freshwater | MKTLARSVGRTDIGGEPLPAVFKAFETNKIIFRRAEVSMMAGTPGVGKSTLALGLA |
| Ga0335053_0759181_360_539 | 3300034118 | Freshwater | MRTLVRSVGRADIGGEPLPSVFRAFDNNKIILRRAEVSMLAGTPGVGKSTLALALALKMK |
| Ga0335056_0570711_1_144 | 3300034120 | Freshwater | MRTLIRSVGRASIGGEPLPSCFKAFESNKIIIRRSEVSMFAAAPGVGK |
| Ga0335058_0461238_1_123 | 3300034121 | Freshwater | MKTLARSVGRSDIGGEPLPSVFKAFETNKIIFRRAEVSMMA |
| Ga0335061_0027280_2_106 | 3300034168 | Freshwater | MKTLSRSVGRPDIGGEPLPPVFRTFDNNQIILRRA |
| Ga0335065_0184363_2_193 | 3300034200 | Freshwater | MRTLTRTIGKTESGGEPLPPVFRTFEHSQIVLRRSEVSMFAGAPGAGKSTLALALATWMKVPTL |
| Ga0335065_0305855_2_163 | 3300034200 | Freshwater | MKTLGRSVGRKDIGGEPMLPVFRAFENNQVVFRRSEVSVIAAQPGAGKSTLALA |
| Ga0335049_0823641_437_547 | 3300034272 | Freshwater | MRTLARAVGSKDIGGEPLPTVFRTFDVNKIVIRRAEV |
| Ga0335049_0880379_369_521 | 3300034272 | Freshwater | MRTLVRSVGRASIGGEPLPSCFKAFESNKIIIRRSEVSMFAAAPGVGKSTL |
| Ga0335052_0353025_1_150 | 3300034279 | Freshwater | MRTLIRSVGRASIGGEPLPSCFKAFESNKIIIRRSEVSMFAAAPGVGKST |
| Ga0335039_0467597_522_635 | 3300034355 | Freshwater | MKTLARSVGRSDIGGEPLPSVFKAFETNKIIFRRAEVS |
| Ga0335048_0186360_1022_1153 | 3300034356 | Freshwater | MRTLVRSVGRASIGGEPLPSCFKAFEANKIIIRRSEVSMFAGAP |
| ⦗Top⦘ |