| Basic Information | |
|---|---|
| Family ID | F027782 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 193 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MTKTEQLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFP |
| Number of Associated Samples | 135 |
| Number of Associated Scaffolds | 193 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 48.70 % |
| % of genes near scaffold ends (potentially truncated) | 99.48 % |
| % of genes from short scaffolds (< 2000 bps) | 82.38 % |
| Associated GOLD sequencing projects | 126 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (100.000 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (24.870 % of family members) |
| Environment Ontology (ENVO) | Unclassified (79.275 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (70.466 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.48% β-sheet: 0.00% Coil/Unstructured: 53.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 193 Family Scaffolds |
|---|---|---|
| PF09250 | Prim-Pol | 9.33 |
| PF12850 | Metallophos_2 | 2.59 |
| PF03406 | Phage_fiber_2 | 1.55 |
| PF03354 | TerL_ATPase | 0.52 |
| PF16778 | Phage_tail_APC | 0.52 |
| PF00145 | DNA_methylase | 0.52 |
| PF04586 | Peptidase_S78 | 0.52 |
| PF05065 | Phage_capsid | 0.52 |
| PF09636 | XkdW | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 193 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.52 |
| COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.52 |
| COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.52 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002277|B570J29592_105399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
| 3300002294|B570J29584_1000401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4892 | Open in IMG/M |
| 3300002296|B570J29587_1001526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2174 | Open in IMG/M |
| 3300002408|B570J29032_109030615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
| 3300002408|B570J29032_109034203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300003488|JGI25919J51413_1014222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
| 3300004805|Ga0007792_10204612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
| 3300005517|Ga0070374_10082735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1673 | Open in IMG/M |
| 3300005517|Ga0070374_10356359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
| 3300005517|Ga0070374_10678357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
| 3300005581|Ga0049081_10119533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 975 | Open in IMG/M |
| 3300005582|Ga0049080_10063935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1264 | Open in IMG/M |
| 3300005662|Ga0078894_10765852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
| 3300006802|Ga0070749_10219867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1083 | Open in IMG/M |
| 3300006805|Ga0075464_10198175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1192 | Open in IMG/M |
| 3300006805|Ga0075464_10951949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300007559|Ga0102828_1139304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
| 3300008114|Ga0114347_1195767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
| 3300008259|Ga0114841_1038826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6271 | Open in IMG/M |
| 3300008263|Ga0114349_1029173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2759 | Open in IMG/M |
| 3300008266|Ga0114363_1006474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6434 | Open in IMG/M |
| 3300008266|Ga0114363_1105508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1475 | Open in IMG/M |
| 3300008266|Ga0114363_1117319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 930 | Open in IMG/M |
| 3300008266|Ga0114363_1126054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
| 3300008450|Ga0114880_1091072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1197 | Open in IMG/M |
| 3300008450|Ga0114880_1095515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1159 | Open in IMG/M |
| 3300008450|Ga0114880_1181627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
| 3300008450|Ga0114880_1274180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
| 3300009026|Ga0102829_1279590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
| 3300009068|Ga0114973_10439114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
| 3300009152|Ga0114980_10068881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2131 | Open in IMG/M |
| 3300009152|Ga0114980_10096125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1773 | Open in IMG/M |
| 3300009152|Ga0114980_10118761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1576 | Open in IMG/M |
| 3300009154|Ga0114963_10038000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3141 | Open in IMG/M |
| 3300009155|Ga0114968_10485069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
| 3300009155|Ga0114968_10545387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
| 3300009155|Ga0114968_10564686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
| 3300009158|Ga0114977_10027968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3534 | Open in IMG/M |
| 3300009158|Ga0114977_10393893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
| 3300009159|Ga0114978_10033756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3637 | Open in IMG/M |
| 3300009159|Ga0114978_10081215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2169 | Open in IMG/M |
| 3300009159|Ga0114978_10202028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1255 | Open in IMG/M |
| 3300009159|Ga0114978_10501404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
| 3300009159|Ga0114978_10752127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300009163|Ga0114970_10463059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
| 3300009163|Ga0114970_10747178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300009164|Ga0114975_10541823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
| 3300009168|Ga0105104_10506805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
| 3300009180|Ga0114979_10144189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1459 | Open in IMG/M |
| 3300009180|Ga0114979_10303437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 948 | Open in IMG/M |
| 3300009180|Ga0114979_10372416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 839 | Open in IMG/M |
| 3300009181|Ga0114969_10715537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300009183|Ga0114974_10048445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2859 | Open in IMG/M |
| 3300009183|Ga0114974_10449702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
| 3300009183|Ga0114974_10600979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
| 3300009184|Ga0114976_10179751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1173 | Open in IMG/M |
| 3300010158|Ga0114960_10004832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10000 | Open in IMG/M |
| 3300010160|Ga0114967_10104602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1640 | Open in IMG/M |
| 3300010354|Ga0129333_10167349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2011 | Open in IMG/M |
| 3300010885|Ga0133913_11172605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1972 | Open in IMG/M |
| 3300010885|Ga0133913_13107386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1102 | Open in IMG/M |
| 3300010885|Ga0133913_13504233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1023 | Open in IMG/M |
| 3300012725|Ga0157610_1211363 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| 3300012772|Ga0138287_1298600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
| 3300013004|Ga0164293_10106167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2147 | Open in IMG/M |
| 3300013005|Ga0164292_10994355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300013014|Ga0164295_11307575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300013295|Ga0170791_15776310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
| 3300013372|Ga0177922_10468965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 726 | Open in IMG/M |
| 3300013372|Ga0177922_11308542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
| 3300015050|Ga0181338_1048820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300017701|Ga0181364_1026435 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 945 | Open in IMG/M |
| 3300017701|Ga0181364_1076768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
| 3300017716|Ga0181350_1026743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1599 | Open in IMG/M |
| 3300017716|Ga0181350_1064898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 946 | Open in IMG/M |
| 3300017722|Ga0181347_1132009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
| 3300017723|Ga0181362_1048838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
| 3300017723|Ga0181362_1083745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
| 3300017736|Ga0181365_1114176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
| 3300017761|Ga0181356_1169762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| 3300017761|Ga0181356_1208406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
| 3300017774|Ga0181358_1098491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1050 | Open in IMG/M |
| 3300017774|Ga0181358_1152401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
| 3300017777|Ga0181357_1214488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
| 3300017777|Ga0181357_1266840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
| 3300017778|Ga0181349_1053399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1580 | Open in IMG/M |
| 3300017780|Ga0181346_1296205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
| 3300017784|Ga0181348_1259064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300019784|Ga0181359_1041347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1785 | Open in IMG/M |
| 3300019784|Ga0181359_1088207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1153 | Open in IMG/M |
| 3300019784|Ga0181359_1156215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
| 3300020159|Ga0211734_10677808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300020161|Ga0211726_10164683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
| 3300020161|Ga0211726_10165384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2153 | Open in IMG/M |
| 3300020183|Ga0194115_10362980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| 3300020501|Ga0208590_1017935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 833 | Open in IMG/M |
| 3300020515|Ga0208234_1035072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300020537|Ga0208722_1050936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300020553|Ga0208855_1017327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1092 | Open in IMG/M |
| 3300020571|Ga0208723_1038657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
| 3300020573|Ga0208485_1016771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1549 | Open in IMG/M |
| 3300021340|Ga0194041_10095593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 926 | Open in IMG/M |
| 3300021956|Ga0213922_1075247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
| 3300022179|Ga0181353_1081586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 816 | Open in IMG/M |
| 3300022190|Ga0181354_1019826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2120 | Open in IMG/M |
| 3300022190|Ga0181354_1038330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1584 | Open in IMG/M |
| 3300022190|Ga0181354_1067524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1187 | Open in IMG/M |
| 3300022190|Ga0181354_1182343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
| 3300022407|Ga0181351_1073133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1383 | Open in IMG/M |
| 3300022407|Ga0181351_1108978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1057 | Open in IMG/M |
| 3300022407|Ga0181351_1120482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 984 | Open in IMG/M |
| 3300022407|Ga0181351_1259834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
| 3300022752|Ga0214917_10350857 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
| 3300025646|Ga0208161_1076482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 981 | Open in IMG/M |
| 3300025896|Ga0208916_10072774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1432 | Open in IMG/M |
| 3300027135|Ga0255073_1037041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
| 3300027138|Ga0255064_1037352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
| 3300027139|Ga0255082_1033868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
| 3300027563|Ga0209552_1182608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300027581|Ga0209651_1024826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1869 | Open in IMG/M |
| 3300027621|Ga0208951_1064606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1042 | Open in IMG/M |
| 3300027644|Ga0209356_1070415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1056 | Open in IMG/M |
| 3300027659|Ga0208975_1049601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1292 | Open in IMG/M |
| 3300027679|Ga0209769_1143983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
| 3300027733|Ga0209297_1016560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3539 | Open in IMG/M |
| 3300027741|Ga0209085_1003419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8718 | Open in IMG/M |
| 3300027746|Ga0209597_1124737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1130 | Open in IMG/M |
| 3300027759|Ga0209296_1004767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8817 | Open in IMG/M |
| 3300027782|Ga0209500_10176512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 983 | Open in IMG/M |
| 3300027785|Ga0209246_10214479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
| 3300027785|Ga0209246_10334126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
| 3300027797|Ga0209107_10115307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1417 | Open in IMG/M |
| 3300027798|Ga0209353_10048037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1965 | Open in IMG/M |
| 3300027798|Ga0209353_10072677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1564 | Open in IMG/M |
| 3300027798|Ga0209353_10106036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1267 | Open in IMG/M |
| 3300027798|Ga0209353_10457966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300027804|Ga0209358_10176008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1125 | Open in IMG/M |
| 3300027808|Ga0209354_10027210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2283 | Open in IMG/M |
| 3300027892|Ga0209550_10254983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1156 | Open in IMG/M |
| 3300027971|Ga0209401_1050676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1884 | Open in IMG/M |
| 3300027972|Ga0209079_10047615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1445 | Open in IMG/M |
| 3300027974|Ga0209299_1016955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3345 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1030600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3416 | Open in IMG/M |
| 3300028025|Ga0247723_1050449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1193 | Open in IMG/M |
| 3300028392|Ga0304729_1087113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1086 | Open in IMG/M |
| (restricted) 3300028559|Ga0247831_1286538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| (restricted) 3300029268|Ga0247842_10125540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1525 | Open in IMG/M |
| 3300031707|Ga0315291_10601898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 997 | Open in IMG/M |
| 3300031772|Ga0315288_10686734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 968 | Open in IMG/M |
| 3300031787|Ga0315900_10009619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12223 | Open in IMG/M |
| 3300031787|Ga0315900_10048602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4498 | Open in IMG/M |
| 3300031857|Ga0315909_10007375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12285 | Open in IMG/M |
| 3300031857|Ga0315909_10066942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3233 | Open in IMG/M |
| 3300031857|Ga0315909_10140095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2011 | Open in IMG/M |
| 3300031951|Ga0315904_10172754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2158 | Open in IMG/M |
| 3300031951|Ga0315904_10187535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2045 | Open in IMG/M |
| 3300031951|Ga0315904_10969239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
| 3300031963|Ga0315901_10167423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1939 | Open in IMG/M |
| 3300032093|Ga0315902_10070421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3915 | Open in IMG/M |
| 3300032116|Ga0315903_10522608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 931 | Open in IMG/M |
| 3300033816|Ga0334980_0296231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
| 3300033981|Ga0334982_0132421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1285 | Open in IMG/M |
| 3300033992|Ga0334992_0072538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1893 | Open in IMG/M |
| 3300033993|Ga0334994_0587016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300033995|Ga0335003_0238020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 849 | Open in IMG/M |
| 3300034021|Ga0335004_0635697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
| 3300034061|Ga0334987_0214619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1341 | Open in IMG/M |
| 3300034061|Ga0334987_0335434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 985 | Open in IMG/M |
| 3300034062|Ga0334995_0668049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| 3300034066|Ga0335019_0380753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 867 | Open in IMG/M |
| 3300034072|Ga0310127_094247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1309 | Open in IMG/M |
| 3300034082|Ga0335020_0081374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1664 | Open in IMG/M |
| 3300034092|Ga0335010_0077059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2288 | Open in IMG/M |
| 3300034092|Ga0335010_0108774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1829 | Open in IMG/M |
| 3300034092|Ga0335010_0294215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 935 | Open in IMG/M |
| 3300034095|Ga0335022_0369934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
| 3300034101|Ga0335027_0452034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
| 3300034101|Ga0335027_0549359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
| 3300034101|Ga0335027_0622801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
| 3300034104|Ga0335031_0842128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300034106|Ga0335036_0005470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10714 | Open in IMG/M |
| 3300034106|Ga0335036_0125274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1857 | Open in IMG/M |
| 3300034109|Ga0335051_0128998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1300 | Open in IMG/M |
| 3300034111|Ga0335063_0457315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
| 3300034118|Ga0335053_0444629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300034120|Ga0335056_0169021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1284 | Open in IMG/M |
| 3300034120|Ga0335056_0381099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
| 3300034122|Ga0335060_0594939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300034166|Ga0335016_0377325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 837 | Open in IMG/M |
| 3300034200|Ga0335065_0773287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300034283|Ga0335007_0698670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| 3300034284|Ga0335013_0018045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5307 | Open in IMG/M |
| 3300034356|Ga0335048_0055742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2528 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 24.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 20.73% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 20.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.70% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.63% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.59% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.59% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.59% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.07% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.55% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.04% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.04% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.04% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.52% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.52% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.52% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.52% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002277 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002294 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002296 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003488 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN | Environmental | Open in IMG/M |
| 3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012725 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012772 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020501 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020515 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020537 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020571 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020573 | Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021340 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-9m | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027135 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8h | Environmental | Open in IMG/M |
| 3300027138 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300027139 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
| 3300029268 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19m | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29592_1053991 | 3300002277 | Freshwater | MKSLIMTKTEQLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDF |
| B570J29584_10004011 | 3300002294 | Freshwater | MKSLTMTKTEQLLDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITP |
| B570J29587_10015261 | 3300002296 | Freshwater | MKSLTMTKTEQLLDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLD |
| B570J29032_1090306151 | 3300002408 | Freshwater | MTTTSEQLFDHVTETIHQRGAKYGHPYPQHKRIAELWS |
| B570J29032_1090342032 | 3300002408 | Freshwater | MKSLIMTKTEQLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFP |
| JGI25919J51413_10142221 | 3300003488 | Freshwater Lake | MSTTTEQLFDNVIKTIHERGVRYGHPITNHKRIAELWSAYL |
| Ga0007792_102046121 | 3300004805 | Freshwater | MPTTTEKLFDEVVSTIQERGAVYGHPAINHKRIADLWSAYLDY |
| Ga0070374_100827351 | 3300005517 | Freshwater Lake | MSTTTEQLFDNVIKTIHERGVRYGHPITNHKRIAELWSAYLGYPIQPNEAA |
| Ga0070374_103563591 | 3300005517 | Freshwater Lake | MTKTEKLFDEVIKTIHARGESYGHPYYNHKRIAELWSAYIGYP |
| Ga0070374_106783573 | 3300005517 | Freshwater Lake | MTKTEKLFDEVIKTIHARGESYGHPYYNHKRIAELWSAYIGYPLQ |
| Ga0049081_101195333 | 3300005581 | Freshwater Lentic | MTNTEKLFDNVIKTIHERGVRYGHPITNHKRIAELWSAYLGYPIQP |
| Ga0049080_100639351 | 3300005582 | Freshwater Lentic | MKFLIMTKTEQLFANVIDTIHSRGANYGHPIGNHKRIAELWSAYLGYPIQPN |
| Ga0078894_107658523 | 3300005662 | Freshwater Lake | MTTTTEKLFNDIASIIHERGAIYGHPYYNHKRISELWSAYL |
| Ga0070749_102198673 | 3300006802 | Aqueous | MPTTTEQLLDNVVKTIHARGLNYGHPITNHKRIAELW |
| Ga0075464_101981751 | 3300006805 | Aqueous | MPTTTEKLFSEVISTIQERGAVYGHPAINHKRIADLWSAYLDYPIQPHQAALC |
| Ga0075464_109519492 | 3300006805 | Aqueous | MPSEIKYLTMTKTESLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQAAL |
| Ga0102828_11393043 | 3300007559 | Estuarine | MSTTTEKLFDNVIKTIHARGISYGHPITNHKRIAELWSAYIGYPIQPNE |
| Ga0114347_11957671 | 3300008114 | Freshwater, Plankton | MTKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYLDFPIT |
| Ga0114841_10388267 | 3300008259 | Freshwater, Plankton | MTKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYLDFPITPHQAA* |
| Ga0114349_10291731 | 3300008263 | Freshwater, Plankton | MTKTEDLLNEVIATIQERGSVYGHPYYNHKRIAGLWSAYLDFPIT |
| Ga0114363_10064741 | 3300008266 | Freshwater, Plankton | MTKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYLDYPI |
| Ga0114363_11055081 | 3300008266 | Freshwater, Plankton | MTKTEQLFANVIDTLHRRGANYGHPIANHKRIAELWS |
| Ga0114363_11173191 | 3300008266 | Freshwater, Plankton | MTKTEQLFDEAITTIQSRGVVYGHPYYNMERISKL |
| Ga0114363_11260541 | 3300008266 | Freshwater, Plankton | MTKTEDLLNEVIATIQERGSVYGHPYYNHKRIAGLWSAYLDYPITPHQAA |
| Ga0114880_10910723 | 3300008450 | Freshwater Lake | MTKTEDLLNEVIATIQERGSVYGHPYYNHKRIAGLW |
| Ga0114880_10955154 | 3300008450 | Freshwater Lake | MTKTEDLLNEVISTIQERGSVYGHPYYNHKRIAGLWSAYLDFPITPHQAA |
| Ga0114880_11816273 | 3300008450 | Freshwater Lake | MTKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYLDYPIT |
| Ga0114880_12741801 | 3300008450 | Freshwater Lake | MTTTSEQLFDHVTETIHQRGAKYGHPYPQHKRIAELWSAY |
| Ga0102829_12795901 | 3300009026 | Estuarine | MTKTEQLFEEVIQILHSRGSQYGHPIGNHKRIAELWSAYLGYPIQPNEVAIL |
| Ga0114973_104391143 | 3300009068 | Freshwater Lake | MSTTTEQLFDNVVKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQPN |
| Ga0114980_100688811 | 3300009152 | Freshwater Lake | MSTTTEKLFDNVIKTIHARGVSYGHPISQHKRIAELWSAYLGYP |
| Ga0114980_100961251 | 3300009152 | Freshwater Lake | MPTTTEKLFANVVKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQPNEVA |
| Ga0114980_101187615 | 3300009152 | Freshwater Lake | MSTTTEQLFDNVVKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQPNEVA |
| Ga0114963_100380009 | 3300009154 | Freshwater Lake | MPTTTEKLFSEVISTIQERGAVYGHPAINHKRIADLWSAYL |
| Ga0114968_104850691 | 3300009155 | Freshwater Lake | MTTTTEQLFDNVIKTIHARGVSYGHPITNHKRIAE |
| Ga0114968_105453871 | 3300009155 | Freshwater Lake | MPTTTEKLFDNVIKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQPNEVAIC |
| Ga0114968_105646863 | 3300009155 | Freshwater Lake | MPTTTEQLFDNVVKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQPNE |
| Ga0114977_100279681 | 3300009158 | Freshwater Lake | MTKTEQLFNEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQA |
| Ga0114977_103938933 | 3300009158 | Freshwater Lake | MSTTTEKLFDNVIKTIHARGVRYGHPITNHKRIAELWSAYLGYPIQPN |
| Ga0114978_1003375610 | 3300009159 | Freshwater Lake | MSTTTEQLFDNVVKTIHARGVSYGHPISQHKRIAELWS |
| Ga0114978_100812151 | 3300009159 | Freshwater Lake | MTRTEQLFAHVIETLHSRGAHYGHPIGNHKRIAELWSAYLGYPIQPNEVAICM |
| Ga0114978_102020283 | 3300009159 | Freshwater Lake | MTKTESLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQ |
| Ga0114978_105014041 | 3300009159 | Freshwater Lake | MTRTEKLFEQVIDTLHSRGADYGHPITNHKRIAELWSA |
| Ga0114978_107521271 | 3300009159 | Freshwater Lake | MPTTTEQLLDNVVKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQPNEV |
| Ga0114970_104630593 | 3300009163 | Freshwater Lake | MSTTTEQLFDNVIKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQPNEVAIC |
| Ga0114970_107471782 | 3300009163 | Freshwater Lake | MPTTTEKLFDNVVKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQPNEVAIC |
| Ga0114975_105418231 | 3300009164 | Freshwater Lake | MPTSTEKLFANVIDTLHSRGADYGHPIGNHKRIAELWSAYL |
| Ga0105104_105068053 | 3300009168 | Freshwater Sediment | MTKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYLDY |
| Ga0114979_101441891 | 3300009180 | Freshwater Lake | MTKTEQLFNEVITTIQQRGSVYGHPYYNHKRIAGLWSAY |
| Ga0114979_103034374 | 3300009180 | Freshwater Lake | MPTTTEQLLDNVVKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQ |
| Ga0114979_103724161 | 3300009180 | Freshwater Lake | MPTTTEKLFDNVVKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQPN |
| Ga0114969_107155371 | 3300009181 | Freshwater Lake | MPTTTEQLFSETVEILHSRGTQYGHPISNHKRIAELWSAYLGYPIQPN |
| Ga0114974_100484451 | 3300009183 | Freshwater Lake | MTKTESLFDEVITTIQQRGSVYGHPYYNHKRIAGLWS |
| Ga0114974_104497023 | 3300009183 | Freshwater Lake | MSTTTEQLFDNVIKTIHERGVRYGHPITNHKRIAELWSAYLGYP |
| Ga0114974_106009791 | 3300009183 | Freshwater Lake | MTKTEKLLADVVDLVHTRGSVYGHPYTNHKRISDLWSAYLDHPITPSQV |
| Ga0114976_101797511 | 3300009184 | Freshwater Lake | MPTTTEQLFDNVIKTIHERGVRYGHPITNHKRIAELWSAYLGYPIQPN |
| Ga0114960_1000483222 | 3300010158 | Freshwater Lake | MPTTTEKLFSEVISTIQERGAVYGHPAINHKRIADLWS |
| Ga0114967_101046025 | 3300010160 | Freshwater Lake | MPTTTEKLFDEVIDILHSRGTQYGHPISNHKRIAELWSAYLGYPIQPN |
| Ga0129333_101673496 | 3300010354 | Freshwater To Marine Saline Gradient | MTKTEQLFANVIDTLHRRGADYGHPIGNHKRIAELWSAYLGYPIQPNE |
| Ga0133913_111726051 | 3300010885 | Freshwater Lake | MPTNTEQLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQA |
| Ga0133913_131073863 | 3300010885 | Freshwater Lake | MTKTEQLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQAAL |
| Ga0133913_135042331 | 3300010885 | Freshwater Lake | MTKTEQLLDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQ |
| Ga0157610_12113631 | 3300012725 | Freshwater | MTKTEDLLNEVIATIQDRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQ |
| Ga0138287_12986003 | 3300012772 | Freshwater Lake | MPTNTEQLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQAA |
| Ga0164293_101061677 | 3300013004 | Freshwater | MTKTEDLLNEVIATIQERGSVYGHPYYNHKRIAGLWSAYLDFPITPHQ |
| Ga0164292_109943553 | 3300013005 | Freshwater | MTKTEQLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQAA |
| Ga0164295_113075751 | 3300013014 | Freshwater | MSTTTEQLFNNVIKTIHERGISYGHPITNHKRIAELWSAYLG |
| Ga0170791_157763101 | 3300013295 | Freshwater | MTKTETLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPIT |
| Ga0177922_104689651 | 3300013372 | Freshwater | MSTTTEQLFDNVIKTIHERGISYGHPITNHKRIAELWSAYLGYPIQPNEV |
| Ga0177922_113085421 | 3300013372 | Freshwater | MTKTEDLLNEVITTIQERGSVYGHPYYNHQRIAGLWSAYLDHPITAHQAALC |
| Ga0181338_10488201 | 3300015050 | Freshwater Lake | MTKTEKLFDEVVKTIHARGESYGHPYYNHKRIAELWSAYIGYPLQPNQL |
| Ga0181364_10264354 | 3300017701 | Freshwater Lake | MTKTEKLFDEVIKTIHARGESYGHPYYNHKRIAEFFS |
| Ga0181364_10767681 | 3300017701 | Freshwater Lake | MTKTEKLFDEVIKTIHARGESYGHPYYNHKRIAELWSAYIGYPLQPNQ |
| Ga0181350_10267431 | 3300017716 | Freshwater Lake | MANLMSTTTEKLFDNVIKTIHARGVSYGHPITNHKRIAELWSAYLGYP |
| Ga0181350_10648984 | 3300017716 | Freshwater Lake | MTKTEKLFDEVIKTIHARGESYGHPYYNHKRIAELWSAYTGYPL |
| Ga0181347_11320091 | 3300017722 | Freshwater Lake | MSTTTEKLFDNVVKTIHARGVSYGHPITNHKRIAELWSAYLGYPIQ |
| Ga0181362_10488383 | 3300017723 | Freshwater Lake | MRYLTMTKTEKLFDEVIKTIHSRGESYGHPYYNHK |
| Ga0181362_10837451 | 3300017723 | Freshwater Lake | MANLMSTTTEKLFDNVIKTIHARGVSYGHPITNHKRIAELWSAYL |
| Ga0181365_11141763 | 3300017736 | Freshwater Lake | MPTTTEKLFDEVVSILHSRGTQYGHPISNHKRIAELWSLQIG |
| Ga0181356_11697623 | 3300017761 | Freshwater Lake | MTKTEKLFDEVIKTIHARGESYGHPYYNHKRIAELWSAYIGYPLQP |
| Ga0181356_12084061 | 3300017761 | Freshwater Lake | MTKTEKLFDEVIKTIHARGESYGHPYYNHKRIAELWSAYIG |
| Ga0181358_10984911 | 3300017774 | Freshwater Lake | MTKTEQLFEEVIQILHSRGSQYGHPIGNHKRIAELWSAYLGYPIQ |
| Ga0181358_11524013 | 3300017774 | Freshwater Lake | MSTTTEKLFDNVIKTIHARGVRYGHPITNHKRIAELWSAYLGYPI |
| Ga0181357_12144881 | 3300017777 | Freshwater Lake | MTKTEKLFDEVVKTIHARGQTYGHPYYNHKRIAEL |
| Ga0181357_12668401 | 3300017777 | Freshwater Lake | MSTTTEKLFNNVVKTIHARGVSYGHPITNHKRIAELWSAYLG |
| Ga0181349_10533991 | 3300017778 | Freshwater Lake | MANLMSTTTEKLFDNVIKTIHARGVSYGHPITNHKRIAELWSAYLGYPIQPNEVAIC |
| Ga0181346_12962053 | 3300017780 | Freshwater Lake | MQKLNPMKYLIMTNTEKLFDNVIKTIHARGVSYGHPITNHKRIAELWS |
| Ga0181348_12590641 | 3300017784 | Freshwater Lake | MSTTTEQLFNNVIKTIHERGVRYGHPITNHKRIAELWSAYLGYPI |
| Ga0181359_10413471 | 3300019784 | Freshwater Lake | MAKLMSTTTEKLFDNVIKTIHARGVSYGHPITNHKRIAELWSAYLGYPIQPND |
| Ga0181359_10882071 | 3300019784 | Freshwater Lake | MANLMSTTTEKLFDNVIKTIHARGVSYGHPITNHKRIAELWSAYLGYPIQPN |
| Ga0181359_11562151 | 3300019784 | Freshwater Lake | MTKTEKLFDEVIKTIHARGESYGHPYYNHKRIAELWSAYIGYPLQPNQVA |
| Ga0211734_106778081 | 3300020159 | Freshwater | MPSEIKYLIMTKTESLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSA |
| Ga0211726_101646831 | 3300020161 | Freshwater | MPSEIKYLIMTKTETLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSA |
| Ga0211726_101653847 | 3300020161 | Freshwater | MTKTESLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSA |
| Ga0194115_103629802 | 3300020183 | Freshwater Lake | MKYLIMTKTSKLFDDVTQLIHQRGTQYGHPISNHKRIAELWTAYLGFPIQPNEVAIC |
| Ga0208590_10179354 | 3300020501 | Freshwater | MTKTEKLFDEAITTIQSRGVVYGHPYYNMERISKLVSSY |
| Ga0208234_10350721 | 3300020515 | Freshwater | MTRTEKLFANVIETLHSRGAHYGHPIENHKRIAELWSAYLGYPIQPNEVAIC |
| Ga0208722_10509363 | 3300020537 | Freshwater | MTKTEQLFDEVIQILHSRGSQYGHPIGNHKRIAELWSAYLGYPIQPNE |
| Ga0208855_10173271 | 3300020553 | Freshwater | MTTTTEKLFDNVIKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQ |
| Ga0208723_10386571 | 3300020571 | Freshwater | MTKTEDLLNEVISTIQERGSVYGHPYYNHKRIAGL |
| Ga0208485_10167711 | 3300020573 | Freshwater | MTKTEQLLDDVITTIQQRGNVYGHPYYNHKRIAGLWSAYLDFPITPHQAALC |
| Ga0194041_100955931 | 3300021340 | Anoxic Zone Freshwater | MPTTTEKLFDEVISTIHERGAIYGHPAINHKRIADLWSAYLDYPI |
| Ga0213922_10752471 | 3300021956 | Freshwater | MPTTTEKLFDEVVSIIHQRGENYGHPFSQHKRIAELWSAYL |
| Ga0181353_10815861 | 3300022179 | Freshwater Lake | MKCLIMKSTTEALFDEVITTLQQRGSVYGHPFYNHKRIAGLWS |
| Ga0181354_10198267 | 3300022190 | Freshwater Lake | MTKTEKLFDDVIKTIHARGESYGHPYYNHKRIAELWSA |
| Ga0181354_10383305 | 3300022190 | Freshwater Lake | MSTTTEKLFDNVVKTIHARGVSYGHPITNHKRIAEL |
| Ga0181354_10675244 | 3300022190 | Freshwater Lake | MTKTEKLFDEVIKTIHARGESYGHPYYNHKRIAELWSAYTGYP |
| Ga0181354_11823432 | 3300022190 | Freshwater Lake | MSTTTEKLFNNVVKTIHARGVSYGHPITNHKRIAELW |
| Ga0181351_10731331 | 3300022407 | Freshwater Lake | MSTTTEKLFNNVVKTIHARGVSYGHPITNHKRIAELWSAYLGYPIQPN |
| Ga0181351_11089781 | 3300022407 | Freshwater Lake | MTTTTEKLFDNVIKTIHARGVSYGHPITNHKRIAELWSAYLGYPIQPNEAAICMA |
| Ga0181351_11204824 | 3300022407 | Freshwater Lake | MANLMSTTTEKLFDNVIKTIHARGVSYGHPITNHKRIAELWSAYLGYPIQPNEVAICM |
| Ga0181351_12598341 | 3300022407 | Freshwater Lake | MSTTTEKLFDNVVKTIHARGVSYGHPITNHKRIAELWSAYLGYPIQPN |
| Ga0214917_103508571 | 3300022752 | Freshwater | MTKTESLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITP |
| Ga0208161_10764823 | 3300025646 | Aqueous | MTKTEDLLNEVISTIQQRGSVYGHPYYNHKRIAGLWS |
| Ga0208916_100727745 | 3300025896 | Aqueous | MTKTEQLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFP |
| Ga0255073_10370413 | 3300027135 | Freshwater | MTTTTEQLFDNVIKTIHERGVSYGHPITNHKRIAELWSAY |
| Ga0255064_10373523 | 3300027138 | Freshwater | MTRTEQLFANVIDTLHSRGSDYGHPIGNHKRIAELW |
| Ga0255082_10338681 | 3300027139 | Freshwater | MTTTTEQLFDNVIKTIHERGVSYGHPITNHKRIAELWSAYIGYPIQPN |
| Ga0209552_11826082 | 3300027563 | Freshwater Lake | MTKTEKLFDEVVKTIHARGESYGHPYYNHKRIAELWSAYIGYPLQPN |
| Ga0209651_10248266 | 3300027581 | Freshwater Lake | MTKTEKLFDEVIKTIHARGESYGHPYYNHKRIAELWSAYIGYPL |
| Ga0208951_10646064 | 3300027621 | Freshwater Lentic | MANLMSTTTEKLFDNVIKTIHARGVSYGHPITNHKRIAELWSAYLGY |
| Ga0209356_10704153 | 3300027644 | Freshwater Lake | MTKTEKLFDEVVKTIHSRGESYGHPYYNHKRIAELWS |
| Ga0208975_10496011 | 3300027659 | Freshwater Lentic | MTNTEKLFDNVIKTIHERGVRYGHPITNHKRIAELWSAY |
| Ga0209769_11439833 | 3300027679 | Freshwater Lake | MTKTEKLFDEVIKTIHARGESYGHPYYNHKRIAELWSAYIGYPLQPNQVAM |
| Ga0209297_10165601 | 3300027733 | Freshwater Lake | MTKTEQLFNEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQAA |
| Ga0209085_10034191 | 3300027741 | Freshwater Lake | MPTTTEKLFSEVISTIQERGAVYGHPAINHKRIADLWSAYLD |
| Ga0209597_11247374 | 3300027746 | Freshwater Lake | MPTTTEQLLDNVVKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQPNEVA |
| Ga0209296_100476717 | 3300027759 | Freshwater Lake | MTKTESLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPH |
| Ga0209500_101765121 | 3300027782 | Freshwater Lake | MPSEIKYLIMTKTESLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFP |
| Ga0209246_102144791 | 3300027785 | Freshwater Lake | MPTTTEQLLDNVVKTIHARGLNYGHPITNHKRIAELWSAYLGYPIQ |
| Ga0209246_103341263 | 3300027785 | Freshwater Lake | MPTTTEQLLDNVVKTIHARGVSYGHPISQHKRIAELWSAYLGYPI |
| Ga0209107_101153071 | 3300027797 | Freshwater And Sediment | MTKTEQLLDDVITTIQQRGNVYGHPYYNHKRIAGLWS |
| Ga0209353_100480371 | 3300027798 | Freshwater Lake | MTKTEKLFDEVIKTIHARGESYGHPYYNHKRIAELW |
| Ga0209353_100726771 | 3300027798 | Freshwater Lake | MANLMSTTTEKLFDNVIKTIHARGVSYGHPITNHKRIAELWSAYLG |
| Ga0209353_101060364 | 3300027798 | Freshwater Lake | MPTTTEQLLDNVVKTIHARGLNYGHPITNHKRIAELWSAYLGYPIQPNEVA |
| Ga0209353_104579661 | 3300027798 | Freshwater Lake | MTKTEKLFDEVIKTIHSRGESYGHPYYNHKRIAELWSAYTGYPLQP |
| Ga0209358_101760083 | 3300027804 | Freshwater Lake | MTKTEQLLNDVITTIQQRGNVYGHPYYNHKRIAGLWSAYLDFPITPHQAA |
| Ga0209354_100272101 | 3300027808 | Freshwater Lake | MANLMSTTTEKLFDNVIKTIHARGVSYGHPITNHKRIA |
| Ga0209550_102549834 | 3300027892 | Freshwater Lake | MTKTEQLLDEVITTIQQRGSVYGHPFYNHKRIAGLWSAYLDFPITP |
| Ga0209401_10506761 | 3300027971 | Freshwater Lake | MSTTTEQLFDNVVKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQPNE |
| Ga0209079_100476154 | 3300027972 | Freshwater Sediment | MTKTEDLLNEVIATIQERGSVYGHPYYNHKRIAGLWSAYLDFPITPHQA |
| Ga0209299_10169551 | 3300027974 | Freshwater Lake | MSTTTEQLFDNVVKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQP |
| (restricted) Ga0247834_10306001 | 3300027977 | Freshwater | MTKTETLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFP |
| Ga0247723_10504494 | 3300028025 | Deep Subsurface Sediment | MKSTTEALFDEVITTLQQRGSVYGHPFYNHKRIAG |
| Ga0304729_10871133 | 3300028392 | Freshwater Lake | MPTTTEKLFSEVISTIQERGAVYGHPAINHKRIADLWSAYLDYPIQPH |
| (restricted) Ga0247831_12865383 | 3300028559 | Freshwater | MSTTTEKLFENVVKTIHARGINYGHPITNHKRIAELWSAYLGYPIQPNEVAI |
| (restricted) Ga0247842_101255405 | 3300029268 | Freshwater | MTKTEKLFDEVIKTIHARGESYGHPYYNHKRIAELWSAY |
| Ga0315291_106018981 | 3300031707 | Sediment | MTTTTESLFDNVIKTIHARGVSYGHPITNHKRIAEL |
| Ga0315288_106867343 | 3300031772 | Sediment | MTTTTESLFDNVIKTIHARGVSYGHPITNHKRIAELWSAYIGY |
| Ga0315900_100096191 | 3300031787 | Freshwater | MTKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYL |
| Ga0315900_100486021 | 3300031787 | Freshwater | MTKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYLDYPITPHQ |
| Ga0315909_1000737519 | 3300031857 | Freshwater | MKKTEDLLNEVITTIQDRGRIYGHPYYNHKRIAQLWSAYL |
| Ga0315909_100669421 | 3300031857 | Freshwater | MTKTEQLLDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYL |
| Ga0315909_101400951 | 3300031857 | Freshwater | MTKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYLDFPITPHQ |
| Ga0315904_101727547 | 3300031951 | Freshwater | MTKTEDLLNEVIATIQERGSVYGHPYYNHKRIAGLWSAYL |
| Ga0315904_101875357 | 3300031951 | Freshwater | MKSLIMTKTEQLFANVIDTLHRRGANYGHPIANHKRIAELWSAYLGY |
| Ga0315904_109692391 | 3300031951 | Freshwater | MTKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYLDFPITP |
| Ga0315901_101674236 | 3300031963 | Freshwater | MTKTEQLFANVIDTLHRRGANYGHPIANHKRIAELWSAYLGY |
| Ga0315902_100704211 | 3300032093 | Freshwater | MTKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYLDYPITPHQAALC |
| Ga0315903_105226084 | 3300032116 | Freshwater | MRSLTMTKTEQLFANVIDTLHRRGANYGHPIANHKRIAELWSAYLGY |
| Ga0334980_0296231_3_116 | 3300033816 | Freshwater | MKSLIMTKTEQLFDEAITTIQSRGVVYGHPYYNMERIS |
| Ga0334982_0132421_1_147 | 3300033981 | Freshwater | MTKTEQLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQA |
| Ga0334992_0072538_1737_1892 | 3300033992 | Freshwater | MTKTEQLFANVIEILHKRGADYGHPIGNHKRIAELWSAYLGYPIQANEVAIL |
| Ga0334994_0587016_360_500 | 3300033993 | Freshwater | MKYLIMTKTESLFDEVITTIQQRGSVYGHPYYNHKRIAGLWTAYLDF |
| Ga0335003_0238020_2_148 | 3300033995 | Freshwater | MPTTTEQLFDNVIKTIHERGVRYGHPITNHKRIAELWSAYLGYPIQPNE |
| Ga0335004_0635697_405_560 | 3300034021 | Freshwater | MPTTTEQLLDNVVKTIHARGLNYGHPITNHKRIAELWSAYLGYPIQPNEVAV |
| Ga0334987_0214619_3_158 | 3300034061 | Freshwater | MKSTTEALFDEVITTLQQRGSVYGHPFYNHKRIAGLWSAYLDFPITPHQAAL |
| Ga0334987_0335434_872_985 | 3300034061 | Freshwater | MTKTEQLLDDVITTIQQRGSVYGHPYYNHKRIAGLWSA |
| Ga0334995_0668049_443_589 | 3300034062 | Freshwater | MTKTEQLLDDVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQA |
| Ga0335019_0380753_708_866 | 3300034066 | Freshwater | MPTTTEQLLDNVVKTIHARGINYGHPITNHKRIAELWSAYLGYPIQPNEVAVC |
| Ga0310127_094247_1160_1309 | 3300034072 | Fracking Water | MTKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYLDFPITPHQAA |
| Ga0335020_0081374_1544_1663 | 3300034082 | Freshwater | MPTTTEQLLDNVVKTIHARGVSYGHPISQHKRIAELWSAY |
| Ga0335010_0077059_2164_2286 | 3300034092 | Freshwater | MTKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYLD |
| Ga0335010_0108774_3_119 | 3300034092 | Freshwater | MTKTEDLLNEVIATIQERGSVYGHPYYNHKRIAGLWSAY |
| Ga0335010_0294215_2_130 | 3300034092 | Freshwater | MTKTEQLFANVIDTIHSRGANYGHPIGNHKRIAELWSAYLGYP |
| Ga0335022_0369934_637_783 | 3300034095 | Freshwater | MTTTEQLFDNVIKTIHERGVRYGHPITNHKRIAELWSAYLGYPIQPNE |
| Ga0335027_0452034_3_149 | 3300034101 | Freshwater | MIKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYLDMPITPHQA |
| Ga0335027_0549359_2_124 | 3300034101 | Freshwater | MKSLIMTKTEQLFDEVITTIQQRGSVYGHPYYNHKRIAGLW |
| Ga0335027_0622801_542_652 | 3300034101 | Freshwater | MTKTEDLLNEVIATIQERGSVYGHPYYNHKRIAGLWS |
| Ga0335031_0842128_355_507 | 3300034104 | Freshwater | MIKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYLDMPITPHQAAL |
| Ga0335036_0005470_2_124 | 3300034106 | Freshwater | MTKTEDLLNEVITTIQQRGSVYGHPYYNHQRIAGLWSAYLD |
| Ga0335036_0125274_3_107 | 3300034106 | Freshwater | MTKTESLFDEVITTIQQRGSVYGHPYYNHKRIAGL |
| Ga0335051_0128998_1168_1299 | 3300034109 | Freshwater | MTKTEDLLNEVIATIQERGSVYGHPYYNHKRIAGLWSAYLDFPI |
| Ga0335063_0457315_3_107 | 3300034111 | Freshwater | MTKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGL |
| Ga0335053_0444629_665_775 | 3300034118 | Freshwater | MTKTEQLFDEVITTIQQRGSVYGHPYYNHKRIAGLWS |
| Ga0335056_0169021_1139_1282 | 3300034120 | Freshwater | MTKTEQLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQ |
| Ga0335056_0381099_2_109 | 3300034120 | Freshwater | MTNTEKLFNNVIKTIHERGVRYGHPITNHKRIAELW |
| Ga0335060_0594939_3_122 | 3300034122 | Freshwater | MTKTEQLLDDVITTIQQRGNVYGHPYYNHKRIAGLWSAYL |
| Ga0335016_0377325_1_159 | 3300034166 | Freshwater | MKFLIMTKTEHLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQ |
| Ga0335065_0773287_3_152 | 3300034200 | Freshwater | MPNEIKYLTMTKTESLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLD |
| Ga0335007_0698670_3_161 | 3300034283 | Freshwater | MTTTEQLFDNVIKTIHERGVRYGHPITNHKRIAELWSAYLGYPIQPNEAAIC |
| Ga0335013_0018045_1_135 | 3300034284 | Freshwater | MTKTEDLLNEVIATIQDRGSVYGHPYYNHKRIAGLWSAYLDFPIT |
| Ga0335048_0055742_1_144 | 3300034356 | Freshwater | MPTTTEKLFDNVIKIIHDRGVRYGHPITNHKRIAELWSAYLGYPIQPN |
| ⦗Top⦘ |