NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F027741

Metagenome / Metatranscriptome Family F027741

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F027741
Family Type Metagenome / Metatranscriptome
Number of Sequences 193
Average Sequence Length 161 residues
Representative Sequence MDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYMSLLP
Number of Associated Samples 140
Number of Associated Scaffolds 193

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 8.29 %
% of genes near scaffold ends (potentially truncated) 84.97 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 130
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(40.414 % of family members)
Environment Ontology (ENVO) Unclassified
(79.275 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(82.902 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.67%    β-sheet: 6.00%    Coil/Unstructured: 51.33%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001354|JGI20155J14468_10093468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1081Open in IMG/M
3300002186|JGI24539J26755_10187016All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium598Open in IMG/M
3300003683|Ga0008459J53047_1071197All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium513Open in IMG/M
3300004642|Ga0066612_1295035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium513Open in IMG/M
3300008791|Ga0103696_1032552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium569Open in IMG/M
3300008930|Ga0103733_1077325All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300008937|Ga0103740_1033846All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300008956|Ga0104261_1035993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium605Open in IMG/M
3300008958|Ga0104259_1030372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium563Open in IMG/M
3300008958|Ga0104259_1035875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300008993|Ga0104258_1053809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium753Open in IMG/M
3300008993|Ga0104258_1055312All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium742Open in IMG/M
3300008993|Ga0104258_1071151All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300008993|Ga0104258_1114981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300009025|Ga0103707_10055602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium728Open in IMG/M
3300009071|Ga0115566_10613722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium608Open in IMG/M
3300009071|Ga0115566_10774148All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300009172|Ga0114995_10381097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium774Open in IMG/M
3300009441|Ga0115007_10708676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium676Open in IMG/M
3300009505|Ga0115564_10536787All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium559Open in IMG/M
3300009543|Ga0115099_10137747All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium721Open in IMG/M
3300009543|Ga0115099_11018756All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium855Open in IMG/M
3300009592|Ga0115101_1775856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300009606|Ga0115102_10116936All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium843Open in IMG/M
3300009606|Ga0115102_10843494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300009677|Ga0115104_11065309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300009677|Ga0115104_11308279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300012408|Ga0138265_1188015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300012414|Ga0138264_1184674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium590Open in IMG/M
3300012414|Ga0138264_1244305All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300012416|Ga0138259_1501671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium672Open in IMG/M
3300012416|Ga0138259_1601168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300012417|Ga0138262_1207827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
3300012417|Ga0138262_1568161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium644Open in IMG/M
3300012419|Ga0138260_10301593All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300012523|Ga0129350_1258883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300012528|Ga0129352_10221219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300012782|Ga0138268_1417378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium677Open in IMG/M
3300012782|Ga0138268_1694791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300018515|Ga0192960_103601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium734Open in IMG/M
3300018515|Ga0192960_104947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium635Open in IMG/M
3300018515|Ga0192960_105145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium623Open in IMG/M
3300018515|Ga0192960_107409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium520Open in IMG/M
3300018556|Ga0192942_105126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300018628|Ga0193355_1022326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium599Open in IMG/M
3300018678|Ga0193007_1054826All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300018684|Ga0192983_1040089All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300018684|Ga0192983_1044656All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium613Open in IMG/M
3300018692|Ga0192944_1033688All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium742Open in IMG/M
3300018692|Ga0192944_1063634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300018692|Ga0192944_1064905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300018779|Ga0193149_1048016All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium608Open in IMG/M
3300018779|Ga0193149_1051668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium585Open in IMG/M
3300018791|Ga0192950_1050980All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium613Open in IMG/M
3300018813|Ga0192872_1087569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300018831|Ga0192949_1070082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium693Open in IMG/M
3300018831|Ga0192949_1077571All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300018832|Ga0194240_1036906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300018836|Ga0192870_1052912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium698Open in IMG/M
3300018842|Ga0193219_1043878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium686Open in IMG/M
3300018846|Ga0193253_1063782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium904Open in IMG/M
3300018846|Ga0193253_1105319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium652Open in IMG/M
3300018855|Ga0193475_1069133All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium569Open in IMG/M
3300018874|Ga0192977_1095886All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300018874|Ga0192977_1099108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium579Open in IMG/M
3300018899|Ga0193090_1149025All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300018913|Ga0192868_10041824All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium686Open in IMG/M
3300018926|Ga0192989_10069429All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium904Open in IMG/M
3300018926|Ga0192989_10124385All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium638Open in IMG/M
3300018949|Ga0193010_10107747All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300018974|Ga0192873_10289110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium700Open in IMG/M
3300018974|Ga0192873_10291945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium696Open in IMG/M
3300018975|Ga0193006_10171341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
3300018976|Ga0193254_10065750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium843Open in IMG/M
3300018976|Ga0193254_10110873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium635Open in IMG/M
3300018977|Ga0193353_10243789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium513Open in IMG/M
3300018980|Ga0192961_10093485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium907Open in IMG/M
3300018997|Ga0193257_10153936All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium697Open in IMG/M
3300019001|Ga0193034_10097487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium671Open in IMG/M
3300019001|Ga0193034_10145755All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium572Open in IMG/M
3300019001|Ga0193034_10158586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium553Open in IMG/M
3300019021|Ga0192982_10204995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium703Open in IMG/M
3300019021|Ga0192982_10249666All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium636Open in IMG/M
3300019021|Ga0192982_10317953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300019031|Ga0193516_10277063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300019031|Ga0193516_10305920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300019032|Ga0192869_10265296All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium745Open in IMG/M
3300019032|Ga0192869_10300590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium700Open in IMG/M
3300019033|Ga0193037_10352197All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium520Open in IMG/M
3300019036|Ga0192945_10122872All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium828Open in IMG/M
3300019036|Ga0192945_10146831All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium758Open in IMG/M
3300019048|Ga0192981_10257597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium665Open in IMG/M
3300019048|Ga0192981_10277164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300019051|Ga0192826_10229735All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium684Open in IMG/M
3300019084|Ga0193051_106487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium744Open in IMG/M
3300019095|Ga0188866_1013361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium837Open in IMG/M
3300019095|Ga0188866_1019603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium709Open in IMG/M
3300019116|Ga0193243_1026045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium786Open in IMG/M
3300019116|Ga0193243_1045210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300019116|Ga0193243_1055635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium547Open in IMG/M
3300019117|Ga0193054_1070013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300019120|Ga0193256_1055644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium670Open in IMG/M
3300019123|Ga0192980_1088316All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium559Open in IMG/M
3300019131|Ga0193249_1084311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium747Open in IMG/M
3300019131|Ga0193249_1093474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium698Open in IMG/M
3300019131|Ga0193249_1094518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium693Open in IMG/M
3300019131|Ga0193249_1100710All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium664Open in IMG/M
3300019131|Ga0193249_1114163All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium608Open in IMG/M
3300019131|Ga0193249_1139483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium525Open in IMG/M
3300019133|Ga0193089_1134360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300019139|Ga0193047_1076687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium675Open in IMG/M
3300019150|Ga0194244_10072333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum610Open in IMG/M
3300019214|Ga0180037_1180519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium547Open in IMG/M
3300021334|Ga0206696_1158975All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium674Open in IMG/M
3300021342|Ga0206691_1841189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium705Open in IMG/M
3300021345|Ga0206688_10155821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium602Open in IMG/M
3300021345|Ga0206688_10892344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium547Open in IMG/M
3300021350|Ga0206692_1016903All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium662Open in IMG/M
3300021353|Ga0206693_1101464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300021365|Ga0206123_10318741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium657Open in IMG/M
3300021872|Ga0063132_104900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium678Open in IMG/M
3300021872|Ga0063132_105778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium696Open in IMG/M
3300021874|Ga0063147_102019All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium709Open in IMG/M
3300021875|Ga0063146_100345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium677Open in IMG/M
3300021887|Ga0063105_1021574All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium684Open in IMG/M
3300021889|Ga0063089_1032362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium647Open in IMG/M
3300021895|Ga0063120_1095200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300021898|Ga0063097_1050054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium742Open in IMG/M
3300021901|Ga0063119_1029512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300021913|Ga0063104_1040679All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium547Open in IMG/M
3300021913|Ga0063104_1062046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300021921|Ga0063870_1005330All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium615Open in IMG/M
3300021930|Ga0063145_1008595All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium550Open in IMG/M
3300021942|Ga0063098_1088659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300021950|Ga0063101_1136465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300022367|Ga0210312_112895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium647Open in IMG/M
3300023696|Ga0228687_1045571All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300025690|Ga0209505_1120130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium726Open in IMG/M
3300025690|Ga0209505_1126168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium701Open in IMG/M
3300025869|Ga0209308_10148166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1081Open in IMG/M
3300025890|Ga0209631_10385377All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium653Open in IMG/M
3300025894|Ga0209335_10286418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium707Open in IMG/M
3300026461|Ga0247600_1112603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300026468|Ga0247603_1069048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium720Open in IMG/M
3300026495|Ga0247571_1163721All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300026495|Ga0247571_1168393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium520Open in IMG/M
3300026495|Ga0247571_1169520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300026495|Ga0247571_1181509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300026500|Ga0247592_1173999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300026503|Ga0247605_1177220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300026513|Ga0247590_1195697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300027752|Ga0209192_10117413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1081Open in IMG/M
3300027833|Ga0209092_10509570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium614Open in IMG/M
3300028106|Ga0247596_1155857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium522Open in IMG/M
3300028137|Ga0256412_1216719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium707Open in IMG/M
3300028282|Ga0256413_1264128All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300028282|Ga0256413_1333162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300028290|Ga0247572_1193535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300028334|Ga0247597_1062013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300028672|Ga0257128_1117789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300030671|Ga0307403_10414066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium725Open in IMG/M
3300030671|Ga0307403_10701267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium550Open in IMG/M
3300030720|Ga0308139_1040672All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium691Open in IMG/M
3300030721|Ga0308133_1036001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium672Open in IMG/M
3300031542|Ga0308149_1046863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium544Open in IMG/M
3300031570|Ga0308144_1039408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium583Open in IMG/M
3300031579|Ga0308134_1115047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium616Open in IMG/M
3300031709|Ga0307385_10391348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300031710|Ga0307386_10576678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium594Open in IMG/M
3300031725|Ga0307381_10365452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium528Open in IMG/M
3300031729|Ga0307391_10760771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300031729|Ga0307391_10857387All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium523Open in IMG/M
3300031739|Ga0307383_10541443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium583Open in IMG/M
3300032360|Ga0315334_10872435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium779Open in IMG/M
3300032470|Ga0314670_10659257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium538Open in IMG/M
3300032517|Ga0314688_10535087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium636Open in IMG/M
3300032518|Ga0314689_10477058All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium653Open in IMG/M
3300032519|Ga0314676_10465392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium752Open in IMG/M
3300032519|Ga0314676_10522912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium704Open in IMG/M
3300032521|Ga0314680_10416290All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium837Open in IMG/M
3300032522|Ga0314677_10547963All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium613Open in IMG/M
3300032650|Ga0314673_10358446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium746Open in IMG/M
3300032650|Ga0314673_10696598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300032651|Ga0314685_10762194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium517Open in IMG/M
3300032709|Ga0314672_1247320All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium668Open in IMG/M
3300032711|Ga0314681_10670791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium574Open in IMG/M
3300032724|Ga0314695_1279055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300032726|Ga0314698_10523207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium528Open in IMG/M
3300032730|Ga0314699_10314463All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium704Open in IMG/M
3300032743|Ga0314707_10473813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium652Open in IMG/M
3300032746|Ga0314701_10379945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300032747|Ga0314712_10291704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium778Open in IMG/M
3300032749|Ga0314691_10446423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium533Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine40.41%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine18.13%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater9.84%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater8.29%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine5.18%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water4.66%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.63%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.11%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.55%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.04%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.04%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.04%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica1.04%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.52%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.52%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001354Pelagic Microbial community sample from North Sea - COGITO 998_met_05EnvironmentalOpen in IMG/M
3300002186Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M MetagenomeEnvironmentalOpen in IMG/M
3300003683Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_54_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004642Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI047_10m_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300008791Microbial communities from seawater in eastern North Pacific Ocean - P1 free-living McLaneEnvironmentalOpen in IMG/M
3300008930Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1BEnvironmentalOpen in IMG/M
3300008937Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3CEnvironmentalOpen in IMG/M
3300008956Marine microbial communities from eastern North Pacific Ocean - P8 free-living McLaneEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009025Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009505Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012417Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018556Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001478 (ERX1789635-ERR1719475)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018678Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782149-ERR1712036)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018779Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018813Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782297-ERR1712172)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018836Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000807 (ERX1789715-ERR1719504)EnvironmentalOpen in IMG/M
3300018842Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018855Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782341-ERR1711903)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018913Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018949Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002172 (ERX1782262-ERR1712034)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018975Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881)EnvironmentalOpen in IMG/M
3300018976Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001301 (ERX1789542-ERR1719444)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018997Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789387-ERR1719468)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019084Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001374 (ERX1809751-ERR1740125)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019120Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789686-ERR1719360)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019139Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001430 (ERX1809743-ERR1740120)EnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019214Estuarine microbial communities from the Columbia River estuary - R.1189 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021334Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021874Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S32 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021875Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S30 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021895Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021898Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-55S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021901Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021921Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021930Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S29 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021942Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-61M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300022367Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1161 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023696Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 52R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025690Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025894Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes)EnvironmentalOpen in IMG/M
3300026461Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028334Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028672Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030720Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_952_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030721Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1117_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031542Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_331_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031570Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_547_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032360Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032709Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032726Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032743Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032749Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI20155J14468_1009346813300001354Pelagic MarineMKYTLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLLP*
JGI24539J26755_1018701613300002186MarineDDSESDHSKEFYNAWNAVKDEEEGYHRAIPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLGTHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKIEVVKMPQFMRFLASDQYMTLI*
Ga0008459J53047_107119713300003683SeawaterKMKFSLAVAALLGLVSESQVNAVEVAKAPVGVTMIALDESSDEDNFVQLAGDDEESDHSKEFYNAWDAVKDEEEGYHRAIPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLETHKGLKGDEKKKYLDTYFARTFAHFDVTKGGKVEVIKMP
Ga0066612_129503513300004642MarineDSESDHSKEFYVPWDAVKDEEEGYHRVLPAYFSEGSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLGTHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKIEVVKMPQFMRFLASDQYMTLI*
Ga0103696_103255213300008791Ocean WaterAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKLDVVKMPMFMRFLASDQYMSLLP*
Ga0103733_107732513300008930Ice Edge, Mcmurdo Sound, AntarcticaVALEGDDSESDHSKEFYSAWNAVKDEEEGYHRALPSYFSGDGDDLFMRSMCKVYALEGKNKDGSPNGNFMMDEATTRAAASEVLGTHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYMTLI*
Ga0103740_103384613300008937Ice Edge, Mcmurdo Sound, AntarcticaEEDVALKGDDSESDHSKEFYNAWAAVKDEEEGYHRTIPAYFSADTDDLFMRSMCKTYALEGKNKDGSPNGNFMMDEATTRAAASEVLGTHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKLEVIKMPQFMRFLASDQYMSLLP*
Ga0104261_103599313300008956Ocean WaterIIKMKYTLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLLP*
Ga0104259_103037213300008958Ocean WaterALVGLISESPVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKLEVIKMPQFMRFLASDQYMSLLP*
Ga0104259_103587513300008958Ocean WaterAIEVARAPAGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKLEVIKMPQFMRFLASDQYMSLLP*
Ga0104258_105380913300008993Ocean WaterMKYTLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKLEVIKMPQFMRFLASDQYMSLLP*
Ga0104258_105531213300008993Ocean WaterLAIAALVGLISVEQVNAIEVARAPAGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKLEVIKMPQFMRFLASDQYMSLLP*
Ga0104258_107115123300008993Ocean WaterMQLQGDDSESDHSKEFYNAWNAVKDEEEGYHRAIPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLETHKGLSGDSKKKYLDTYFPRTFAHFDVTKGGKIEVAK
Ga0104258_111498113300008993Ocean WaterMKFSLAVAALLGLVSESQVNAVEVAKAPVGVTMIALDESSDEDNFVQLAGDDEESDHSKEFYNAWDAVKDEEEGYHRAIPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLETHKGLKGDEKKKYLDTYFARTFAHFDVTKGGKVEVIK
Ga0103707_1005560213300009025Ocean WaterMLRGDDEESDHSKEFYNAWDAVKDEEEGYHRAMPSWFAGDDDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAAATEVLGTHKGIKGDAAKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYMSLLP*
Ga0115566_1061372213300009071Pelagic MarineMKYTLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTK
Ga0115566_1077414813300009071Pelagic MarineESDHSKEFYNAWDAVKDEEEGYHRALPSYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFMMDEATTRAAASEVLETHKGLKGDEKKKYLDTYFARTFAHFDVTKGGKVEVIKMPQFMRFLASDQYMSLQG*
Ga0114995_1038109713300009172MarineFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLLP*
Ga0115007_1070867613300009441MarineKDEEEGYHRAIPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLGTHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKIEVVKMPQFMRFLASDQYMTLI*
Ga0115564_1053678713300009505Pelagic MarineEEGYHRSIPAYFSGDDDDLFMRSMCKTYALEGKNKDGSPNGNFQMDEAVTGAAASEVLETHKGMSGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQQLTL*
Ga0115099_1013774713300009543MarineMHAWLVACVAGAGSLAVAALLGLVSESQVNAVEVAKAPVGVTMIALDESSDEDNFVQLAGDDEESDHSKEFYNAWDAVKDEEEGYHRAIPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLETHKGLKGDEKKKYLDTYFARTFAHFDVTKGGKVEVIKMPQFMRFLASDQYMTLQN*
Ga0115099_1101875623300009543MarineMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKLEVIKMPQFMRFLASDQYMSLLP*
Ga0115101_177585613300009592MarineKMKFSLAVAALLGLVSESQVNAVEVAKAPVGVTMIALDESSDEDNFVQLAGDDEESDHSKEFYNAWDAVKDEEEGYHRAIPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLETHKGLKGDEKKKYLDTYFARTFAHFDVTKGGKVEVIKMPQFMRFLASDQYMTLQN*
Ga0115102_1011693613300009606MarineMKYTLAIAALVGLISVEQVNAIEVARAPAGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKLEVIKMPQFMRFLASDQYMSLLP*
Ga0115102_1084349413300009606MarineMKFSLAVAALLGLVSESQVNAVEVAKAPVGVTMIALDESSDEDNFVQLAGDDEESDHSKEFYNAWDAVKDEEEGYHRAIPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLETHKGLKGDEKKKYLDTYFARTFAHFDVTKGGKVEVIKMPQFMRFLASDQYMTLQN*
Ga0115104_1106530913300009677MarineDSSDSDEDVQVRGDDSESDHSKEFYNAWNAVKDEEEGYHRVIPAYFSADSDDLFMRSMCKTYALEGKNKDGSPNGNFQMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKDGKIDVIKMPMFMRFLASDQYMSLLP*
Ga0115104_1130827913300009677MarineVQIDSDSSDSEENVALEGDGEESDHSKEFYVPWDAVADDAEGYHRVLPAYFSEGSDDLFMRSMCKTYALEGKNKDGSPNGNFQMDEASTRAAATEVLETHKNMKGDEKKKYLDTYFARTFAHFDVNKEGKLDVIKMPQFMRFLANDQYMSL*
Ga0138265_118801513300012408Polar MarineAAFLQDDTESDHSKEFYNAWDAVKDEEEGYHRAMPSYFAGDDDDLFMRSMIKTYALEGKNKDGSPNGSFVMDEATTRAASSEVLGTHKGMKGDALKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYTSLLP*
Ga0138264_118467413300012414Polar MarineKFFAYVALLGAVNATFLGDDTESDHSKEFYNAWDAVKDEEEGYHRAMPSYFAGDDDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAASSEVLGTHKGMKGDALKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYTSLLP*
Ga0138264_124430513300012414Polar MarineKFFAYVALLGAVNAAFLQDDTESDHSKEFYNAWDAVKDEEEGYHRAMPSYFAGDDDDLFMRSMIKTYALEGKNKDGSPNGSFVMDEATTRAASSEVLGTHKGMKGDALKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYTSLLP*
Ga0138259_150167113300012416Polar MarineMKFAILALIGAVAARPFINANVEISESSESSSSGDENVQLRDDTESDHSKEFYNAWDAVKDEEEGYHRAMPSYFAGDDDDLFMRSMIKTYALEGKNKDGSPNGSFVMDEATTRAASSEVLGTHKGMKGDALKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYTSLLP*
Ga0138259_160116813300012416Polar MarineFFAYVALLGAVNAAFLQDDTESDHSKEFYNAWDAVKDEEEGYHRAMPSYFAGDDDDLFMRSMIKTYALEGKNKDGSPNGSFVMDEATTRAASSEVLGTHKGMKGDALKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYTSLLP*
Ga0138262_120782713300012417Polar MarineMKFFAYVALLGAVNAAFLQDDTESDHSKEFYNAWDAVKDEEEGYHRAMPSYFAGDDDDLFMRSMIKTYALEGKNKDGSPNGSFVMDEATTRAASSEVLGTHKGMKGDALKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYTSLLP*
Ga0138262_156816113300012417Polar MarineMKFSAYVAILGAVNASFLQDDTESDHSKEFYNAWDAVKDEEEGYHRAMPSYLAGDDDDLFMRSMIKTYALEGKNKDGSPNGSFVMDEATTRAAASEVLGTHKGMKGDALKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYTSLLP*
Ga0138260_1030159313300012419Polar MarineSDENVALEGDDSESDHSKEFYSAWNAVKDEEEGYHRALPSYFSGDGDDLFMRSMCKTYALEGKNKDGSPNGNFMMDEATTRAAASEVLGTHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKLEVIKMPQFMRFLASDQYMTLLP*
Ga0129350_125888313300012523AqueousGILSADQVNAIEVARAPEGVTMVAVDSESESDEQNVQLAGDDSESDHSKEFYNAWNAVKDEEEGYHRVIPSYFSGDDDDIFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKSGKIEVIKMPQFMRFLASDQY
Ga0129352_1022121913300012528AqueousVQLAGDDSESDHSKEFYNAWNAVKDEEEGYHRVIPSYFSGDDDDIFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKSGKIEVIKMPQFMRFLASDQYMSLLP*
Ga0138268_141737813300012782Polar MarineKIQMKFAILALIGAVAARPFINANVEISESSESSSSGDENVQLRDDTESDHSKEFYNAWDAVKDEEEGYHRAMPSYFAGDDDDLFMRSMIKTYALEGKNKDGSPNGSFVMDEATTRAASSEVLGTHKGMKGDALKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYTSLLP*
Ga0138268_169479113300012782Polar MarineGAVNATFLGDDTESDHSKEFYNAWDAVKDEEEGYHRAMPSYFAGDDDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAASSEVLGTHKGMKGDALKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYTSLLP*
Ga0192960_10360113300018515MarineHGDNKFIKMKYTLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLLP
Ga0192960_10494713300018515MarineETSSDSSDSEENVAVRGDDEESDHSKEFYSAWNAVKDDEEGYHRAIPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFQMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKDGKLDVIKMPQFMRFLASDQYMSLLP
Ga0192960_10514513300018515MarineETSSDSSDSEENVAVRGDDEESDHSKEFYSAWNAVKDDEEGYHRAIPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLGTHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKIEVVKMPQFMRFLASDQYMTLI
Ga0192960_10740913300018515MarineSSESDDENVQLNGDDSESDHSKEFYNAWDAVKDEEEGYHRAIPAYFSGDGDDLFMRSMCKAYALEGKNKDGSPNGNFMMNEATTRAAASEVLETHKGLKGDEKKKYLDTYFARTFAHFDVTKDGKIEVIKMPQFMRFLASDQYMTLQN
Ga0192942_10512613300018556MarineMVAVDSESESDEQNVQLAGDDSESDHSKEFYNAWNAVKDEEEGYHRVIPSYFSGDDDDIFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLETHKGLAGDAKKKYLDTYFPRTFAHFDVTKSGKIEVIKMPQFMRFLASDQYMSLLP
Ga0193355_102232613300018628MarineMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYMSLLP
Ga0193007_105482613300018678MarineHSKEFYNAWDAVKDEEEGYHRAMPSWFAGDDDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAAATEVLATHKGIKGDAAKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYMSLLP
Ga0192983_104008913300018684MarineNVEISESSESSSSGDENVQLRDDTESDHSKEFYNAWDAVKDEEEGYHRAMPSYFAGDDDDLFMRSMIKTYALEGKNKDGSPNGSFVMDEATTRAASSEVLGTHKGMKGDALKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYTSLLP
Ga0192983_104465613300018684MarineMKFFAYVALLGAVNAAFLQDDTESDHSKEFYNAWDAVKDEEEGYHRAMPSYFAGDDDDLFMRSMIKTYALEGKNKDGSPNGSFVMDEATTRAASSEVLGTHKGMKGDALKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYTSLLP
Ga0192944_103368813300018692MarineMGNNKFIKMKYTLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLLP
Ga0192944_106363413300018692MarineHLQVYDNLSSDDEEETNVQLNGDDSESDHSKEFYNAWDAVKDEEEGYHRALPAYFSGDGDDLFMRSMCKTYALEGKNKDGSPNGNFMMDEATTRAAASEVLETHKGLKGDEKKKYLDTYFARTFAHFDVTKGGKIEVIKMPQFMRFLASDQYMTLQN
Ga0192944_106490513300018692MarineMQLQGDDSESDHSKEFYNAWNAVKDEEEGYHRAIPAHFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLGTHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKI
Ga0193149_104801613300018779MarineYFALFAAVVSANLSVSEYSDSEFVQLHGDSEESDHSKEFYNAWDAVKDEEEGYHRAMPSWFSGDDDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAAATEVIGTHKGIKGDAAKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLSSDQYMSLLP
Ga0193149_105166813300018779MarineFTVLIAAVAAIYGDSEESDHSKEFYNAWDAVKDEEEGYHRAMPSWFAGDDDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAAATEVLATHKGIKGDAAKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0192950_105098013300018791MarineMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLLP
Ga0192872_108756913300018813MarineMIAMDESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLKGDEKKKYLDTYFPRTFAHFDVTKGGSIEVIKMPQFMRFLASDQYMSLLP
Ga0192949_107008213300018831MarineLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLL
Ga0192949_107757113300018831MarineLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKDGKLDVVKMPMFMRFLASDQYMSLL
Ga0194240_103690613300018832MarineDFSTKSSNKHMPDWTKVQLASDSESSDEENVALEGDDSESDHSKEFYNAWNAVKDEEEGYHRVLPSYFAGDGDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYMSL
Ga0192870_105291213300018836MarineYTLAIAALVGLISVEQVNAIEVARAPAGVTMIAMDESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLKGDEKKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYMSLLP
Ga0193219_104387813300018842MarineSIAALVGILSADQVNAIEVARAPEGVTMVAVDSESESDEQNVQLAGDDSESDHSKEFYNAWNAVKDEEEGYHRVIPSYFSGDDDDIFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKSGKIEVIKMPQFMRFLASDQYMSLL
Ga0193253_106378213300018846MarineGNKIIKMKYTLAIAALVGLISVEQVNAIEVARAPAGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKLEVIKMPQFMRFLASDQYMSLLP
Ga0193253_110531913300018846MarineKFSLAVAALLGLVSESQVNAVEVAKAPVGVTMIALDESSDEDNFVQLAGDDEESDHSKEFYNAWDAVKDEEEGYHRAIPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLETHKGLKGDEKKKYLDTYFARTFAHFDVTKGGKVEVIKMPQFMRFLASDQYMTLQN
Ga0193475_106913313300018855MarineQLHGDSEESDHSKEFYNAWDAVKDEEEGYHRAMPSWFSGDDDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAAATEVIGTHKGIKGDAAKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLSSDQYMSLLP
Ga0192977_109588613300018874MarineGFENAEADSANAHWEDYTKVQLSSSETSEEDVMLGDDTESDHSKEFYNAWDAVKDEEEGYHRAMPSYFAGDDDDLFMRSMIKTYALEGKNKDGSPNGSFVMDEATTRAASSEVLGTHKGMKGDALKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYTSLLP
Ga0192977_109910813300018874MarineKFFAYVALLGAVNATFLGDDTESDHSKEFYNAWDAVKDEEEGYHRAMPSYFAGDDDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAASSEVLGTHKGMKGDALKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYTSLLP
Ga0193090_114902513300018899MarineKFSAYVAILGAVNASFLQDDTESDHSKEFYNAWDAVKDEEEGYHRAMPSYFAGDDDDLFMRSMIKTYALEGKNKDGSPNGSFVMDEATTRAAASEVLGTHKGMKGDALKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYTSLLP
Ga0192868_1004182413300018913MarineEQVNAIEVARAPAGVTMIAMDESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLKGDEKKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYMSLLP
Ga0192989_1006942913300018926MarineRNKIIKMKYTLAIAALVGLISVEQVNAIEVARAPAGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKLEVIKMPQFMRFLASDQYMSLLP
Ga0192989_1012438513300018926MarineTKMKFSLAVAALLGLVSESQVNAVEVAKAPVGVTMIALDESSDEDNFVQLAGDDEESDHSKEFYNAWDAVKDEEEGYHRAIPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLETHKGLKGDEKKKYLDTYFARTFAHFDVTKGGKVEVIKMPQFMRFLASDQYMTLQN
Ga0193010_1010774713300018949MarineNGRPPYQSAMQLRSESSTSSEEDVQLRGDSEESDHSKEFYNAWDAVKDEEEGYHRAMPSWFSGDDDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAAATEVIGTHKGIKGDAAKKYLDTYFPRTFAHFDVTKGGKVEVIKMPQFMRFLASDQYMSLLP
Ga0192873_1028911013300018974MarineMKYTLAIAALVGLISVEQVNAIEVARAPAGVTMIAMDESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLKGDEKKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYMSLLP
Ga0192873_1029194513300018974MarineMKYTLAIAALVGLISVEQVNAIEVARAPAGVTMIAMDESSDEENVQLAGDDSESDHSKEFYNAWDAVKDEEEGYHRAIPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMNEATTRAAASEVLETHKGLKGDEKKKYLDTYFARTFAHFDVTKGGKIEVIKMPQFMRFLASDQYMTLQNXGIKFQFKIIFNTYILSI
Ga0193006_1017134113300018975MarineMKYFAYLIAAVAAMNIRGDDEESDHSKEFYNAWDAVKDEEEGYHRAMPSWFAGDDDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAAATEVLGTHKGIKGDAAKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYMSLLP
Ga0193254_1006575013300018976MarineMKYTLAIAALVGLISVEQVNAIEVARAPAGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKLEVIKMPQFMRFLASDQYMSLLP
Ga0193254_1011087313300018976MarineKMKFSLAVAALLGLVSESQVNAVEVAKAPVGVTMIALDESSDEDNFVQLAGDDEESDHSKEFYNAWDAVKDEEEGYHRAIPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLETHKGLKGDEKKKYLDTYFARTFAHFDVTKGGKVEVIKMPQFMRFLASDQYMTLQN
Ga0193353_1024378913300018977MarineSSESDSDIQNIQLYGDDEESDHSKEFYNAWDAVKDEEEGYHRAMPSWFSGDDDDLFMRSMIKTYALEGKNKDGSPNGSFVMDEATARAAASEVLETHKGLKGDAKKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLSSDQYMSLLP
Ga0192961_1009348513300018980MarineQRRVHGDNKFIKMKYTLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLLP
Ga0193257_1015393613300018997MarineYTLAIAALVGLISVEQVNAIEVARAPAGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKLEVIKMPQFMRFLASDQYMSLLP
Ga0193034_1009748713300019001MarineMKYFALFAAVVSANLSVSEYSDSEFVQLHGDSEESDHSKEFYNAWDAVKDDEEGYHRAMPSWFSGDDDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAAATEVIGTHKGIKGDAAKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLSSDQYMSLLP
Ga0193034_1014575513300019001MarineLVAANFKDDDEESDHSKEFYNAWDAVKDEEEGYHRAMPSWFSGDDDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAAATEVLGTHKGIKGDAAKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLGSDQYMSLLP
Ga0193034_1015858613300019001MarineVRGDSEESDHSKEFYNAWDAVKDEEEGYHRAMPSWFSGDDDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAAASEVIGTHKGIKGDAAKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLSSDQYMSLLP
Ga0192982_1020499513300019021MarineHGTLIIIKIKIQMKFAILALIGAVAARPFINANVEISESSESSSSGDENVQLRDDTESDHSKEFYNAWDAVKDEEEGYHRAMPSYFAGDDDDLFMRSMIKTYALEGKNKDGSPNGSFVMDEATTRAASSEVLGTHKGMKGDALKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYTSLLP
Ga0192982_1024966613300019021MarineMKFFAYVALLGAVNATFLGDDTESDHSKEFYNAWDAVKDEEEGYHRAMPSYFAGDDDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAASSEVLGTHKGMKGDALKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYTSLLP
Ga0192982_1031795313300019021MarineMKFFAYVALLGAVNAAFLQDDTESDHSKEFYNAWDAVKDEEEGYHRAMPSYFAGDDDDLFMRSMIKTYALEGKNKDGSPNGNFMMDEATTRAASSEVLSTHKGMKGDALKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYTSLLP
Ga0193516_1027706313300019031MarineMLRGDDEESDHSKEFYNAWDAVKDEEEGYHRAMPSWFSGDDDDLFMRSMIKTYALEGKNKDGSPNGNFQMDEATTRAAATEVLGTHKGIKGEAAKKYLDTYFARTFAHFDVTKSGKIEVIKMPQFMRFLASDQYMSLLP
Ga0193516_1030592013300019031MarineVKDEEEGYHRAMPSWFSGDDDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLATHKGIKGEAAKKYLDTYFARTFAHFDVTKGGKIEVIKMPQFMRFLASDQYMSLLP
Ga0192869_1026529613300019032MarineHGELINLFTMKFSLAVAALVGLISESQINAIEVARHAPVGVTMIAVDNESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLKGDEKKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYVSLLP
Ga0192869_1030059013300019032MarineMKFFVAAALMAITNGMSISESSSESDSDINFVQVHKDDDEESDHSKEFYNAWDAVKDEEEGYHRAMPSWFAGDDDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAAATEVIGTHKGIKGDAAKKYLDTYFARTFAHFDVTKSGKIEVIKMPQFMRFLASDQYVSLLP
Ga0193037_1035219713300019033MarineKEFYNAWDAVKDEEEGYHRAMPSWFAGDDDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLETHKGLKGDEKKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYMSLLHEHERLSDECN
Ga0192945_1012287213300019036MarineMQLQGDDSESDHSKEFYNAWNAVKDEEEGYHRAIPAHFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLGTHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKIEVSKMPQFMRFLASDQYMTLI
Ga0192945_1014683113300019036MarineMGDDSESDHSKEFYPAWKAVKDEEEGYHRSIPAYFSGDDDDLFMRSMCKTYALEGKNKDGSPNGNFQMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKDGKLDVVKMPMFMRFLASDQYMSLLP
Ga0192981_1025759713300019048MarineTWGIIKIKIQMKFAILALIGAVAARPFINANVEISESSESSSSGDENVQLRDDTESDHSKEFYNAWDAVKDEEEGYHRAMPSYFAGDDDDLFMRSMIKTYALEGKNKDGSPNGSFVMDEATTRAASSEVLGTHKGMKGDALKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYTSLLP
Ga0192981_1027716413300019048MarineMGKIIINKFIMKFSAYVAILGAVNASFLQDDTESDHSKEFYNAWDAVKDEEEGYHRAMPSYFAGDDDDLFMRSMIKTYALEGKNKDGSPNGSFVMDEATTRAAASEVLGTHKGMKGDALKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYTSLLP
Ga0192826_1022973513300019051MarineMKFFAVAVLMAVANGMSISNKNFVQAQGDDEESDHSKEFYNAWDAVKDEEEGYHRAMPSWFAGDDDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAAATEVLGTHKGIKGDAAKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0193051_10648713300019084MarineLAIAALVGLISVEQVNAIEVARAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKGGKLEVIKMPQFMRFLASDQYMSLL
Ga0188866_101336113300019095Freshwater LakeMGDDSESDHSKEFYPAWKAVKDEEEGYHRSIPAYFSGDDDDLFMRSMCKTYALEGKNKDGSPNGNFQMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKLDVVKMPMFMRFLASDQYMSLLP
Ga0188866_101960313300019095Freshwater LakeMKYTLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLLP
Ga0193243_102604513300019116MarineHGDNKIIKMKYTLAIAALVGILSADQVNAIEVARAPEGVTMVAVDSESESDEQNVQLAGDDSESDHSKEFYNAWNAVKDEEEGYHRVIPSYFSGDDDDIFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLETHKGLAGDAKKKYLDTYFPRTFAHFDVTKSGKIEVIKMPQFMRFLASDQYMSLLP
Ga0193243_104521013300019116MarineDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKSGKIEVIKMPQFMRFLASDQYMSLLP
Ga0193243_105563513300019116MarineDEEEGYHRAIPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDGKKKYLDTYFPRTWAHFDVTKDGKIDVIKMPQFMRFLASDQYMSLLP
Ga0193054_107001313300019117MarineKEFYNAWDSVKDEDEGYHRAIPAYFAGDGDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYMSLLP
Ga0193256_105564413300019120MarineLVGLISVEQVNAIEVARAPAGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKLEVIKMPQFMRFLASDQYMSLLP
Ga0192980_108831613300019123MarineDDTESDHSKEFYNAWDAVKDEEEGYHRAMPSYFAGDDDDLFMRSMIKTYALEGKNKDGSPNGSFVMDEATTRAAASEVLGTHKGMKGDALKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLSSDQYMTLI
Ga0193249_108431113300019131MarineMKYTLAIAALVGLISVEQVNAIEVARAPAGVTMIAMDESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKLDVVKMPMFMRFLASDQYMSLLP
Ga0193249_109347413300019131MarineMKYTLAIAALVGLISVEQVNAIEVARAPAGVTMIAMDESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLLP
Ga0193249_109451813300019131MarineMKYTLAIAALVGLISVEQVNAIEVARAPAGVTMIAMDESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLKGDEKKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYMSLQP
Ga0193249_110071013300019131MarineMKYTLAIAALVGLISVEQVNAIEVARAPAGVTMVAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKIEVVKMPQFMRFLASDQYMTLI
Ga0193249_111416323300019131MarineMQLQGDDSESDHSKEFYNAWNAVKDEEEGYHRAIPAHFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLGTHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGK
Ga0193249_113948313300019131MarineSTHLQVYDNLSSDDEEETNVQLNGDDSESDHSKEFYNAWDAVKDEEEGYHRALPAYFSGDGDDLFMRSMCKTYALEGKNKDGSPNGNFMMDEATTRAAASEVLETHKGLKGDEKKKYLDTYFARTFAHFDVTKGGKIEVIKMPQFMRFLASDQYMTLQN
Ga0193089_113436013300019133MarineKSSNKNMPDWTKVQLNDSSSDSEDVQLEGDDSESDHSKEFYNAWDAVKDEEEGYHRALPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFMMDEATTRAAASEVLETHKGLKGDEKKKYLDTYFARTFAHFDVTKGGKVEVIKMPQFMRFLASDQYMTLQN
Ga0193047_107668713300019139MarineAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLLP
Ga0194244_1007233313300019150MarineKVSKGGNRRGIRRDDDTESDHSKEFYNAWDAVKDEEEGYHRAMPSYFAGDDDDIFMRSMINNYALEGKNKDGSPNGAFMMTESTAKAAAKEVLATHKGMKGDALKKYLDTYFAKSWGHFDVNKSGAVEVIKMPQFMRFLASDQRMSLGESGR
Ga0180037_118051913300019214EstuarineYTLAIAALVGLISVEQVNAIEVARAPAGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLNTHRGLSGKAREAYLKTYFPRSWAHFDVNRTGMVEAIKMPQLMRFLASDQQMY
Ga0206696_115897513300021334SeawaterAALVGLISVEQVNAIEVARAPAGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFQMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYMSLLP
Ga0206691_184118913300021342SeawaterVLQYTLAIAALVGLISVEQVNAIEVARAPAGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKLEVIKMPQFMRFLASDQYMSLLP
Ga0206688_1015582113300021345SeawaterKMKFFAVAALVAIANGMSVSESSSESESDVHFVQLAKDDSEESDHSKEFYNAWDAVKDEEEGYHRAMPSWFAGDDDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLETHNGLKGDAKKKYLDTYFPRTFAHFDVTKGGKLEVIKMP
Ga0206688_1089234413300021345SeawaterVKDEEEGYHRAMPSWFSGDDDDLFMRSMVKTYALEGKNKDGSPNVNYVMNEATSRAAAAEVLATHKGIKGDSAKKYLDTYFPTTFAHFDVTKGGKLEVIKMPQFMRFLASDQYMSLLP
Ga0206692_101690313300021350SeawaterGLISVEQVNAIEVARAPAGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKLEVIKMPQFMRFLASDQYMSLLP
Ga0206693_110146413300021353SeawaterDVQLRGDDEESDHSKEFYNAWDAVKDEEEGYHRAMPSWFSGDGDDLFMRSMIKTYALEGKNKDGSPNGNFQMDEATTRAAATEVLGTHKGIKGEAAKKYLDTYFARTFAHFDVTKGGKIEVIKMPQFMRFLGSDQYMSLLP
Ga0206123_1031874113300021365SeawaterMKYTLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKLDVVKMPMFMRFLA
Ga0063132_10490023300021872MarineVENVELNGDDSESDHSKEFYNAWNAVKDEEEGYHRAIPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATSRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKGGKIEVTKMPQFMRFLASDQYMTLI
Ga0063132_10577813300021872MarineKYTLAIAALVGLISVEQVNAIEVARAPAGVTMVAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYMSLLP
Ga0063147_10201913300021874MarineMKYTLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLLP
Ga0063146_10034513300021875MarineKYTLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLLP
Ga0063105_102157413300021887MarineYTLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLLP
Ga0063089_103236213300021889MarineYTLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLLP
Ga0063120_109520013300021895MarineKFFVLALAAASAYSVSESSESESDVRFVQLHGDSEESDHSKEFYNAWDAVKDEEEGYHRAMPSWFAGDDDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLETHKGLKGDEKKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYMSLLP
Ga0063097_105005413300021898MarineMQLQGDDSESDHSKEFYNAWNAVKDEEEGYHRAIPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLGTHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKIEVSKMPQFMRFLASDQYMTLI
Ga0063119_102951213300021901MarineLALAAASAYSVSESSESESDVRFVQLHGDSEESDHSKEFYNAWDAVKDEEEGYHRAMPSWFAGDDDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLETHKGLKGDEKKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYMSLLP
Ga0063104_104067913300021913MarineNVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLLP
Ga0063104_106204613300021913MarineAWKAVKDEEEGYHRAIPAYFSGDDDDLFMRSMCKTYALEGKNKDGSPNGNFQMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKDGKLDVVKMPMFMRFLASDQYMSLLP
Ga0063870_100533013300021921MarineSSDSSDSDEDVQVRGDDSESDHSKEFYPAWKAVKDEEEGYHRAIPAYFSGDDDDLFMRSMCKTYALEGKNKDGSPNGNFQMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKDGKLDVVKMPMFMRFLASDQYMSLLP
Ga0063145_100859513300021930MarineYTLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLL
Ga0063098_108865923300021942MarineMQLQGDDSESDHSKEFYNAWNAVKDEEEGYHRAIPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLGTHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKIEVSKM
Ga0063101_113646513300021950MarineKEFYPAWKAVKDEEEGYHRAIPAYFSGDDDDLFMRSMCKTYALEGKNKDGSPNGNFQMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKDGKLDVVKMPMFMRFLASDQYMSLLP
Ga0210312_11289513300022367EstuarineARAPAGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKLEVIKMPQFMRFLASDQTLNLQ
Ga0228687_104557113300023696SeawaterALVGLISVEQVNAIEVARAPAGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKLEVIKMPQFMRFLASDQYM
Ga0209505_112013013300025690Pelagic MarineSQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLLP
Ga0209505_112616813300025690Pelagic MarineFYNAWNAVKDEEEGYHRAIPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLGTHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKIEVVKMPQFMRFLASDQYMTLI
Ga0209308_1014816613300025869Pelagic MarineMKYTLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLLPXAVQKNASFFKNXKMIKNYSLAESGAFCVSPELIVNDLS
Ga0209631_1038537713300025890Pelagic MarineMKYTLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRF
Ga0209335_1028641813300025894Pelagic MarineKEFYNAWNAVKDEEEGYHRAIPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLGTHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKIEVVKMPQFMRFLASDQYMTLI
Ga0247600_111260313300026461SeawaterMKYTLAIAALVGLISVEQVNAIEVARAPAGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKLEVIKMPQFMRFLASDQY
Ga0247603_106904813300026468SeawaterLAIAALVGLISVEQVNAIEVARAPAGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKLEVIKMPQFMRFLASDQYMSLL
Ga0247571_116372113300026495SeawaterKMKFSLAVAALLGLVSESQVNAVEVAKAPVGVTMIALDESSDEDNFVQLAGDDEESDHSKEFYNAWDAVKDEEEGYHRAIPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLETHKGLKGDEKKKYLDTYFARTFAHFDVTKGGKVEVIKMPQFMRF
Ga0247571_116839313300026495SeawaterVGLISVEQVNAIEVARAPAGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKLEVIKMPQFMRFLASDQYMSL
Ga0247571_116952013300026495SeawaterEENVELEGDGEESDHSKEFYVPWDAVADDAEGYHRVLPAYFTEGSDDLFMRSMCKTFALEGKNKDGSPNGNFQMDEASTRAAATEVLETHKGLKGDEKKKYLDTYFARTFAHFDVNKEGKIDVIKMPQFMRFLSNDQYMTLQN
Ga0247571_118150913300026495SeawaterISVEQVNAIEVARAPAGVTMIAMDESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLKGDEKKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYM
Ga0247592_117399913300026500SeawaterAALVGLISVEQVNAIEVARAPAGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKLEVIKMPQFMRFLAS
Ga0247605_117722013300026503SeawaterKMKFSLAVAALLGLVSESQVNAVEVAKAPVGVTMIALDESSDEDNFVQLAGDDEESDHSKEFYNAWDAVKDEEEGYHRAIPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLGTHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKIEVSKM
Ga0247590_119569713300026513SeawaterMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKLE
Ga0209192_1011741313300027752MarineMKYTLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLLPXAVQKNASFFKNXKMIKNYSLAESGAFYVSPELIVNDLS
Ga0209092_1050957013300027833MarineMKYTLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDLFMRSMCKAYALEGKNKDGSPNGNFVMDEATTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDG
Ga0247596_115585713300028106SeawaterMKYTLAIAALVGLISVEQVNAIEVARAPAGVTMIAMDESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKLEVIKMPQFMRFL
Ga0256412_121671913300028137SeawaterMFNSTVMMRSHHSKEFYVPWDAVKDDEDGYHRVLPAYFTEGSDDLFMRSMCKTYALEGKNKDGSPNGNFQMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKDGKIDVIKMPQFMRFLASDQYMTLQN
Ga0256413_126412813300028282SeawaterMKYTLAIAALVGLISVEQVNAIEVARAPAGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLKGDEKKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYMSLLP
Ga0256413_133316213300028282SeawaterKFSLAVAALLGLVSESQVNAVEVAKAPVGVTMIALDESSDEDNFVQLAGDDEESDHSKEFYNAWDAVKDEEEGYHRAIPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASD
Ga0247572_119353513300028290SeawaterKFSLAVAALLGLVSESQVNAVEVAKAPVGVTMIALDESSDEDNFVQLAGDDEESDHSKEFYNAWDAVKDEEEGYHRAIPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLETHKGLKGDEKKKYLDTYFARTFAHFDVTKGGKVEVIKMPQF
Ga0247597_106201313300028334SeawaterLAIAALVGLISVEQVNAIEVARAPAGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKLEVIKMPQFMRFL
Ga0257128_111778913300028672MarineAALIAATSESSVNAVEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFTGDGDDLFMKSMIKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGMTGDSKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLL
Ga0307403_1041406613300030671MarineWTTLIIIKIKIQMKFAILALIGAVAARPFINANVEISESSESSSSGDENVQLRDDTESDHSKEFYNAWDAVKDEEEGYHRAMPSYFAGDDDDLFMRSMIKTYALEGKNKDGSPNGSFVMDEATTRAASSEVLGTHKGMKGDALKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYTSLLP
Ga0307403_1070126713300030671MarineKFFAYVALLGAVNATFLGDDTESDHSKEFYNAWDAVKDEEEGYHRAMPSYFAGDDDDLFMRSMIKTYALEGKNKDGSPNGSFVMDEATTRAASSEVLGTHKGMKGDALKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYTSLLP
Ga0308139_104067213300030720MarineKYTLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLLP
Ga0308133_103600113300030721MarineTLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLLP
Ga0308149_104686313300031542MarineSESDHSKEFYPAWKAVKDEEEGYHRAIPAYFSGDDDDLFMRSMCKTYALEGKNKDGSPNGNFQMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLLP
Ga0308144_103940813300031570MarineYTLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDQAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLLP
Ga0308134_111504713300031579MarineESDSSDSEENVAIRGDDSESDHSKEFYPAWKAVKDEEEGYHRSIPAYFSGDDDDLFMRSMCKTYALEGKNKDGSPNGNFQMDEAVTRAAASEVLETHKGLSGDAKKKYLDTYFPRTFAHFDVTKDGKLDVVKMPMFMRFLASDQYMSLLP
Ga0307385_1039134813300031709MarineFSFAILGLVAATFGDDEESDHSKEFYNAWDAVKDEEEGYHRAMPSWFSGDDDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAACTEVLGTHKGIKGDAAKKYLDTYFARTFAHFDVTKGGKLEVIKMPQFMRFLGSDQYMSLLP
Ga0307386_1057667813300031710MarineFNIRMKFFSFAILGLVAATFGDDEESDHSKEFYNAWDAVKDEEEGYHRAMPSWFSGDDDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAACTEVIGTHKGIKGDAAKKYLDTYFARTFAHFDVTKGGKLEVIKMPQFMRFLGSDQYMSLLP
Ga0307381_1036545213300031725MarineFGDDEESDHSKEFYNAWDAVKDEEEGYHRAMPSWFSGDDDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLGTHKGIKGDAGKKYMDTYFARTFAHFDVTKGGKLEVIKMPQFMRFLASDQYMSLLP
Ga0307391_1076077113300031729MarineKFFAYVALLGAVNAAFLQDDTESDHSKEFYNAWDAVKDEEEGYHRAMPSYFAGDDDDLFMRSMIKTYALEGKNKDGSPNGSFVMDEATTRAASSEVLGTHKGMKGDALKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYTSLLP
Ga0307391_1085738713300031729MarineMKFAILALIGAVAARPFINANVEISESSESSSSGDENVQLRDDTESDHSKEFYNAWDAVKDEEEGYHRAMPSYFAGDDDDLFMRSMIKTYALEGKNKDGSPNGSFVMDEATTRAASSEVLGTHKGMKGDALKKYLDTYFPRTFAHFDVTKGGKIEVIKMPQFMRFLASDQYTSL
Ga0307383_1054144313300031739MarineKFFSFAILAVVSATFGDDEESDHSKEFYNAWDAVKDEEEGYHRAMPSWFSGDDDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAAATEVIGTHKGIKGDAAKKYLDTYFARTFAHFDVTKGGKLEVIKMPQFMRFLGSDQYMSLLP
Ga0315334_1087243513300032360SeawaterMKFVSFALLGLVAANFKDDDEESDHSKEFYNAWDAVKDEEEGYHRAMPSWFAGDDDDLFMRSMIKTYALEGKNKDGSPNGNFVMDEATTRAAATEVLGTHKGIKGDAAKKYLDTYFARTFAHFDVTKGGKIEVIKMPQFMRFLGSDQYMSLLP
Ga0314670_1065925713300032470SeawaterLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSL
Ga0314688_1053508723300032517SeawaterMQLQGDDSESDHSKEFYNAWNAVKDEEEGYHRAIPAHFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLGTHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKIEVSKMPQFMR
Ga0314689_1047705813300032518SeawaterMPDWTKVQLNDSSSDSEDVQLEGDDSESDHSKEFYNAWDAVKDEEEGYHRALPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFMMDEATTRAAASEVLETHKGLKGDEKKKYLDTYFARTFAHFDVTKGGKVEVIKMPQFMRFL
Ga0314676_1046539223300032519SeawaterMGDDSESDHSKEFYPAWKAVKDEEEGYHRAIPAYFSGDSDDIFMRSMCKTYALEGKNKDGSPNGNFQMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKLDVVKMPMFMRFLASDQYMSLLP
Ga0314676_1052291223300032519SeawaterMPDWTKVQLNDSSSDSEDVQLEGDDSESDHSKEFYNAWDAVKDEEEGYHRALPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFMMDEATTRAAASEVLETHKGLKGDEKKKYLDTYFARTFAHFDVTKGGKVEVIKMPQFMRFLASDQYMSLQG
Ga0314680_1041629013300032521SeawaterIKMKYTLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLLP
Ga0314677_1054796313300032522SeawaterKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLLP
Ga0314673_1035844613300032650SeawaterMQLQGDDSESDHSKEFYNAWNAVKDEEEGYHRAIPAHFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLGTHKGLSGDSKKKYLDTYFPRTFAHFDVTKGGKIEVSKMPQFMRFLASDQYMTLI
Ga0314673_1069659813300032650SeawaterKDSTHLQVYDNLSSDDEEETNVQLNGDDSESDHSKEFYNAWDAVKDEEEGYHRALPAYFSGDGDDLFMRSMCKTYALEGKNKDGSPNGNFMMDEATTRAAASEVLETHKGLKGDEKKKYLDTYFARTFAHFDVTKGGKIEVIKMPQFMRFLASDQYMTLQN
Ga0314685_1076219413300032651SeawaterKYTLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMR
Ga0314672_124732013300032709SeawaterKYTLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLSPEQFRKTQVFLRIEK
Ga0314681_1067079113300032711SeawaterMQLQGDDSESDHSKEFYNAWNAVKDEEEGYHRAIPAHFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLGTHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKIEVSKMP
Ga0314695_127905513300032724SeawaterLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLL
Ga0314698_1052320713300032726SeawaterLVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLL
Ga0314699_1031446313300032730SeawaterIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLLP
Ga0314707_1047381313300032743SeawaterLAIAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMTLI
Ga0314701_1037994513300032746SeawaterMGDDSESDHSKEFYNAWNAVKDEEEGYHRAIPAYFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLGTHKGLSGDAKKKYLDTYFPRTFAHFDVTKGGKIEVVKMPQFMRFLASDQYMTLI
Ga0314712_1029170413300032747SeawaterMQLQGDDSESDHSKEFYNAWNAVKDEEEGYHRAIPAHFSGDSDDLFMRSMCKTYALEGKNKDGSPNGNFVMDEATTRAAASEVLGTHKGLSGDAKKKYLDTYFPRTFAHFDITKGGKIEVSKMPQFMRFLASDQYMTLI
Ga0314691_1044642313300032749SeawaterAALVGLISESQVNAIEIAKAPVGVTMIAMDSESSDEENVQLAGDDSESDHSKEFYNAWNAVKDDEEGYHRVIPAYFSGDGDDIFMRSMVKTYALEGKNKDGSPNGNFMMDEAVTRAAASEVLETHKGLTGDAKKKYLDTYFPRTFAHFDVTKDGKIEVIKAPQFMRFLASDQYMSLL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.