| Basic Information | |
|---|---|
| Family ID | F027701 |
| Family Type | Metagenome |
| Number of Sequences | 193 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MDHPAPLPRDSAMRAANRAEGEWLRKAKEDKKRKKQ |
| Number of Associated Samples | 65 |
| Number of Associated Scaffolds | 193 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 89.83 % |
| % of genes near scaffold ends (potentially truncated) | 13.47 % |
| % of genes from short scaffolds (< 2000 bps) | 91.71 % |
| Associated GOLD sequencing projects | 65 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (78.756 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (98.446 % of family members) |
| Environment Ontology (ENVO) | Unclassified (98.446 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (98.446 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.75% β-sheet: 0.00% Coil/Unstructured: 56.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 193 Family Scaffolds |
|---|---|---|
| PF04195 | Transposase_28 | 2.07 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 78.76 % |
| All Organisms | root | All Organisms | 21.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300013296|Ga0157374_12363970 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 559 | Open in IMG/M |
| 3300013297|Ga0157378_12637364 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 555 | Open in IMG/M |
| 3300013297|Ga0157378_12830519 | Not Available | 538 | Open in IMG/M |
| 3300015267|Ga0182122_1066536 | Not Available | 515 | Open in IMG/M |
| 3300015269|Ga0182113_1063210 | Not Available | 575 | Open in IMG/M |
| 3300015269|Ga0182113_1067213 | Not Available | 564 | Open in IMG/M |
| 3300015274|Ga0182188_1053143 | Not Available | 525 | Open in IMG/M |
| 3300015275|Ga0182172_1058552 | Not Available | 546 | Open in IMG/M |
| 3300015275|Ga0182172_1069236 | Not Available | 519 | Open in IMG/M |
| 3300015275|Ga0182172_1076218 | Not Available | 503 | Open in IMG/M |
| 3300015276|Ga0182170_1023806 | Not Available | 703 | Open in IMG/M |
| 3300015276|Ga0182170_1033622 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 640 | Open in IMG/M |
| 3300015277|Ga0182128_1058760 | Not Available | 550 | Open in IMG/M |
| 3300015277|Ga0182128_1064683 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 535 | Open in IMG/M |
| 3300015283|Ga0182156_1027670 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 703 | Open in IMG/M |
| 3300015283|Ga0182156_1087512 | Not Available | 503 | Open in IMG/M |
| 3300015285|Ga0182186_1024156 | Not Available | 718 | Open in IMG/M |
| 3300015285|Ga0182186_1074640 | Not Available | 520 | Open in IMG/M |
| 3300015286|Ga0182176_1025824 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 731 | Open in IMG/M |
| 3300015286|Ga0182176_1047618 | Not Available | 606 | Open in IMG/M |
| 3300015286|Ga0182176_1051387 | Not Available | 592 | Open in IMG/M |
| 3300015286|Ga0182176_1080300 | Not Available | 513 | Open in IMG/M |
| 3300015287|Ga0182171_1006750 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 1024 | Open in IMG/M |
| 3300015287|Ga0182171_1031280 | Not Available | 679 | Open in IMG/M |
| 3300015288|Ga0182173_1061823 | Not Available | 556 | Open in IMG/M |
| 3300015289|Ga0182138_1018408 | Not Available | 785 | Open in IMG/M |
| 3300015291|Ga0182125_1044722 | Not Available | 629 | Open in IMG/M |
| 3300015291|Ga0182125_1060496 | Not Available | 576 | Open in IMG/M |
| 3300015292|Ga0182141_1020988 | Not Available | 773 | Open in IMG/M |
| 3300015292|Ga0182141_1078841 | Not Available | 531 | Open in IMG/M |
| 3300015294|Ga0182126_1027083 | Not Available | 727 | Open in IMG/M |
| 3300015294|Ga0182126_1078652 | Not Available | 534 | Open in IMG/M |
| 3300015294|Ga0182126_1084078 | Not Available | 524 | Open in IMG/M |
| 3300015295|Ga0182175_1016561 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 841 | Open in IMG/M |
| 3300015295|Ga0182175_1038343 | Not Available | 666 | Open in IMG/M |
| 3300015295|Ga0182175_1074778 | Not Available | 548 | Open in IMG/M |
| 3300015296|Ga0182157_1058560 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 598 | Open in IMG/M |
| 3300015296|Ga0182157_1079842 | Not Available | 544 | Open in IMG/M |
| 3300015298|Ga0182106_1027624 | Not Available | 743 | Open in IMG/M |
| 3300015298|Ga0182106_1029838 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 726 | Open in IMG/M |
| 3300015298|Ga0182106_1030174 | Not Available | 724 | Open in IMG/M |
| 3300015298|Ga0182106_1032669 | Not Available | 708 | Open in IMG/M |
| 3300015298|Ga0182106_1065986 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 577 | Open in IMG/M |
| 3300015298|Ga0182106_1084716 | Not Available | 534 | Open in IMG/M |
| 3300015299|Ga0182107_1042614 | Not Available | 659 | Open in IMG/M |
| 3300015299|Ga0182107_1048083 | Not Available | 637 | Open in IMG/M |
| 3300015300|Ga0182108_1020089 | Not Available | 823 | Open in IMG/M |
| 3300015300|Ga0182108_1022983 | Not Available | 792 | Open in IMG/M |
| 3300015300|Ga0182108_1049521 | Not Available | 636 | Open in IMG/M |
| 3300015300|Ga0182108_1080344 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis | 550 | Open in IMG/M |
| 3300015300|Ga0182108_1081954 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria | 546 | Open in IMG/M |
| 3300015302|Ga0182143_1083099 | Not Available | 540 | Open in IMG/M |
| 3300015302|Ga0182143_1102831 | Not Available | 505 | Open in IMG/M |
| 3300015303|Ga0182123_1021516 | Not Available | 773 | Open in IMG/M |
| 3300015303|Ga0182123_1023957 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 751 | Open in IMG/M |
| 3300015303|Ga0182123_1094539 | Not Available | 509 | Open in IMG/M |
| 3300015303|Ga0182123_1095457 | Not Available | 508 | Open in IMG/M |
| 3300015304|Ga0182112_1019164 | Not Available | 827 | Open in IMG/M |
| 3300015304|Ga0182112_1069058 | Not Available | 574 | Open in IMG/M |
| 3300015305|Ga0182158_1100361 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria | 509 | Open in IMG/M |
| 3300015305|Ga0182158_1101119 | Not Available | 508 | Open in IMG/M |
| 3300015308|Ga0182142_1050930 | Not Available | 646 | Open in IMG/M |
| 3300015308|Ga0182142_1060635 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 614 | Open in IMG/M |
| 3300015308|Ga0182142_1077761 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 569 | Open in IMG/M |
| 3300015308|Ga0182142_1079412 | Not Available | 565 | Open in IMG/M |
| 3300015308|Ga0182142_1090808 | Not Available | 542 | Open in IMG/M |
| 3300015314|Ga0182140_1047821 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 660 | Open in IMG/M |
| 3300015314|Ga0182140_1056280 | Not Available | 629 | Open in IMG/M |
| 3300015314|Ga0182140_1081472 | Not Available | 562 | Open in IMG/M |
| 3300015321|Ga0182127_1088714 | Not Available | 562 | Open in IMG/M |
| 3300015322|Ga0182110_1076655 | Not Available | 587 | Open in IMG/M |
| 3300015322|Ga0182110_1087855 | Not Available | 562 | Open in IMG/M |
| 3300015322|Ga0182110_1089055 | Not Available | 560 | Open in IMG/M |
| 3300015322|Ga0182110_1093082 | Not Available | 552 | Open in IMG/M |
| 3300015323|Ga0182129_1031917 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 738 | Open in IMG/M |
| 3300015323|Ga0182129_1117250 | Not Available | 501 | Open in IMG/M |
| 3300015341|Ga0182187_1022331 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 1061 | Open in IMG/M |
| 3300015341|Ga0182187_1061218 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 764 | Open in IMG/M |
| 3300015341|Ga0182187_1089733 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 670 | Open in IMG/M |
| 3300015341|Ga0182187_1151036 | Not Available | 558 | Open in IMG/M |
| 3300015341|Ga0182187_1171016 | Not Available | 533 | Open in IMG/M |
| 3300015342|Ga0182109_1147946 | Not Available | 589 | Open in IMG/M |
| 3300015342|Ga0182109_1201842 | Not Available | 522 | Open in IMG/M |
| 3300015342|Ga0182109_1203183 | Not Available | 521 | Open in IMG/M |
| 3300015342|Ga0182109_1217953 | Not Available | 507 | Open in IMG/M |
| 3300015343|Ga0182155_1053315 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 839 | Open in IMG/M |
| 3300015343|Ga0182155_1063659 | Not Available | 790 | Open in IMG/M |
| 3300015343|Ga0182155_1101053 | Not Available | 674 | Open in IMG/M |
| 3300015343|Ga0182155_1104386 | Not Available | 666 | Open in IMG/M |
| 3300015343|Ga0182155_1135566 | Not Available | 607 | Open in IMG/M |
| 3300015343|Ga0182155_1157114 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 575 | Open in IMG/M |
| 3300015343|Ga0182155_1205159 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 520 | Open in IMG/M |
| 3300015344|Ga0182189_1088855 | Not Available | 715 | Open in IMG/M |
| 3300015344|Ga0182189_1127882 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 627 | Open in IMG/M |
| 3300015345|Ga0182111_1117216 | Not Available | 668 | Open in IMG/M |
| 3300015345|Ga0182111_1143391 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 619 | Open in IMG/M |
| 3300015345|Ga0182111_1153655 | Not Available | 603 | Open in IMG/M |
| 3300015346|Ga0182139_1016007 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 1322 | Open in IMG/M |
| 3300015346|Ga0182139_1075186 | Not Available | 787 | Open in IMG/M |
| 3300015346|Ga0182139_1090796 | Not Available | 735 | Open in IMG/M |
| 3300015346|Ga0182139_1178370 | Not Available | 570 | Open in IMG/M |
| 3300015346|Ga0182139_1192131 | Not Available | 553 | Open in IMG/M |
| 3300015347|Ga0182177_1064607 | Not Available | 835 | Open in IMG/M |
| 3300015347|Ga0182177_1095083 | Not Available | 725 | Open in IMG/M |
| 3300015347|Ga0182177_1170238 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 583 | Open in IMG/M |
| 3300015347|Ga0182177_1212558 | Not Available | 535 | Open in IMG/M |
| 3300015347|Ga0182177_1212869 | Not Available | 534 | Open in IMG/M |
| 3300015347|Ga0182177_1237936 | Not Available | 511 | Open in IMG/M |
| 3300015347|Ga0182177_1238564 | Not Available | 511 | Open in IMG/M |
| 3300015347|Ga0182177_1250025 | Not Available | 501 | Open in IMG/M |
| 3300015351|Ga0182161_1146829 | Not Available | 639 | Open in IMG/M |
| 3300015351|Ga0182161_1192869 | Not Available | 574 | Open in IMG/M |
| 3300015351|Ga0182161_1237414 | Not Available | 527 | Open in IMG/M |
| 3300015355|Ga0182159_1062643 | Not Available | 1032 | Open in IMG/M |
| 3300015355|Ga0182159_1064969 | Not Available | 1017 | Open in IMG/M |
| 3300015355|Ga0182159_1080038 | Not Available | 938 | Open in IMG/M |
| 3300015355|Ga0182159_1179292 | Not Available | 673 | Open in IMG/M |
| 3300015355|Ga0182159_1199027 | Not Available | 644 | Open in IMG/M |
| 3300015361|Ga0182145_1030425 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 922 | Open in IMG/M |
| 3300015361|Ga0182145_1163777 | Not Available | 533 | Open in IMG/M |
| 3300015361|Ga0182145_1168303 | Not Available | 528 | Open in IMG/M |
| 3300015361|Ga0182145_1187915 | Not Available | 508 | Open in IMG/M |
| 3300017404|Ga0182203_1050011 | Not Available | 737 | Open in IMG/M |
| 3300017404|Ga0182203_1125954 | Not Available | 549 | Open in IMG/M |
| 3300017407|Ga0182220_1072056 | Not Available | 566 | Open in IMG/M |
| 3300017409|Ga0182204_1030333 | Not Available | 758 | Open in IMG/M |
| 3300017409|Ga0182204_1056450 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 632 | Open in IMG/M |
| 3300017410|Ga0182207_1032176 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 875 | Open in IMG/M |
| 3300017410|Ga0182207_1038793 | Not Available | 826 | Open in IMG/M |
| 3300017410|Ga0182207_1098555 | Not Available | 613 | Open in IMG/M |
| 3300017410|Ga0182207_1111673 | Not Available | 588 | Open in IMG/M |
| 3300017410|Ga0182207_1160169 | Not Available | 519 | Open in IMG/M |
| 3300017410|Ga0182207_1171968 | Not Available | 507 | Open in IMG/M |
| 3300017411|Ga0182208_1106208 | Not Available | 536 | Open in IMG/M |
| 3300017411|Ga0182208_1128377 | Not Available | 503 | Open in IMG/M |
| 3300017413|Ga0182222_1060359 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 586 | Open in IMG/M |
| 3300017413|Ga0182222_1068299 | Not Available | 568 | Open in IMG/M |
| 3300017415|Ga0182202_1025190 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 855 | Open in IMG/M |
| 3300017415|Ga0182202_1028720 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 821 | Open in IMG/M |
| 3300017415|Ga0182202_1095815 | Not Available | 568 | Open in IMG/M |
| 3300017420|Ga0182228_1074304 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 615 | Open in IMG/M |
| 3300017420|Ga0182228_1130975 | Not Available | 500 | Open in IMG/M |
| 3300017424|Ga0182219_1032842 | Not Available | 789 | Open in IMG/M |
| 3300017424|Ga0182219_1050722 | Not Available | 689 | Open in IMG/M |
| 3300017425|Ga0182224_1033056 | Not Available | 830 | Open in IMG/M |
| 3300017425|Ga0182224_1052342 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 723 | Open in IMG/M |
| 3300017425|Ga0182224_1063956 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 680 | Open in IMG/M |
| 3300017425|Ga0182224_1084160 | Not Available | 625 | Open in IMG/M |
| 3300017425|Ga0182224_1091984 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria | 608 | Open in IMG/M |
| 3300017425|Ga0182224_1125551 | Not Available | 551 | Open in IMG/M |
| 3300017427|Ga0182190_1055035 | Not Available | 730 | Open in IMG/M |
| 3300017427|Ga0182190_1111364 | Not Available | 576 | Open in IMG/M |
| 3300017427|Ga0182190_1137527 | Not Available | 535 | Open in IMG/M |
| 3300017430|Ga0182192_1150608 | Not Available | 528 | Open in IMG/M |
| 3300017430|Ga0182192_1174370 | Not Available | 501 | Open in IMG/M |
| 3300017433|Ga0182206_1094657 | Not Available | 594 | Open in IMG/M |
| 3300017433|Ga0182206_1137862 | Not Available | 527 | Open in IMG/M |
| 3300017436|Ga0182209_1167847 | Not Available | 508 | Open in IMG/M |
| 3300017438|Ga0182191_1078567 | Not Available | 668 | Open in IMG/M |
| 3300017442|Ga0182221_1087824 | Not Available | 618 | Open in IMG/M |
| 3300017442|Ga0182221_1118501 | Not Available | 564 | Open in IMG/M |
| 3300017442|Ga0182221_1142176 | Not Available | 532 | Open in IMG/M |
| 3300017443|Ga0182193_1135455 | Not Available | 573 | Open in IMG/M |
| 3300017443|Ga0182193_1174626 | Not Available | 524 | Open in IMG/M |
| 3300017443|Ga0182193_1185324 | Not Available | 513 | Open in IMG/M |
| 3300017680|Ga0182233_1093843 | Not Available | 551 | Open in IMG/M |
| 3300017683|Ga0182218_1069751 | Not Available | 642 | Open in IMG/M |
| 3300017683|Ga0182218_1144962 | Not Available | 512 | Open in IMG/M |
| 3300017684|Ga0182225_1084189 | Not Available | 595 | Open in IMG/M |
| 3300017684|Ga0182225_1117896 | Not Available | 536 | Open in IMG/M |
| 3300017685|Ga0182227_1061532 | Not Available | 681 | Open in IMG/M |
| 3300017686|Ga0182205_1080013 | Not Available | 650 | Open in IMG/M |
| 3300017686|Ga0182205_1125624 | Not Available | 559 | Open in IMG/M |
| 3300017686|Ga0182205_1155171 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 520 | Open in IMG/M |
| 3300017690|Ga0182223_1016853 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 865 | Open in IMG/M |
| 3300017690|Ga0182223_1068916 | Not Available | 593 | Open in IMG/M |
| 3300017690|Ga0182223_1074572 | Not Available | 580 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 98.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017680 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0157374_123639702 | 3300013296 | Miscanthus Rhizosphere | MDHLAPLPRDSSMRVMNHAEGEQLRRAKEDKRKKK* |
| Ga0157378_126373641 | 3300013297 | Miscanthus Rhizosphere | MDHLAPLPRDSTVRTANRTEGERLRKAKEDKRKKK* |
| Ga0157378_128305192 | 3300013297 | Miscanthus Rhizosphere | MDHPAPLSRDSAVRTANHAEGEWLRKAKEDKKRKKQWKL* |
| Ga0182122_10665362 | 3300015267 | Miscanthus Phyllosphere | MDHPTLLPRDSAVRMANHVEGERLRKAKEDKNRKKQQKL* |
| Ga0182113_10632101 | 3300015269 | Miscanthus Phyllosphere | MDHPVPLPRDSSMRAANRAKGERLRKAKEDKKRNRQWKL* |
| Ga0182113_10672131 | 3300015269 | Miscanthus Phyllosphere | MDPPTPLLRDSAMRMANCAKGERLRKAKEDRKRKK* |
| Ga0182188_10531431 | 3300015274 | Miscanthus Phyllosphere | FTDHLAPLPRDSSVRALNHAEGERLRKAKEGKRKKK* |
| Ga0182172_10585522 | 3300015275 | Miscanthus Phyllosphere | MDHPAPLSRDLTVRVANCAEGERLRKAKEGKKRKK* |
| Ga0182172_10692362 | 3300015275 | Miscanthus Phyllosphere | MDHPASLPRDLAMRAVNRVEGERLRKVKEDKKRKKQ* |
| Ga0182172_10762181 | 3300015275 | Miscanthus Phyllosphere | MLLLRDSSMRAANHVEGERLRKAKEDMRKKRQQKLLA* |
| Ga0182170_10238061 | 3300015276 | Miscanthus Phyllosphere | MDHPAPLSRDSAVRTTNRAEGERLRKVKEDKKRKK* |
| Ga0182170_10336222 | 3300015276 | Miscanthus Phyllosphere | MDHLAPLSRDLAVRVANRAGGKWLWKAKEDKKRKK* |
| Ga0182128_10587602 | 3300015277 | Miscanthus Phyllosphere | MDHLALLPKDLSMRAMNHAEGERLRKKEDKKRKKQ* |
| Ga0182128_10646832 | 3300015277 | Miscanthus Phyllosphere | MDHPTPLPRDSAVRTANHTEGEWLRKAKEDKKRKKQ |
| Ga0182160_10662951 | 3300015281 | Miscanthus Phyllosphere | HMDHPALLPRGLAMRAVNHTDGERLKKAKEDKKRKK* |
| Ga0182156_10276702 | 3300015283 | Miscanthus Phyllosphere | MDHSAPLPRDSSVRVVNHAEGERLRKAKEDKKRKR* |
| Ga0182156_10875122 | 3300015283 | Miscanthus Phyllosphere | PRDLIIMDHQAPLLRDSAMRATNHVEVERLRKAKEDKKRKK* |
| Ga0182186_10241562 | 3300015285 | Miscanthus Phyllosphere | MDHPVPLPRDSAMRVVNRTKGERLRKAKEDKKRKK* |
| Ga0182186_10746401 | 3300015285 | Miscanthus Phyllosphere | MDHLASLPRDSSVRAANHAEGERLRKAKEDKRKKKH* |
| Ga0182176_10258242 | 3300015286 | Miscanthus Phyllosphere | MDHLAPLPRDSAMRIANHAEGERLRKAKEDRKRKKQ* |
| Ga0182176_10476182 | 3300015286 | Miscanthus Phyllosphere | MDHLALLPRDLAMRAANRAESERLRKVKEDKKRKK* |
| Ga0182176_10513872 | 3300015286 | Miscanthus Phyllosphere | MDHPMPLPRDSDMRVANRAKGERLRKAKEDKKRKK* |
| Ga0182176_10803001 | 3300015286 | Miscanthus Phyllosphere | MDHPVPLLRDLAMRVANHTKGEWLREAKEDKKRKKQRKLQAWE* |
| Ga0182171_10067504 | 3300015287 | Miscanthus Phyllosphere | MDHSAPLPRDSSVRAVNHAEGEQLRKEKEDKKRKR |
| Ga0182171_10137693 | 3300015287 | Miscanthus Phyllosphere | MDHPTPLPRDSSMRAMNYALGKWLRKAKEDKKRKR* |
| Ga0182171_10312801 | 3300015287 | Miscanthus Phyllosphere | MDDLAPLPRDSTMRAANHAEGKWLRKEKEGKRKKKQ |
| Ga0182173_10331711 | 3300015288 | Miscanthus Phyllosphere | MDDLALLPRDSSVRVANRAEGERLRKAKEDKRRKRQ* |
| Ga0182173_10618232 | 3300015288 | Miscanthus Phyllosphere | MDHLAPLPRDSAVRTMNRAEGERLRKAKKDRKRKRQWKL* |
| Ga0182138_10184081 | 3300015289 | Miscanthus Phyllosphere | MDHIAPLPRDSSVRVANHVEGEQLRKAKEDKKRKKQWKLRVRE* |
| Ga0182125_10161442 | 3300015291 | Miscanthus Phyllosphere | MDHPALLPRGLAMRAVNHTDGERLKKAKEDKKRKK* |
| Ga0182125_10309782 | 3300015291 | Miscanthus Phyllosphere | MDHPSSLPRDSSVRVANHAEGERLRKAKEDKRKKRQRKLQAQE* |
| Ga0182125_10447221 | 3300015291 | Miscanthus Phyllosphere | MDHPAPLPRDSAMRTANHTEGERPRKVKEDKKRKKQWKL* |
| Ga0182125_10604961 | 3300015291 | Miscanthus Phyllosphere | VVPLPRDLAVRTANHAEGERLRRAKEDRKRKKKWKL* |
| Ga0182141_10209882 | 3300015292 | Miscanthus Phyllosphere | MDHPAPLSRDSAMRAANHAEGERLWKAKEDKKRKK* |
| Ga0182141_10788411 | 3300015292 | Miscanthus Phyllosphere | MDHPAPLPRDSSMRAASHAEGKWLRKAKEDKKRKQQQKL* |
| Ga0182126_10270831 | 3300015294 | Miscanthus Phyllosphere | MDHLAPLLRDSTVRTVNRAEGEWLRKVNEDRKRKK* |
| Ga0182126_10786521 | 3300015294 | Miscanthus Phyllosphere | MDHPAPLPRDSSMRVVNHVEGEWLRKVKEDKRKKKQRRL* |
| Ga0182126_10840782 | 3300015294 | Miscanthus Phyllosphere | MEHPALLPRDSATRMMNCAEGEWLRKAKEDRKRKKQQKLQA* |
| Ga0182175_10165611 | 3300015295 | Miscanthus Phyllosphere | MDHPTLLPRDSAMRLANYAKAEWLKKAKEDKMRKRQQKLRA |
| Ga0182175_10383431 | 3300015295 | Miscanthus Phyllosphere | MDHLAPLPRDLSVRAVNHAEGERLKKAKEDKRKKRQWKL* |
| Ga0182175_10747782 | 3300015295 | Miscanthus Phyllosphere | MDHPAPLPRDLAMRVANRAEGERLRKAKDDKKRKKQWKL* |
| Ga0182157_10585601 | 3300015296 | Miscanthus Phyllosphere | MNHSAPLPRDSFVRAANHAEGERLRKAKVDKKRKRQRKLQAQE* |
| Ga0182157_10798421 | 3300015296 | Miscanthus Phyllosphere | MDHPAPLPRDLAVRAVNRAEGEWLRKAKEDKKREKQ* |
| Ga0182106_10276241 | 3300015298 | Miscanthus Phyllosphere | MDHPASLPRDLSMRAANHVKGERLRKTKEDKRKKKQ* |
| Ga0182106_10298381 | 3300015298 | Miscanthus Phyllosphere | MDHPAPLPRDSAVRVANRAKGEWLRKAKEDKKRKKQWKLRVRE* |
| Ga0182106_10301741 | 3300015298 | Miscanthus Phyllosphere | MDHPTPLPRDSAMRMANHAKGEWLRKAKEDKKRNNQQKLLA* |
| Ga0182106_10326692 | 3300015298 | Miscanthus Phyllosphere | MDLIFMDHPAPLPRDSSVRVANHAEGEWLRKAKEDKRKKKHQKL* |
| Ga0182106_10659862 | 3300015298 | Miscanthus Phyllosphere | MRDLIFMDHPAPLPRDSSMRVVNHAKGERLRKAKEDKKRKR* |
| Ga0182106_10847161 | 3300015298 | Miscanthus Phyllosphere | MDHPASLPRDSSMRAANRAEGERLRKAKEDKRKKK* |
| Ga0182107_10426142 | 3300015299 | Miscanthus Phyllosphere | MDHPTPLPRDLAMRLVNHAEGEWLRKAKDDKKRKKQWKL* |
| Ga0182107_10480831 | 3300015299 | Miscanthus Phyllosphere | MDHPMPLLRDSSVRAVNRAKGEWLRKAKEDKRKKK* |
| Ga0182107_10955551 | 3300015299 | Miscanthus Phyllosphere | PRELVFTDHPALLPRDSSMRAANRAEGERLRKAKEDKRKKKQ* |
| Ga0182108_10200892 | 3300015300 | Miscanthus Phyllosphere | LPRDSFVRATNHVEGERLRKAKEDKKRNRQWKLQAWK* |
| Ga0182108_10229831 | 3300015300 | Miscanthus Phyllosphere | MPPTDLILMDHPAPLLRDSTVRVANHTEGEQLRKAKEDKKRKK* |
| Ga0182108_10495211 | 3300015300 | Miscanthus Phyllosphere | MDHPVALPRDSSMRAANRAEGERVRKAKEDKKRKK* |
| Ga0182108_10803442 | 3300015300 | Miscanthus Phyllosphere | MDHPAPLPRDSAVRAANRAEGKRLRKVKEDWKRKKQRKLQVQER |
| Ga0182108_10819541 | 3300015300 | Miscanthus Phyllosphere | MDHPMPLLRDLAMRMVNHAEGERLRKAKEDKKRKK* |
| Ga0182143_10830992 | 3300015302 | Miscanthus Phyllosphere | MDHPVPLPRDSCVRAVNRAEGERLRKAKEDKKRKRQQKL* |
| Ga0182143_11028311 | 3300015302 | Miscanthus Phyllosphere | MDHPTPLPRDSVVRTANRAEGERLRKAKEDKKRKKQQ |
| Ga0182123_10215162 | 3300015303 | Miscanthus Phyllosphere | MDHSVSLPRDSAMRMANRIEGEWLRKAKEDKKRKRQRKL* |
| Ga0182123_10239572 | 3300015303 | Miscanthus Phyllosphere | MDHPAPLPRDSAMRAVNRAEGEWLRKAKEDKMKKE* |
| Ga0182123_10945391 | 3300015303 | Miscanthus Phyllosphere | MDHPVPLPRDSAVRVVNRAEGERLRKVKEDKKRKKMWKLWS* |
| Ga0182123_10954572 | 3300015303 | Miscanthus Phyllosphere | MDHLAPLPRELAMRVANRAEGEWLRKAKEGKKRKKKWKLRA* |
| Ga0182112_10191642 | 3300015304 | Miscanthus Phyllosphere | MDHPAPLPRDSAMRAANRAEGEWLRKAKEDKKRKKQWKL* |
| Ga0182112_10690582 | 3300015304 | Miscanthus Phyllosphere | MDHPVPLLRDSDVRVANRAEGERLRKAKDDKKRKRQQKL* |
| Ga0182158_11003612 | 3300015305 | Miscanthus Phyllosphere | MDHLVPLPRDSTMRVANSAEGKRLRKAKEDKKRKK |
| Ga0182158_11011192 | 3300015305 | Miscanthus Phyllosphere | MDHLAPLLRDSSMRAVNHVVGKGLRKAKEDKRKKKQWKL* |
| Ga0182142_10509301 | 3300015308 | Miscanthus Phyllosphere | MDHPVLLLRDSAMRTMNHAEGERLRKAKEDRKRKKQRKLQVQE* |
| Ga0182142_10606352 | 3300015308 | Miscanthus Phyllosphere | MDHPAPLPRDLAVRAVNRAEGEWLRKAKEDKKRKKQ* |
| Ga0182142_10777612 | 3300015308 | Miscanthus Phyllosphere | MDPPTSLPRDSTVRMANHTEGERLRKAKEDKKGKKQWKL* |
| Ga0182142_10794122 | 3300015308 | Miscanthus Phyllosphere | MDHPAPLPRDSAMRAVNHIEGEMLRKAKEDEERKKQRKL* |
| Ga0182142_10908081 | 3300015308 | Miscanthus Phyllosphere | MDHPAPLLRDSSMRVVNCVEGERLRKAKEDKRKKQQQKL* |
| Ga0182140_10478212 | 3300015314 | Miscanthus Phyllosphere | MDHPAPLPRDSAMRAANRAEGEWLRKAKEDKKRKKQ* |
| Ga0182140_10562801 | 3300015314 | Miscanthus Phyllosphere | FMDYLAPLPWDSSMRAANHAEGKRLRKAKEDKKRKR* |
| Ga0182140_10814722 | 3300015314 | Miscanthus Phyllosphere | MDHLASLSRDLAVSAANRAEGEQLRKAKEDKKRKK* |
| Ga0182127_10887141 | 3300015321 | Miscanthus Phyllosphere | MDHPAPLPRDSSMRVVNHVEGEWLRKVKEDKRKKKQWKLQA* |
| Ga0182110_10766552 | 3300015322 | Miscanthus Phyllosphere | MDHLVPLLRDSTMNTVNHAEGEPLRKAKDDKKRTKQRKL* |
| Ga0182110_10878551 | 3300015322 | Miscanthus Phyllosphere | MDHPVPLLRDSSVRAANHTEGERLRKAKEDKRKNKQ* |
| Ga0182110_10890551 | 3300015322 | Miscanthus Phyllosphere | LILTDHLAPLPRDSSMRVANRAEGERLRKAKEDKRKKK* |
| Ga0182110_10930822 | 3300015322 | Miscanthus Phyllosphere | MDHPTPLSRDSTMRTANHTKGEWLRKAKEDRKRKKQ* |
| Ga0182129_10319171 | 3300015323 | Miscanthus Phyllosphere | MDHPTLLPRDSFVRAANHAEGEWLRKAKEDKRKKKQPKLQARE* |
| Ga0182129_10594012 | 3300015323 | Miscanthus Phyllosphere | LRDLIFLDHPAPLPRDSSMRAVNDAKGMRLRKAKEDKKRKRQWKL* |
| Ga0182129_11172502 | 3300015323 | Miscanthus Phyllosphere | MDHPVSLPRDSFMRAVNHAEGERLRKAKEDKKRKK* |
| Ga0182187_10223312 | 3300015341 | Miscanthus Phyllosphere | MDHPTLLLRDLAMRVANSAKGERLGKAKLDKKRKKQRKLWA* |
| Ga0182187_10612182 | 3300015341 | Miscanthus Phyllosphere | MDHPAPLPRDSTMRVANLAKGEWLRKAKEDKKRKKQ* |
| Ga0182187_10897332 | 3300015341 | Miscanthus Phyllosphere | MDHPTLLPRDSTMRATNRTEGERLRKAKEDKKRKRQ* |
| Ga0182187_11273712 | 3300015341 | Miscanthus Phyllosphere | MDHLDLLPRDSSVRVVNRAKGERMRKAKDDKRRKR* |
| Ga0182187_11510361 | 3300015341 | Miscanthus Phyllosphere | MDHPAPLPRDSAMRAVNRAEGEWLRKAKEDKKRKKQWKLQVRE* |
| Ga0182187_11710161 | 3300015341 | Miscanthus Phyllosphere | MDHPASLLRDSSVRVANHVEGEWLRKAKEDKRKKKQWKL* |
| Ga0182109_11259172 | 3300015342 | Miscanthus Phyllosphere | MDHPALLPRDSSVRAANRAEGERLRKAEEDKRKKKQQKL* |
| Ga0182109_11479461 | 3300015342 | Miscanthus Phyllosphere | MDHPALLPRDLAMRAANCAEGEWLRKAKEDKKRKK* |
| Ga0182109_12018422 | 3300015342 | Miscanthus Phyllosphere | MDHPMPLLRDSSVRAVNRAKGEWLRKAKEDKMRKKQWKLRA* |
| Ga0182109_12031831 | 3300015342 | Miscanthus Phyllosphere | MDHLAPLPRDSFMRVANHVEGKRLRKAKEDKKRKR |
| Ga0182109_12179531 | 3300015342 | Miscanthus Phyllosphere | MDHPTPLPRVSSMRVVNHAEGEQLRMVKEDKKKKK* |
| Ga0182155_10533151 | 3300015343 | Miscanthus Phyllosphere | MDHPAPLPRDSGVRVVNHIEGEWLSKAKEDKKRKKQWKL* |
| Ga0182155_10636591 | 3300015343 | Miscanthus Phyllosphere | LTDHPMPLLRDSAMRTVNRAEGEWLRKAKEDRKRKK* |
| Ga0182155_11010532 | 3300015343 | Miscanthus Phyllosphere | MDHPAPLPRDSVVRVANHAKGERLRKAKEDKKRKK* |
| Ga0182155_11043861 | 3300015343 | Miscanthus Phyllosphere | MDHPVPLPRDSSMRAANHAKCEWLRKTKEDNKRKRQRKL* |
| Ga0182155_11355661 | 3300015343 | Miscanthus Phyllosphere | MDHPAPLLRDSSMRAVNRAEGERLRKAKEDKKRKRQRKL* |
| Ga0182155_11571142 | 3300015343 | Miscanthus Phyllosphere | MDHMTLLLRDLAMRVVNHAEGERLRKTKEDKKRKKQWKL* |
| Ga0182155_12051591 | 3300015343 | Miscanthus Phyllosphere | MDHPVPLLRYSSVRVANHARGKQLRKAKEDKKRKKQW |
| Ga0182189_10888552 | 3300015344 | Miscanthus Phyllosphere | MDHLAPLPRDSAVWAANHAQGERLRKVKEDKRKKKQWKL* |
| Ga0182189_11278822 | 3300015344 | Miscanthus Phyllosphere | MDHPAPLPRDSAVRAANHAEGERLRKVKEDKKGKKQRKLQAWE* |
| Ga0182111_11172162 | 3300015345 | Miscanthus Phyllosphere | MDHPMPLPRDSIVRTANHAEGEQLRKAKDDKKRKKQ* |
| Ga0182111_11433912 | 3300015345 | Miscanthus Phyllosphere | MDHPAPLPRDSSVRAANHDEGERLRKAKEDKKRKRQRKL* |
| Ga0182111_11536551 | 3300015345 | Miscanthus Phyllosphere | MDHLTPLPRDLAVRVVNHAEGERLRKVKEDEKRKK* |
| Ga0182111_12139121 | 3300015345 | Miscanthus Phyllosphere | MDHPAPLLRDLAMRAGNRTEGERLRKANEDKRKKRWWKLLA* |
| Ga0182139_10160071 | 3300015346 | Miscanthus Phyllosphere | MDHLAPLPRDSVMRAANHIEGEWLRKAKEDKKKKK* |
| Ga0182139_10751862 | 3300015346 | Miscanthus Phyllosphere | MDHSALLPRDLAMRAMNRAEGERLRKAKEDKKRKKQ* |
| Ga0182139_10907961 | 3300015346 | Miscanthus Phyllosphere | MDHLPPWLRDSSMRAVNRAEGERLRKAKEDKRKKKQWKL* |
| Ga0182139_11783701 | 3300015346 | Miscanthus Phyllosphere | MDHPAPLLRDSSMRVVNCAEGERLRKVKEDKRKKKQWKL* |
| Ga0182139_11921311 | 3300015346 | Miscanthus Phyllosphere | MDHPVLLPRDLAMRTVNHAEGKRLRKEKEDRKRKKQ* |
| Ga0182139_12423842 | 3300015346 | Miscanthus Phyllosphere | MDHLALLPRDSSVRAANRAEGKRLRKAMEDKRKKRPQKL* |
| Ga0182177_10646072 | 3300015347 | Miscanthus Phyllosphere | MDHPVSLPRDSTVRAANRAEGKRLRKAKEDKKRKKQ* |
| Ga0182177_10950832 | 3300015347 | Miscanthus Phyllosphere | MDHPMPLLRDSAVRMANHAEDERPRKAKEDKNRKKQQKL* |
| Ga0182177_11702382 | 3300015347 | Miscanthus Phyllosphere | MDHPTPLLRDSAVRMANRTEGERLRKAKEDKKRKKQQGLWAWE* |
| Ga0182177_12125581 | 3300015347 | Miscanthus Phyllosphere | MDHPAPLPRDSSMRAANRAVCERLRKAEEDKRKKKQQKL* |
| Ga0182177_12128691 | 3300015347 | Miscanthus Phyllosphere | MDHLAPLLRDSSIRAVNHIEGERLRKEKEDKRKKQQKLQT* |
| Ga0182177_12379362 | 3300015347 | Miscanthus Phyllosphere | MDHPVPLSRDSTVRAANRAKGEQLRKAKEDKKRKL* |
| Ga0182177_12385642 | 3300015347 | Miscanthus Phyllosphere | MDHLAPLPRDSTVRVVNHAEGERLRKVKEDEGKKRQRKL* |
| Ga0182177_12500252 | 3300015347 | Miscanthus Phyllosphere | MDHPTPLSRDLVVRMANHAEGEWLRKVKEDKKRKK* |
| Ga0182161_11468291 | 3300015351 | Miscanthus Phyllosphere | MDHSTPLLRDSSVRATNRAKGERLRKAKEDKKRKRQ* |
| Ga0182161_11928693 | 3300015351 | Miscanthus Phyllosphere | MDHPAPLPRDSFVRAVNHAEGERLRKAKEDKKRKRQ* |
| Ga0182161_12374142 | 3300015351 | Miscanthus Phyllosphere | MDHPTPLLRDSAMRAANHAEDERLRKVKEDKKKKR* |
| Ga0182159_10626433 | 3300015355 | Miscanthus Phyllosphere | MDHLVPLPRDSTVRVANHAKGEQLRKAKEDNKTKKQRKLRARE* |
| Ga0182159_10649692 | 3300015355 | Miscanthus Phyllosphere | MDHPVPLPRDSAVRTVNHTEGERLRKAKEDKKRKK* |
| Ga0182159_10800382 | 3300015355 | Miscanthus Phyllosphere | MDHPAPLLRDSSMRVVNHAEGEWLRKAKEDKKRKR* |
| Ga0182159_11792921 | 3300015355 | Miscanthus Phyllosphere | MDHLAPLLRDSAMRTVNHVKGEWLRKAKEDKKRKKQW* |
| Ga0182159_11990272 | 3300015355 | Miscanthus Phyllosphere | MDHSALLLRDSAMRMVNHAMGERLRKAKEDRKRKKQ* |
| Ga0182145_10304251 | 3300015361 | Miscanthus Phyllosphere | MDHPVPLPRDLSVRAANHAEGERLRKAKEDKGKKRQ* |
| Ga0182145_11637771 | 3300015361 | Miscanthus Phyllosphere | MDHLAPLLRDSSMRAVNHAEGEWLRKAKEDKKRKRQ* |
| Ga0182145_11683031 | 3300015361 | Miscanthus Phyllosphere | MDHPVPLPRDSSMRAANHAEGERLRKAKADKNRKRQRKLQARE* |
| Ga0182145_11879151 | 3300015361 | Miscanthus Phyllosphere | MDHLAPLPRDSSVRVANHAEGEQLRKAKEDKKRKK* |
| Ga0182203_10500112 | 3300017404 | Miscanthus Phyllosphere | MDHPALLPRDSVVREANRAEGEQLRKAKEDKKRKK |
| Ga0182203_11160642 | 3300017404 | Miscanthus Phyllosphere | MDHPALLPRDSSMRAMNHVEGERLMKAKEDRRKKR |
| Ga0182203_11259541 | 3300017404 | Miscanthus Phyllosphere | MDHPAPLPRDSAGRTVNRAEGKRLRKAKEDKERKKQ |
| Ga0182220_10720561 | 3300017407 | Miscanthus Phyllosphere | MDHLAPLPRDPAVRMVNRAKGERLRKVKEDKKRKKH |
| Ga0182204_10303332 | 3300017409 | Miscanthus Phyllosphere | MDHSAPLPRDSTVRMANRAEGERLRKVKEDKKRKKMWKLWS |
| Ga0182204_10564502 | 3300017409 | Miscanthus Phyllosphere | MDHLVPLPRDSTVRVANHAKGEQLRKAKEDNKTKKQRKLRARE |
| Ga0182207_10321761 | 3300017410 | Miscanthus Phyllosphere | MDHPVPLLRDSAMMMMNRVEGKRLRKAKEDKKSKKQWKL |
| Ga0182207_10387933 | 3300017410 | Miscanthus Phyllosphere | MDHLMLLLRDSAMRAANHAEGERLRKAKEDKKKKKQ |
| Ga0182207_10985551 | 3300017410 | Miscanthus Phyllosphere | DLILMDHPALLLRDSSMRVTNHAEGERLRKVKEDKRKKR |
| Ga0182207_11116732 | 3300017410 | Miscanthus Phyllosphere | MDYTASLLRDSSMRVVNRAEGERLRKTKEDKKRKRQ |
| Ga0182207_11601692 | 3300017410 | Miscanthus Phyllosphere | MDHPVPLPRDLAVRMANRAGGERLRKAKEDKKRKKQWKL |
| Ga0182207_11719681 | 3300017410 | Miscanthus Phyllosphere | MDHPTPLSRDSTMRTANHAKGERLRKAKEDRKRKKQ |
| Ga0182208_10457221 | 3300017411 | Miscanthus Phyllosphere | LMRDLIFMDHLAPLPRDSSMRALNHAKGERLRKAKEDKRKKKQ |
| Ga0182208_11062081 | 3300017411 | Miscanthus Phyllosphere | MDHLAPLPRDSSMRVMNHAEGEQLRRAKEDKRKKK |
| Ga0182208_11283773 | 3300017411 | Miscanthus Phyllosphere | MDHSAPLPRDSTVRAANHAEGEWLRKAKEDKKRKKQ |
| Ga0182222_10603591 | 3300017413 | Miscanthus Phyllosphere | MDHPALLPRDLTVRTVNHADGERLRRVTEDKKRKKRWKL |
| Ga0182222_10682992 | 3300017413 | Miscanthus Phyllosphere | MDHPAPLPRDSSVRATNHAEGERLRKAKEDKRRKRQ |
| Ga0182202_10251902 | 3300017415 | Miscanthus Phyllosphere | MDHPALLLRDSSMRTANHVEGKRLRKAKEDKNRKKQWKL |
| Ga0182202_10287202 | 3300017415 | Miscanthus Phyllosphere | MDHPALLPRDLAMRAANHAEGERSRNAKEDKKRKKQQKL |
| Ga0182202_10958152 | 3300017415 | Miscanthus Phyllosphere | MDHPVPLLRDSSVMVANHVEGERLRKVKEDKRKKKQWKL |
| Ga0182228_10743042 | 3300017420 | Miscanthus Phyllosphere | MDDPVLLPRDLAMRTANRAEGEQLRKTKEDKKRKK |
| Ga0182228_11309752 | 3300017420 | Miscanthus Phyllosphere | MDHPAPLPRDSVMRAANRAEGERLRKAKEDKKRKK |
| Ga0182219_10328421 | 3300017424 | Miscanthus Phyllosphere | MDHPAPLPRDSSMRVVNSTEGEWLRKAKEDQKRKW |
| Ga0182219_10507222 | 3300017424 | Miscanthus Phyllosphere | MDHPVLLLRDSAMRTMNHAEGERLRKAKEDKKRKKQWKL |
| Ga0182219_10849481 | 3300017424 | Miscanthus Phyllosphere | MDHPTPLPRDLFVRAANHDEGERLRKEKEDKRKNKQWKL |
| Ga0182219_11197301 | 3300017424 | Miscanthus Phyllosphere | MDHPAPLLRDLAVRTANHLEGEQLRKAKDKKRKKE |
| Ga0182224_10330561 | 3300017425 | Miscanthus Phyllosphere | RDLILMDHPMPLPRDSTMRTANHTEGELLRKAKEDKKRKK |
| Ga0182224_10523421 | 3300017425 | Miscanthus Phyllosphere | MDHLALLPRDSAMRTVNHAKGERLRKAKEDKRKKRQ |
| Ga0182224_10639562 | 3300017425 | Miscanthus Phyllosphere | MDHPASLPRDSAVRTANHAEGEWLRKAKEDKKRKKQWKL |
| Ga0182224_10841601 | 3300017425 | Miscanthus Phyllosphere | MDHPVSLPRDSSMRATNCAEGERLRKAKGDKKRKKQQNL |
| Ga0182224_10919841 | 3300017425 | Miscanthus Phyllosphere | MDHPTLLPRDSFVRAANHAEGEWLRKAKEDKRKKKQPKLQARE |
| Ga0182224_11255512 | 3300017425 | Miscanthus Phyllosphere | MDHPTPLPRDSAVRVANRVKGERLRKAEVDKKRKKQ |
| Ga0182190_10550352 | 3300017427 | Miscanthus Phyllosphere | MDHLAPLPRDSTVRTANRTEGERLRKAKEDKKRKKQ |
| Ga0182190_11113642 | 3300017427 | Miscanthus Phyllosphere | MDHPTLLLRDSVMRMMNHAKGERLRKAKEDKKRKK |
| Ga0182190_11375272 | 3300017427 | Miscanthus Phyllosphere | MDHSAPLPRESAMRAANRVEGERLSKAKENKKRKKQ |
| Ga0182192_11506081 | 3300017430 | Miscanthus Phyllosphere | MDLILMDHSAPLSRDLAVRMANRAEGEQLRKAKEDQKRKKQ |
| Ga0182192_11743702 | 3300017430 | Miscanthus Phyllosphere | MDHLTPLLRDSTMRAVNRAEGERLRKAKEDKKRKK |
| Ga0182206_10946571 | 3300017433 | Miscanthus Phyllosphere | MDHLAPLPRDSSVRAVNHAEGEQLRKAKEDKKRKRQRKL |
| Ga0182206_11378621 | 3300017433 | Miscanthus Phyllosphere | MDHLAPLPRDSAVRMANRTEGERLRKAKEDKKRKKQWKLQAWGMRGGH |
| Ga0182209_11678472 | 3300017436 | Miscanthus Phyllosphere | MDHPAPLLRDSAMRTANHAEGEWPMKAKEDKRRKRQRKL |
| Ga0182191_10785672 | 3300017438 | Miscanthus Phyllosphere | MDHLALLPRDSAMRTANGIEGEQLRKAKEDKERKK |
| Ga0182221_10878242 | 3300017442 | Miscanthus Phyllosphere | MDHPAPLPRDSAMRAVNHIEGEMLRKAKEDEERKKQRKL |
| Ga0182221_11185012 | 3300017442 | Miscanthus Phyllosphere | MDHPMPLLRDSAVRVVNRAEGERLRKAKEDKKRKK |
| Ga0182221_11421763 | 3300017442 | Miscanthus Phyllosphere | DHPALLPRDSSMRAANRTKGEQLRKAKEDKRKKRQ |
| Ga0182193_11354552 | 3300017443 | Miscanthus Phyllosphere | MDHLASLPRDSAVRTVNRAEGEWLRKAREDKKRKKQLKL |
| Ga0182193_11746262 | 3300017443 | Miscanthus Phyllosphere | MDHLAPLLRDSSMRVAIRTEGERLRKEKEDNRRKR |
| Ga0182193_11853241 | 3300017443 | Miscanthus Phyllosphere | MDHPAPLLRDSTVRTVNRAKGEWLRKVNEDRKRKK |
| Ga0182233_10938432 | 3300017680 | Miscanthus Phyllosphere | MDHPAPLPRDSAMRAVNRAEGEWLRKAKEDKKRKKQWKLQARE |
| Ga0182218_10697512 | 3300017683 | Miscanthus Phyllosphere | MDHLAPLPREPSGREANHAKAEQLRKAKEDKKRKK |
| Ga0182218_11449622 | 3300017683 | Miscanthus Phyllosphere | MDHPAPLLRDSSMRVVNHAEGEWLRKAKEDKKRKR |
| Ga0182225_10841891 | 3300017684 | Miscanthus Phyllosphere | TDQPMPLPWDLAVRTMNHAEDERLRRAKEDKKRKKQQKLQAWE |
| Ga0182225_11178961 | 3300017684 | Miscanthus Phyllosphere | LMDHLAPLPRDSSMRTVNHAEGERMRKAKEDKRKKQQQKL |
| Ga0182227_10615321 | 3300017685 | Miscanthus Phyllosphere | MDHPTPLPRYSAVRTANRAEGERLSKAKKDMKRKRQ |
| Ga0182227_11245931 | 3300017685 | Miscanthus Phyllosphere | MDHLAPLLRDSSVRAANRAKGERLRKVKEDKRRKRQQKLQVHE |
| Ga0182205_10800131 | 3300017686 | Miscanthus Phyllosphere | LMDHPTPLSRDSTMRTANHAKGERLRKAKEDRKRKK |
| Ga0182205_11256241 | 3300017686 | Miscanthus Phyllosphere | MDHPALLLRDSSVRVANHVEGERLRKTKEDKKRKRQ |
| Ga0182205_11551711 | 3300017686 | Miscanthus Phyllosphere | MDLILMDHPAPLLRDSSMRAVNHAKGEQLWKAKEDKRNKR |
| Ga0182223_10168531 | 3300017690 | Miscanthus Phyllosphere | MDHLTPLLRDSAMRAANHAEGERLRKAKEDKKAKK |
| Ga0182223_10689161 | 3300017690 | Miscanthus Phyllosphere | PRDLIFTDHPTLLPRDSSVRVANCAEGEWLRQVKEDKKRKRQRKL |
| Ga0182223_10745721 | 3300017690 | Miscanthus Phyllosphere | MDHPTPLSRDSAVRVANRAKGERLRKAMEDKKRKRRRKL |
| ⦗Top⦘ |