NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F027685

Metagenome Family F027685

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F027685
Family Type Metagenome
Number of Sequences 194
Average Sequence Length 69 residues
Representative Sequence MEMDMEQAQAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG
Number of Associated Samples 120
Number of Associated Scaffolds 194

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 83.51 %
% of genes near scaffold ends (potentially truncated) 25.26 %
% of genes from short scaffolds (< 2000 bps) 79.90 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group unclassified viruses (60.309 % of family members)
NCBI Taxonomy ID 12429
Taxonomy All Organisms → Viruses → unclassified viruses

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(35.567 % of family members)
Environment Ontology (ENVO) Unclassified
(86.082 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(95.361 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.02%    β-sheet: 0.00%    Coil/Unstructured: 48.98%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 194 Family Scaffolds
PF02794HlyC 18.04
PF03237Terminase_6N 1.03
PF03906Phage_T7_tail 0.52
PF00959Phage_lysozyme 0.52

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 194 Family Scaffolds
COG2994ACP:hemolysin acyltransferase (hemolysin-activating protein)Posttranslational modification, protein turnover, chaperones [O] 18.04

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.60 %
UnclassifiedrootN/A13.40 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10021308All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3158Open in IMG/M
3300000116|DelMOSpr2010_c10056531All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1678Open in IMG/M
3300001450|JGI24006J15134_10016091All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3534Open in IMG/M
3300001450|JGI24006J15134_10076659Not Available1264Open in IMG/M
3300001450|JGI24006J15134_10096245All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1072Open in IMG/M
3300001460|JGI24003J15210_10008656All Organisms → cellular organisms → Bacteria → Proteobacteria4205Open in IMG/M
3300001460|JGI24003J15210_10050074Not Available1398Open in IMG/M
3300001460|JGI24003J15210_10099887Not Available833Open in IMG/M
3300001472|JGI24004J15324_10007126All Organisms → cellular organisms → Bacteria → Proteobacteria4184Open in IMG/M
3300001472|JGI24004J15324_10007727All Organisms → cellular organisms → Bacteria → Proteobacteria3992Open in IMG/M
3300001472|JGI24004J15324_10038683All Organisms → cellular organisms → Bacteria1491Open in IMG/M
3300001472|JGI24004J15324_10106384All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.711Open in IMG/M
3300001589|JGI24005J15628_10156410All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.686Open in IMG/M
3300001720|JGI24513J20088_1027614Not Available585Open in IMG/M
3300001969|GOS2233_1110383All Organisms → cellular organisms → Bacteria1711Open in IMG/M
3300004097|Ga0055584_100180552All Organisms → cellular organisms → Bacteria2138Open in IMG/M
3300004097|Ga0055584_101569976All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.682Open in IMG/M
3300004448|Ga0065861_1054252All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.986Open in IMG/M
3300004457|Ga0066224_1026045All Organisms → cellular organisms → Bacteria2898Open in IMG/M
3300004460|Ga0066222_1028286All Organisms → cellular organisms → Bacteria → Proteobacteria4734Open in IMG/M
3300004460|Ga0066222_1028369Not Available1465Open in IMG/M
3300004460|Ga0066222_1087599Not Available538Open in IMG/M
3300005057|Ga0068511_1001842All Organisms → cellular organisms → Bacteria → Proteobacteria2225Open in IMG/M
3300005086|Ga0072334_10313291Not Available754Open in IMG/M
3300005086|Ga0072334_10413061All Organisms → cellular organisms → Bacteria → Proteobacteria1796Open in IMG/M
3300005239|Ga0073579_1063259All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1227Open in IMG/M
3300006026|Ga0075478_10000945All Organisms → Viruses10607Open in IMG/M
3300006026|Ga0075478_10053145All Organisms → Viruses → Predicted Viral1326Open in IMG/M
3300006026|Ga0075478_10198793All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.613Open in IMG/M
3300006027|Ga0075462_10042939All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1445Open in IMG/M
3300006029|Ga0075466_1036270All Organisms → Viruses → Predicted Viral1513Open in IMG/M
3300006029|Ga0075466_1052287All Organisms → Viruses → Predicted Viral1201Open in IMG/M
3300006029|Ga0075466_1154542All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.589Open in IMG/M
3300006029|Ga0075466_1186152All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.520Open in IMG/M
3300006735|Ga0098038_1001506All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.10046Open in IMG/M
3300006735|Ga0098038_1008904All Organisms → cellular organisms → Bacteria → Proteobacteria3980Open in IMG/M
3300006735|Ga0098038_1050992All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1494Open in IMG/M
3300006735|Ga0098038_1059709All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1364Open in IMG/M
3300006735|Ga0098038_1230794Not Available590Open in IMG/M
3300006735|Ga0098038_1249302All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.561Open in IMG/M
3300006735|Ga0098038_1271268All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.532Open in IMG/M
3300006737|Ga0098037_1154048All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.770Open in IMG/M
3300006749|Ga0098042_1007638All Organisms → cellular organisms → Bacteria → Proteobacteria3521Open in IMG/M
3300006749|Ga0098042_1011832All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2716Open in IMG/M
3300006749|Ga0098042_1015259All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2331Open in IMG/M
3300006749|Ga0098042_1039337All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1313Open in IMG/M
3300006752|Ga0098048_1121175All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300006752|Ga0098048_1218544All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.560Open in IMG/M
3300006802|Ga0070749_10047773All Organisms → Viruses → Predicted Viral2613Open in IMG/M
3300006802|Ga0070749_10137152All Organisms → Viruses → Predicted Viral1429Open in IMG/M
3300006810|Ga0070754_10012268All Organisms → cellular organisms → Bacteria → Proteobacteria5315Open in IMG/M
3300006810|Ga0070754_10411804All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.590Open in IMG/M
3300006916|Ga0070750_10038127All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2369Open in IMG/M
3300006916|Ga0070750_10126042All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1172Open in IMG/M
3300006916|Ga0070750_10186494All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.924Open in IMG/M
3300006919|Ga0070746_10061838All Organisms → Viruses → Predicted Viral1929Open in IMG/M
3300006919|Ga0070746_10159975All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1092Open in IMG/M
3300006922|Ga0098045_1036415All Organisms → Viruses → Predicted Viral1252Open in IMG/M
3300007229|Ga0075468_10043602All Organisms → Viruses → Predicted Viral1549Open in IMG/M
3300007229|Ga0075468_10153557All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.696Open in IMG/M
3300007345|Ga0070752_1059731All Organisms → Viruses → Predicted Viral1719Open in IMG/M
3300007539|Ga0099849_1300467Not Available579Open in IMG/M
3300007963|Ga0110931_1062515All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1124Open in IMG/M
3300007963|Ga0110931_1169445All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.654Open in IMG/M
3300007963|Ga0110931_1180133Not Available633Open in IMG/M
3300008216|Ga0114898_1038145All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1576Open in IMG/M
3300008217|Ga0114899_1180652All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.676Open in IMG/M
3300008218|Ga0114904_1070012All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.886Open in IMG/M
3300008218|Ga0114904_1112364All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.656Open in IMG/M
3300008219|Ga0114905_1084434All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1118Open in IMG/M
3300008220|Ga0114910_1105938Not Available833Open in IMG/M
3300009413|Ga0114902_1053291All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1166Open in IMG/M
3300009414|Ga0114909_1073040Not Available974Open in IMG/M
3300009414|Ga0114909_1089279All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.857Open in IMG/M
3300009418|Ga0114908_1152817Not Available740Open in IMG/M
3300009476|Ga0115555_1091058All Organisms → Viruses → Predicted Viral1319Open in IMG/M
3300009512|Ga0115003_10476873All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.731Open in IMG/M
3300009550|Ga0115013_10098911All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1658Open in IMG/M
3300009603|Ga0114911_1108444All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.804Open in IMG/M
3300009604|Ga0114901_1179544All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.623Open in IMG/M
3300009620|Ga0114912_1071960All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.853Open in IMG/M
3300010148|Ga0098043_1042112All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1415Open in IMG/M
3300010148|Ga0098043_1056245All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1196Open in IMG/M
3300010148|Ga0098043_1078378All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.982Open in IMG/M
3300010148|Ga0098043_1205902All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.544Open in IMG/M
3300010300|Ga0129351_1180146All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.826Open in IMG/M
3300010883|Ga0133547_11165493All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1475Open in IMG/M
3300011128|Ga0151669_113904All Organisms → cellular organisms → Bacteria → Proteobacteria6405Open in IMG/M
3300011129|Ga0151672_129935All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1940Open in IMG/M
3300011252|Ga0151674_1019460All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.652Open in IMG/M
3300011258|Ga0151677_1022646All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.732Open in IMG/M
3300012953|Ga0163179_10800239All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.808Open in IMG/M
3300017697|Ga0180120_10135796All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1050Open in IMG/M
3300017713|Ga0181391_1019428All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1698Open in IMG/M
3300017719|Ga0181390_1044725All Organisms → Viruses → Predicted Viral1322Open in IMG/M
3300017726|Ga0181381_1000043Not Available34313Open in IMG/M
3300017727|Ga0181401_1122818Not Available647Open in IMG/M
3300017732|Ga0181415_1017282All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1684Open in IMG/M
3300017733|Ga0181426_1039623All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.929Open in IMG/M
3300017737|Ga0187218_1051307All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1026Open in IMG/M
3300017738|Ga0181428_1050704All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.967Open in IMG/M
3300017741|Ga0181421_1057944All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1026Open in IMG/M
3300017744|Ga0181397_1197532All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.504Open in IMG/M
3300017748|Ga0181393_1078705All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.866Open in IMG/M
3300017750|Ga0181405_1120416All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.655Open in IMG/M
3300017760|Ga0181408_1133616All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.641Open in IMG/M
3300017764|Ga0181385_1031586All Organisms → Viruses → Predicted Viral1674Open in IMG/M
3300017764|Ga0181385_1204923All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.596Open in IMG/M
3300017765|Ga0181413_1051508All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1275Open in IMG/M
3300017769|Ga0187221_1139480All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.722Open in IMG/M
3300017769|Ga0187221_1211296All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.557Open in IMG/M
3300017770|Ga0187217_1043137All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1583Open in IMG/M
3300017770|Ga0187217_1127310Not Available859Open in IMG/M
3300017949|Ga0181584_10458343All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.790Open in IMG/M
3300018421|Ga0181592_10002291All Organisms → cellular organisms → Bacteria15723Open in IMG/M
3300020274|Ga0211658_1007453All Organisms → cellular organisms → Bacteria2715Open in IMG/M
3300020414|Ga0211523_10300200All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.657Open in IMG/M
3300020424|Ga0211620_10477483All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.524Open in IMG/M
3300020439|Ga0211558_10562459All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.515Open in IMG/M
3300020469|Ga0211577_10245224All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1157Open in IMG/M
3300022065|Ga0212024_1026065All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.977Open in IMG/M
3300022068|Ga0212021_1009632All Organisms → Viruses → Predicted Viral1615Open in IMG/M
3300022068|Ga0212021_1125713All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.525Open in IMG/M
3300022072|Ga0196889_1051567All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.797Open in IMG/M
3300022072|Ga0196889_1097336All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.538Open in IMG/M
3300022074|Ga0224906_1001179All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.13086Open in IMG/M
3300022074|Ga0224906_1001603All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.11018Open in IMG/M
3300022074|Ga0224906_1078744All Organisms → Viruses → Predicted Viral1001Open in IMG/M
3300022164|Ga0212022_1048033All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.660Open in IMG/M
3300022178|Ga0196887_1038196All Organisms → Viruses → Predicted Viral1291Open in IMG/M
3300022178|Ga0196887_1066457All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.877Open in IMG/M
3300022187|Ga0196899_1198495Not Available532Open in IMG/M
3300023176|Ga0255772_10089606All Organisms → Viruses → Predicted Viral1972Open in IMG/M
3300025071|Ga0207896_1006698All Organisms → cellular organisms → Bacteria2092Open in IMG/M
3300025071|Ga0207896_1069971Not Available548Open in IMG/M
3300025071|Ga0207896_1074373All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.525Open in IMG/M
3300025086|Ga0208157_1001375All Organisms → cellular organisms → Bacteria → Proteobacteria11085Open in IMG/M
3300025086|Ga0208157_1006155All Organisms → Viruses → Predicted Viral4272Open in IMG/M
3300025086|Ga0208157_1028976All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1612Open in IMG/M
3300025086|Ga0208157_1081281All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.808Open in IMG/M
3300025098|Ga0208434_1113176All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.518Open in IMG/M
3300025101|Ga0208159_1011602All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2353Open in IMG/M
3300025101|Ga0208159_1029728All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1249Open in IMG/M
3300025102|Ga0208666_1129347All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.588Open in IMG/M
3300025102|Ga0208666_1153726Not Available511Open in IMG/M
3300025120|Ga0209535_1010566All Organisms → cellular organisms → Bacteria → Proteobacteria5210Open in IMG/M
3300025120|Ga0209535_1018214All Organisms → cellular organisms → Bacteria → Proteobacteria3637Open in IMG/M
3300025120|Ga0209535_1076503Not Available1289Open in IMG/M
3300025120|Ga0209535_1089817All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1133Open in IMG/M
3300025120|Ga0209535_1144145All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.764Open in IMG/M
3300025120|Ga0209535_1191391All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.588Open in IMG/M
3300025120|Ga0209535_1202162All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.557Open in IMG/M
3300025127|Ga0209348_1151390All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.681Open in IMG/M
3300025127|Ga0209348_1222775All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.515Open in IMG/M
3300025128|Ga0208919_1102201All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.922Open in IMG/M
3300025128|Ga0208919_1119083All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.838Open in IMG/M
3300025137|Ga0209336_10075231Not Available994Open in IMG/M
3300025138|Ga0209634_1002027All Organisms → cellular organisms → Bacteria14395Open in IMG/M
3300025138|Ga0209634_1105028All Organisms → Viruses → Predicted Viral1240Open in IMG/M
3300025151|Ga0209645_1178688All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.639Open in IMG/M
3300025168|Ga0209337_1116247Not Available1215Open in IMG/M
3300025168|Ga0209337_1171154Not Available916Open in IMG/M
3300025280|Ga0208449_1128982All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.567Open in IMG/M
3300025282|Ga0208030_1041227All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1358Open in IMG/M
3300025282|Ga0208030_1078296Not Available872Open in IMG/M
3300025293|Ga0208934_1066387All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.638Open in IMG/M
3300025508|Ga0208148_1111065All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.577Open in IMG/M
3300025610|Ga0208149_1136376All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.568Open in IMG/M
3300025630|Ga0208004_1056040All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1044Open in IMG/M
3300025652|Ga0208134_1096972All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.822Open in IMG/M
3300025653|Ga0208428_1030482All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1724Open in IMG/M
3300025759|Ga0208899_1129940Not Available892Open in IMG/M
3300027833|Ga0209092_10060541All Organisms → Viruses → Predicted Viral2318Open in IMG/M
3300027859|Ga0209503_10303577All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.778Open in IMG/M
3300028125|Ga0256368_1065586All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.626Open in IMG/M
3300029309|Ga0183683_1001908All Organisms → cellular organisms → Bacteria → Proteobacteria8062Open in IMG/M
3300029309|Ga0183683_1005556All Organisms → cellular organisms → Bacteria → Proteobacteria3804Open in IMG/M
3300029309|Ga0183683_1018961All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1450Open in IMG/M
3300029318|Ga0185543_1022544All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1467Open in IMG/M
3300029318|Ga0185543_1023172All Organisms → Viruses → Predicted Viral1442Open in IMG/M
3300029319|Ga0183748_1039820All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1425Open in IMG/M
3300029448|Ga0183755_1004865All Organisms → cellular organisms → Bacteria6340Open in IMG/M
3300029448|Ga0183755_1035577All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1407Open in IMG/M
3300029448|Ga0183755_1096315All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.593Open in IMG/M
3300029787|Ga0183757_1007938All Organisms → cellular organisms → Bacteria → Proteobacteria3244Open in IMG/M
3300029787|Ga0183757_1019571All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1645Open in IMG/M
3300031519|Ga0307488_10300710Not Available1033Open in IMG/M
3300031578|Ga0307376_10574261All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.721Open in IMG/M
3300032274|Ga0316203_1219010All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.523Open in IMG/M
3300034374|Ga0348335_012672All Organisms → Viruses → Predicted Viral4491Open in IMG/M
3300034374|Ga0348335_047517All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1688Open in IMG/M
3300034375|Ga0348336_008689All Organisms → cellular organisms → Bacteria → Proteobacteria6405Open in IMG/M
3300034375|Ga0348336_028092All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2713Open in IMG/M
3300034418|Ga0348337_136568All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.720Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine35.57%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous21.13%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater11.86%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean8.76%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine8.25%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.58%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.06%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.55%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.03%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.03%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.03%
WaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Water1.03%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.52%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.52%
Marine WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water0.52%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.52%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.52%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.52%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.52%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.52%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300001720Marine viral communities from the Pacific Ocean - LP-36EnvironmentalOpen in IMG/M
3300001969Marine microbial communities from Yucatan Channel, Mexico - GS017EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004457Marine viral communities from Newfoundland, Canada MC-1EnvironmentalOpen in IMG/M
3300004460Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300005057Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2umEnvironmentalOpen in IMG/M
3300005086Microbial Community from Halfdan Field MHDA3EnvironmentalOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300008216Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_GeostarEnvironmentalOpen in IMG/M
3300008217Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215EnvironmentalOpen in IMG/M
3300008218Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6EnvironmentalOpen in IMG/M
3300008219Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05EnvironmentalOpen in IMG/M
3300008220Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908EnvironmentalOpen in IMG/M
3300009413Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12EnvironmentalOpen in IMG/M
3300009414Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906EnvironmentalOpen in IMG/M
3300009418Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17EnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009603Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904EnvironmentalOpen in IMG/M
3300009604Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16EnvironmentalOpen in IMG/M
3300009620Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51EnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300011128Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.02EnvironmentalOpen in IMG/M
3300011129Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, 0.02EnvironmentalOpen in IMG/M
3300011252Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeateEnvironmentalOpen in IMG/M
3300011258Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeateEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017733Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020274Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX556029-ERR598943)EnvironmentalOpen in IMG/M
3300020414Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028)EnvironmentalOpen in IMG/M
3300020424Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556056-ERR599138)EnvironmentalOpen in IMG/M
3300020439Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300023176Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaGEnvironmentalOpen in IMG/M
3300025071Marine viral communities from the Pacific Ocean - LP-36 (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025101Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025280Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes)EnvironmentalOpen in IMG/M
3300025282Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes)EnvironmentalOpen in IMG/M
3300025293Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 (SPAdes)EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025653Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027859Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028125Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SBEnvironmentalOpen in IMG/M
3300029309Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440EnvironmentalOpen in IMG/M
3300029318Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289EnvironmentalOpen in IMG/M
3300029319Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516EnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300029787Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031578Soil microbial communities from Risofladan, Vaasa, Finland - TR-2EnvironmentalOpen in IMG/M
3300032274Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1002130853300000116MarineMIEIDMDRADQAYQSLSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFQKPRRKMDAQMRQMAAGMLMR*
DelMOSpr2010_1005653123300000116MarineMEIDLAAADAAYQGLSEQEKEIVREALDSPLAAVLSKIFPELMTAIGTLNKPRRKMDAEMQQVAARMLQQ*
JGI24006J15134_1001609143300001450MarineMQIDMEQAQAAYASLSEQERELIREAMDSPLAGVLSKIFPDLMGALGSFNKPRRKMDAAQRQMAAGMLMG*
JGI24006J15134_1007665923300001450MarineMEMNMEQAQAAYASLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG*
JGI24006J15134_1009624523300001450MarineMEMDMKQAKAAYQSLSEQERELIREVMDSPLAGVLAKIFPDLISALGSFNKPRRKMDAAQRQMAAGMLMR*
JGI24003J15210_1000865623300001460MarineMEQARAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLVGALGSFNKPRRKIDAAQRQMAAGMLMR*
JGI24003J15210_1005007423300001460MarineMEMDMEQAKAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRXMXAAQRQMAAGMLMG*
JGI24003J15210_1009988723300001460MarineMEMNMEQAKAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMASRMLMG*
JGI24004J15324_1000712623300001472MarineMQMDMEQARAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLVGALGSFNKPRRKIDAAQRQMAAGMLMR*
JGI24004J15324_1000772743300001472MarineMEIDLDAADAAYQALSEQEKEIVREALDSPLAAVLSKIFPDLMSSLGQXNXPRRKMDAEMRQVAAGMLMR*
JGI24004J15324_1003868313300001472MarineMEQAKAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAG
JGI24004J15324_1010638423300001472MarineMEQAKAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFXKPRRKMDAAQRQMAAGMLMG*
JGI24005J15628_1015641033300001589MarineQSLSEQERELIREAMDSPLAAVLSKVFPDLMGALGGFNRPRRKMDAXMQQIAAQMLQR*
JGI24513J20088_102761423300001720MarineMQIDMEQAQAAYASLSEQERELIREAMDSPLAGVLSKIFPDLMGALGSFNKPRRKMDAAQRQMAA
GOS2233_111038353300001969MarineMEVDLEAADAAYQALSEQEKELIREALDSPLAGVLAKVFPQLMRSLGTFNRPRRKMDAAQQQMAARMLMG*
Ga0055584_10018055223300004097Pelagic MarineMQMDMEQAQAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG*
Ga0055584_10156997633300004097Pelagic MarineMEIDLAAADAAYQGLSEQEKEIVREALDSPLAAVLSKIFPELMTAIGTLNKPRRKMDAEMQQVAARMLQR*
Ga0065861_105425223300004448MarineMEIDLDAADAAYQALSEQEKEIVREALDSPLAAVLSKIFPDLMSSLGQFNRPRRKMDAEMRQVAAGMLMR*
Ga0066224_102604533300004457MarineMEMNMEQAKAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG*
Ga0066222_102828633300004460MarineMEQAQAAYQSLSEQERELIREAMDSPLAAVLSKVFPDLMGALGGFNRPRRKMDAQMQQMAAQMLQR*
Ga0066222_102836923300004460MarineMEQAQAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG*
Ga0066222_108759923300004460MarineMQMDMEQAKAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG*
Ga0068511_100184233300005057Marine WaterMMEVDMERADEAYQALSEQEKEIIREAMDSPLAAVLSKIFPELMQAIGSMNKPRRKMDQAQRDMAARMLMG*
Ga0072334_1031329123300005086WaterMEIDLAAADAAYQGLSEQEKEIVREALDSPLAAVLSKIFPELMTAIGTLNKPRRKMDAEMQQVA
Ga0072334_1041306113300005086WaterDDAYQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFQKPRRKMDAQMRQMAAGMLMR*
Ga0073579_106325923300005239MarineMIEIDMDRADQAYQSLSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFKKPRRKMDAQMRQMAAGMLMR*
Ga0075478_1000094553300006026AqueousMIEIDMDRADQAFQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGSFNKPRRKMDAQMRQMAAGMLMR*
Ga0075478_1005314523300006026AqueousMEIDLAAADANYQGLSEQEKEIVREALDSPLAAVLSKIFPELMTAIGTLNKPRRKMDAEMQQVAARMLQR*
Ga0075478_1019879323300006026AqueousMQIDMEQAQAAYQSLSEQERELIREAMDSPLAAVLSKVFPDLMGALGGFNRPRRKMDAQMQQIAAQMLQR*
Ga0075462_1004293933300006027AqueousMQIDMEQAQAAYQSLSEQERELIREAMDSPLAAVLSKVFPDLMGALGGFNRPRRKMDAQMQQMAAQMLQR*
Ga0075466_103627023300006029AqueousMEIDLDAADAAYQALSEQEKEIVREALDSPLAVVLSKIFPDLMSSLGQFNRPRRKMDAEMRQVAAGMLMR*
Ga0075466_105228733300006029AqueousMNMEQAKAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG*
Ga0075466_115454223300006029AqueousMEIDLAAADAAYQGLSEQEKEIVREALDSPLAAVLSKIFPELMTAIGTLNRPRRKMDAEMQQVAARMLQQ*
Ga0075466_118615223300006029AqueousMIEIDMDRADQAFQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFQKPRRKMDAQMRQMAAGMLMR*
Ga0098038_100150643300006735MarineMIEIDMDRADQAFQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFNKPRRKMDAQMRQMAAGMLMR*
Ga0098038_100890443300006735MarineMEMDIEKAQAAYASLSEQERELIREAMDSPLAGVLAKIFPDLVNMLGSFNKPRRKMDAAQRQMAAGMLMG*
Ga0098038_105099213300006735MarineMIEIDMDRADQAFQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGSFNKPRRKMDAQMRQ
Ga0098038_105970923300006735MarineMEVDMEAADEAYQALSEQEKEIVREALDSPLAAVLSKIFPDLMDSLGQFNRPRRKMDAEMRQVAAGMLMR*
Ga0098038_123079413300006735MarineMEMDMEQAQAAYASLSEQERELIREAMDSPLAGVLAKIFPDLIGALGNFNKPRRKMDAAQRQMAAGMLMG*
Ga0098038_124930213300006735MarineMDMNMEQAQAAYASLSEQERELIREAMDSPLAGVLAKIFPDLVSMLGSFNKPRRKMDAAQRQMAAGMLMG*
Ga0098038_127126823300006735MarineMEIDMESADAAYQALSEQEKEIVREALDSPLAAVLSKIFPELMSSLGQFNRPRRKMDAEMRQVAAGMLMR*
Ga0098037_115404823300006737MarineMEIDMESADAAYQALSEQEKEIVREALDSPLAAVLSKIFPDLMDSLGQFNRPRRKMDAEMRQVAAGMLMR*
Ga0098042_100763823300006749MarineMMQVDMEAADKAYQALSEQEKEIIREALDSPLAGVLSKLFPEIMQAIGSFNKPRRKMDAEMRQMAAGMLMR*
Ga0098042_101183243300006749MarineMEVDMEAADEAYQALSEQEKEIVREALDSPLAAVLSKIFPDLMTSLGQFNRPRRKMDAEMRQVAAGMLMR*
Ga0098042_101525913300006749MarineMEVDMEAADAAYQALSEQEKEIVREALDSPLAAVLSKIFPDLMDSLGQFNRPRRKMDAEMRQVAAGMLMR*
Ga0098042_103933713300006749MarineMIEIDMDRADQAFQALSEQEKEIIREALDSPLAGVLSKIFPEIMQAIGSFNKPRRKMDADMRQV
Ga0098048_112117513300006752MarineADQAFQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFNKPRRKMDAQMRQMAAGMLMR*
Ga0098048_121854423300006752MarineMEMDIEKAQAAYASLSEQERELIREAMDSPLAGVLAKIFPDMVNMLGSFNKPRRKMDAAQRQMAAGMLMG*
Ga0070749_1004777333300006802AqueousMNMEQAQAAYASLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMR*
Ga0070749_1013715233300006802AqueousMEMDMEQAKAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG*
Ga0070754_1001226843300006810AqueousMEIDLAAADANYQGLSEQEKEIVREALDSPLAAVLSKIFPELMTAIGTLNRPRRKMDAEMQQVAARMLQQ*
Ga0070754_1041180423300006810AqueousMEMDMEQAQAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG*
Ga0070750_1003812723300006916AqueousMIEIDMDRADDAYQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGSFNKPRRKMDAQMRQMAAGMLMR*
Ga0070750_1012604223300006916AqueousMEIDLAAADANYQGLSEQEKEIVREALDSPLAAVLSKIFPELMTAIGTLNRPRRKMDAEMQQVAARMLQR*
Ga0070750_1018649423300006916AqueousMEMNMEQAQAAYASLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMR*
Ga0070746_1006183833300006919AqueousMIEIDMDRADDAYQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGSFNKPRRKMDAQMRQMAAGMLLR*
Ga0070746_1015997523300006919AqueousMIEIDMDRADQAYQSLSEQEKEIIREALDSPLAGVMNKIFQEIMQAIGTFQKPRRKMDAQMRQMAAGMLMR*
Ga0098045_103641523300006922MarineMDMNMEQAQAAYASLSEQERELIREAMDSPLAGVLAKIFPDLVSMLGSFNKPCRKMDAAQRQMAAGMLMG*
Ga0075468_1004360213300007229AqueousIMEMNMEQAKAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG*
Ga0075468_1015355713300007229AqueousEIDMDRADQAFQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFQKPRRKMDAQMRQMAAGMLMR*
Ga0070752_105973143300007345AqueousLSEQERELIREAMDSPLAAVLSKVFPDLMGALGGFNRPRRKMDAQMQQMAAQMLQR*
Ga0099849_130046723300007539AqueousMEMNMEQAQAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG*
Ga0110931_106251523300007963MarineMEMDMEKAKAAYAGLSEQERELIREAMDSPLAGVLAKVFPDLISMLGTFTKPRRKMDAAQRRMAAGMLMG*
Ga0110931_116944523300007963MarineMMQVDMEAADKAYQALSEQEKEIIREALDSPLAGVLSKIFPEIMQAIGSFNKPRRKMDADMRQVAAGMLMR*
Ga0110931_118013313300007963MarineMEMNMEKAQAAYASLSEQERELIREAMDSPLAGVLAKIFPDLVSMLGSFNKPRHKMDAAQRQMAAGMLMG*
Ga0114898_103814523300008216Deep OceanMIEIDMDRADDAYQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFQKPRRKMDAEMRQVAAGMLMR*
Ga0114899_118065223300008217Deep OceanMIEIDMDRADDAYQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFQKPRRKMDAEMRQVA
Ga0114904_107001223300008218Deep OceanMIEIDMDRADDAYQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFQKPRRKMDAQMRQVAAGMLMR*
Ga0114904_111236413300008218Deep OceanAAYQALSEQEKEIVREALDSPLAAVLSKIFPELMTSLGQFNRPRRKMDAEMRQVAAGMLMR*
Ga0114905_108443423300008219Deep OceanMIEIDMDRADQAFQALSEQEKEIIREALDSPLAGVLNKIFPEIMQAIGTFNKPRRKMDAEMRQVAAGMLMR*
Ga0114910_110593823300008220Deep OceanMEIDLAAADAAYQGLSEQEKEIVREALDSPLAAVLSKIFPELMTAIGTLNKPRRKMDAEMQQVAARM
Ga0114902_105329133300009413Deep OceanMEIDMESADAAYQALSEQEKEIVREALDSPLAAVLSKIFPELMTSLGQFNRPRRKMDAEMRQVAAGMLMR*
Ga0114909_107304023300009414Deep OceanMEIDLAADDAAYQGLSEQEKEIVREALDGPLAAVLSKIFPELMTAIGTLNKPRRKMDAEMQQVAARMLQR*
Ga0114909_108927923300009414Deep OceanMIEIDMDRADDAYQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFQKPRRKMDAEMQQVAARMLQR*
Ga0114908_115281713300009418Deep OceanMEMDMEQAKAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMD
Ga0115555_109105823300009476Pelagic MarineMEMNMEQAQAAYQSLSEQERELIREAMDSPLAGVLAKIFPGLVSMRGSFNKPRRKMDAAQRQMAAGMLMG*
Ga0115003_1047687333300009512MarineMQMDIEQAQAAYASLSEQERELIREAMDSTLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG*
Ga0115013_1009891123300009550MarineMEVDMEAADEAYQALSEQEKEIVREALDSPLGAVLSKIFPDLMSSLGQFNRPRRKMDAEMRQVAAGMLMR*
Ga0114911_110844413300009603Deep OceanIEIEMDRADDAYQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFNKPRRKMDAEMRQVAAGMLMR*
Ga0114901_117954413300009604Deep OceanMIEIDMDRADQAFQALSEQEKEIIREALDSPLAGVLNKIFPEIMQAIGTFNKPRRKMDAQMRQVAAGMLMR*
Ga0114912_107196013300009620Deep OceanMIEIDMDRADDAYQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFQKPRRKMDAEMRQVAAGMLM
Ga0098043_104211233300010148MarineMMQVDMESADKAYQALSEQEKEIIREALDSPLAGVLSKIFPEIMQAIGSFNKPRRKMDADMRQVAAGMLMR*
Ga0098043_105624523300010148MarineMEMDMEKAKAAYAGLSEQERELIREAMDSPLAGVLAKVFPDLISMLGTFNKPRRKMDAAQRRMAAGMLMG*
Ga0098043_107837823300010148MarineMIEIDMDRADQAFQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGSFNKPRRKMDAQMRQM
Ga0098043_120590213300010148MarineMDMNMEQAQAAYASLSEQERELIREAMDSPLAAVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG*
Ga0129351_118014623300010300Freshwater To Marine Saline GradientMEIDMESADAAYQALSEQEKEIVREALDSPLAVVLSKIFPDLMSSLGQFNRPRRKMDAEMRQVAAGMLMR*
Ga0133547_1116549323300010883MarineMQMDIEQAQAAYASLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG*
Ga0151669_11390463300011128MarineMEMNMKQAQAAYASLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG*
Ga0151672_12993533300011129MarineMEMNMEQAQAAYASLSEQERELIREAMGSPLAGVLAKIFPDLIGALGSFNKLRRKMDSAQRQMAAGMLMG*
Ga0151674_101946013300011252MarineMIEIDIDRADQAYLSLSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFKKPRHKMDAQMRQMAAGM
Ga0151677_102264623300011258MarineMEMDMEQAKAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLISALGSFNKPRRKMDAAQRQMAAGMLMG*
Ga0163179_1080023923300012953SeawaterMIEIDMDRADQAFQALSEQEKEIIREALDSPLAGVMNKVFPEIMQAIGTFQKPRRKMDAEMRQVAAGMLMR*
Ga0180120_1013579623300017697Freshwater To Marine Saline GradientMEMNMEQAQAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG
Ga0181391_101942823300017713SeawaterMIEIDMDRADDAFQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFQKPRRKMDAQMRQMAAGMLMR
Ga0181390_104472533300017719SeawaterGLYIMEIDLAAADAAYQGLSEQEKEIVREALDSPLAAVLSKIFPELMTAIGTLNRPRRKMDAEMQQVAARMLQQ
Ga0181381_100004343300017726SeawaterMIEIDMDRADQAFQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFNKPRRKMDAQMRQVAAGMLMR
Ga0181401_112281823300017727SeawaterMEIDLAAADAAYQGLSEQEKEIVREALDSPLAAVLSKIFPELMTAIGTLNRPRRKMDAEMQQVAAR
Ga0181415_101728233300017732SeawaterMIEIDMDRADQAFQALSEQEKEIIREALDSPLAGVLNKIFPEIMQAIGSFNKPRRKMDAQMREVAAGMLMR
Ga0181426_103962323300017733SeawaterMEIDMESADEAYQALSEQEKEIVREALDSPLAAVLSKIFPDLMTSLGQFNRPRRKMDAEMRQVAAGMLMR
Ga0187218_105130723300017737SeawaterMIEIDMDRADDAFQALSEQEKEIIREAMDSPLAGVMNKIFPEIMQAIGTFQKPRRKMDAQMRQMAAGMLMR
Ga0181428_105070423300017738SeawaterMEIDMESADAAYQALSEQEKEIVREALDSPLAAVLSKIFPELMTAIGTLNRPRRKMDAEMRQVAAGMLMR
Ga0181421_105794433300017741SeawaterDRADQAFQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGSFNKPRRKMDAQMRQMAAGMLMR
Ga0181397_119753213300017744SeawaterFEFIWQPNGFHMIEIDMDRADQAFQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFQKPRRKMDAQMRQMAAGMLMR
Ga0181393_107870523300017748SeawaterMIEIDMDRADQAFRALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFQKPRRKMDAQMRQMAAGMLMR
Ga0181405_112041613300017750SeawaterQIDMEQAQAAYQSLSEQERELIREAMDSPLAAVLSKVFPDLMGALGGFNRPRRKMDAQMQQMAAQMLQR
Ga0181408_113361623300017760SeawaterMEIDMESADAAYQALSEQEKEIVREALDSPLGAVLSKIFPDLMTSLGQFNRPRRKMDAEMRQVAAGMLMR
Ga0181385_103158643300017764SeawaterAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKIDAAQRQMAAGMLMR
Ga0181385_120492323300017764SeawaterMEIDMESADAAYQALSEQEKEIVREALDSPLGAVLSKIFPDLMSSLGQFNRPRRKMDAEMRQVAAGMLMR
Ga0181413_105150823300017765SeawaterMIEIDMDRADQAFQALSEQEKEIIREALDSPLAGVLNKIFPEIMQAIGTFNKPRRKMDAQMREVAAGMLMR
Ga0187221_113948023300017769SeawaterMEIDMESADAAYQALSEQEKEIVREALDSPLGAVLSKIFPELMSSLGQFNRPRRKMDAEMRQVAAGMLMR
Ga0187221_121129623300017769SeawaterMEMDMEQAKAAYQSLSEQERELIREALDSPLAGVMNKIFPEIMQAIGTFQKPRRKMDAQMRQMAAGMLMR
Ga0187217_104313733300017770SeawaterMIEIDMDRADQAFQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGSFNKPRRKMDAQMRQMAAGML
Ga0187217_112731023300017770SeawaterMEIDLAAADAAYQGLSEQEKEIVREALDSPLAAVLSKIFPELMTAIGTLNRPRRKMDAEM
Ga0181584_1045834323300017949Salt MarshMEVDMERANEAYQALSEQEKEIIREAMDSPLAAVLSKVIPEMMQAIGSLNRPRRKMDQAQRDMAARMLMG
Ga0181592_1000229113300018421Salt MarshANEAYQALSEQEKEIIREAMDSPLAAVLSKVIPEMMQAIGSLNRPRRKMDQAQRDMAARMLMG
Ga0211658_100745343300020274MarineMQIDLEDAQSAYQSLTEQERELIREAMDSPLASVLSKVFPNLMSALGSFNKPRRKMDAAQRRMAAGMLMR
Ga0211523_1030020013300020414MarineMMQVDMEAADKAYQALSEQEKEIIREALDSPLAGVLSKIFPEIMQAIGSFNKPRRKMDADMRQVAAGMLMR
Ga0211620_1047748323300020424MarineMEVDLEAADAAYQALSEQEKELIREALDSPLAGVLAKVFPELMRSLGSFNRPRRKMDAAQQQMAARMLMG
Ga0211558_1056245913300020439MarineGCADTEHLWQPKGLCMMEVDMERADEAYQALSEQEKEIIREAMDSPLAAVLSKIFPELMQAIGSMNKPRRKMDQAQRDMAARMLMG
Ga0211577_1024522433300020469MarineMIEIDMDRADQAFQALSEQEKEIIREALDSPLAGVLNKIFPEIMQAIGSFNKPRRKMDAQMRQVAAGMLMR
Ga0212024_102606513300022065AqueousMIEIDMDRADQAFQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGSFNKPRRKMDAQMRQMAAGMLMR
Ga0212021_100963213300022068AqueousMIEIDMDRADDAYQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGSFNKPRRKMDAQMRQMAAGMLMR
Ga0212021_112571313300022068AqueousAKAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG
Ga0196889_105156733300022072AqueousMEIDLDAADAAYQALSEQEKEIVREALDSPLAAVLSKIFPDLMSSLGQFNRPRRKMDAEMRQVAAGMLMR
Ga0196889_109733613300022072AqueousDMEQAQAAYQSLSEQERELIREAMDSPLAAVLSKVFPDLMGALGGFNRPRRKMDAQMQQMAAQMLQR
Ga0224906_1001179163300022074SeawaterMIEIDMDRADQAFQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGIFQKPRRKMDAQMRKMAAGMLMR
Ga0224906_100160373300022074SeawaterMIEIDMDRADQAFQALSEQEKEIIREALDSPLAGVLNKIFPEIMQAIGTFNKPRRKMDAQMRQVAAGMLMR
Ga0224906_107874423300022074SeawaterMIEIDMDRADQAFQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFQKPRRKMDAQMRQMAAGMLMR
Ga0212022_104803323300022164AqueousMEIDLDAADAAYQALSEQEKEIVREALDSPLAAVLSKIFPDLMSSLGQFNRPRRKMD
Ga0196887_103819633300022178AqueousMNMEQAKAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG
Ga0196887_106645723300022178AqueousMEQAQAAYQSLSEQERELIREAMDSPLAAVLSKVFPDLMGALGGFNRPRRKMDAQMQQMAAQMLQR
Ga0196899_119849513300022187AqueousMEMDMEQAKAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG
Ga0255772_1008960613300023176Salt MarshAYQALSEQEKEIIREAMDSPLAAVLSKVIPEMMQAIGSLNRPRRKMDQAQRDMAARMLMG
Ga0207896_100669843300025071MarineMQIDMEQAQAAYASLSEQERELIREAMDSPLAGVLSKIFPDLMGALGSFNKPRRKMDAAQRQMAAGMLMG
Ga0207896_106997123300025071MarineMEINLAAADAAYQGLSEQEKEIVREALDSPLAAVLSKIFPELMTAIGTLNKPRRKMDAEMQQVAARMLQQ
Ga0207896_107437313300025071MarineYASLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG
Ga0208157_100137583300025086MarineMDMNMEQAQAAYASLSEQERELIREAMDSPLAGVLAKIFPDLVSMLGSFNKPRRKMDAAQRQMAAGMLMG
Ga0208157_100615543300025086MarineMIEIDMDRADQAFQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFNKPRRKMDAQMRQMAAGMLMR
Ga0208157_102897623300025086MarineMEMDIEKAQAAYASLSEQERELIREAMDSPLAGVLAKIFPDLVNMLGSFNKPRRKMDAAQRQMAAGMLMG
Ga0208157_108128113300025086MarineMEVDMEAADEAYQALSEQEKEIVREALDSPLAAVLSKIFPDLMDSLGQFNRPRRKMDAEMRQVAAGMLMR
Ga0208434_111317613300025098MarineFQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFNKPRRKMDAQMRQMAAGMLMR
Ga0208159_101160233300025101MarineMEVDMEAADEAYQALSEQEKEIVREALDSPLAAVLSKIFPDLMTSLGQFNRPRRKMDAEMRQVAAGMLMR
Ga0208159_102972813300025101MarineMQVDMEAADKAYQALSEQEKEIIREALDSPLAGVLSKLFPEIMQAIGSFNKPRRKMDAEM
Ga0208666_112934723300025102MarineMIEIDMDRADQAFQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFNKPRRKMD
Ga0208666_115372613300025102MarineMEMDMEQAQAAYASLSEQERELIREAMDSPLAGVLAKIFPDLIGALGNFNKPRRKMDAAQRQMAAGMLMG
Ga0209535_101056653300025120MarineMQMDMEQARAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLVGALGSFNKPRRKIDAAQRQMAAGMLMR
Ga0209535_101821423300025120MarineMEMDMKQAKAAYQSLSEQERELIREVMDSPLAGVLAKIFPDLISALGSFNKPRRKMDAAQRQMAAGMLMR
Ga0209535_107650323300025120MarineMEMNMEQAKAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG
Ga0209535_108981723300025120MarineMEIDLDAADAAYQALSEQEKEIVREALDSPLAVVLSKIFPDLMSSLGQFNRPRRKMDAEMRQVAAGMLMR
Ga0209535_114414523300025120MarineMEIDLAAADAAYQGLSEQEKEIVREALDSPLAAVLSKIFPELMTAIGTLNKPRRKMDAEMQQVAARMLQQ
Ga0209535_119139133300025120MarineSRTKSKFIWQPKRLYMIEIDMDRADQAYQSLSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFKKPRRKMDAQMRQMAAGMLMR
Ga0209535_120216223300025120MarineMEMNMEQAKAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMASRMLMG
Ga0209348_115139033300025127MarineAQAAYDGLSEQEREIIREAMDSPLAGVLAKIFPDLMGMLGSFNKPRRKMDAAQRQMAAGMLMR
Ga0209348_122277533300025127MarineMNIDMEQAQKRYEALTEQEKEMIREALDSPLAMVLNKVLPELMQGLGQFNKPRRKMDQAMREQAVRILRG
Ga0208919_110220133300025128MarineMEMDMEKAKAAYAGLSEQERELIREAMDSPLAGVLAKVFPDLMSMLGTFNKPRRKMDAAQRRMAAGMLMG
Ga0208919_111908313300025128MarineMMQIDMEAADKAYQALSEQEKEIIREALDSPLAGVLSKIFPEIMQAIGSFNKPRRKMDADMRQVAAGMLMR
Ga0209336_1007523123300025137MarineMDMKQAKAAYQSLSEQERELIREVMDSPLAGVLAKIFPDLISALGSFNKPRRKMDAAQRQMAAGMLMR
Ga0209634_100202753300025138MarineMQIDMEQAQAAYQSLSEQERELIREAMDSPLAAVLSKVFPDLMGALGGFNRPRRKMDAQMQQIAAQMLQR
Ga0209634_110502823300025138MarineMEMDMEQAQAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG
Ga0209645_117868813300025151MarineLMEINMEQAQAAYDGLSEQEREIIREAMDSPLAGVLAKIFPDLMGMLGSFNKPRRKMDAAQRQMAAGMLMR
Ga0209337_111624713300025168MarineMDMEQAKAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG
Ga0209337_117115413300025168MarineMEMDMEQAQAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDA
Ga0208449_112898223300025280Deep OceanMEIDMESADAAYQALSEQEKEIVREALDSPLAAVLSKIFPELMTSLGQFNRPRRKMDAEMRQVAAGMLMR
Ga0208030_104122723300025282Deep OceanMIEIDMDRADQAFQALSEQEKEIIREALDSPLAGVLNKIFPEIMQAIGTFNKPRRKMDAEMRQVAAGMLMR
Ga0208030_107829613300025282Deep OceanMEIDLAAADAAYQGLSEQEKEIVREALDSPLAAVLSKIFPELMTAIGTLNKPRRKMDAEMQQVAARMLQR
Ga0208934_106638713300025293Deep OceanMEIDMESADAAYQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFQKPRRKMDAQMRQVAAGMLMR
Ga0208148_111106523300025508AqueousMIEIDMDRADQAYQSLSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFKKPRRKMDAQMRQMAAGMLMR
Ga0208149_113637633300025610AqueousFCIMEMDMEQAQAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG
Ga0208004_105604023300025630AqueousMIEIDMDRADQAFQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFQKPRRKMDAAQRQMAAGMLMG
Ga0208134_109697223300025652AqueousMEIDLAAADANYQGLSEQEKEIVREALDSPLAAVLSKIFPELMTAIGTLNRPRRKMDAEMQQVAARMLQQ
Ga0208428_103048223300025653AqueousMDRADQAFQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGSFNKPRRKMDAQMRQMAAGMLMR
Ga0208899_112994023300025759AqueousMNMEQAQAAYASLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMR
Ga0209092_1006054133300027833MarineMQIDMEQAQAAYQSLSEQERELIREAMDSPLAAVLSKVFPDLMGALGGFNRPRRKMDAQMQQMAAQMLQR
Ga0209503_1030357713300027859MarineMEVDMEAADEAYQALSEQEKEIVREALDSPLGAVLSKIFPDLMSSLGQFNRPRRKMDAEM
Ga0256368_106558623300028125Sea-Ice BrineMQMDMEQAQAAYASLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG
Ga0183683_100190863300029309MarineMMQVDMEAADKAYQALSEQEKEIIREALDSPLAGVLSKLFPEIMQAIGSFNKPRRKMDAEMRQMAAGMLMR
Ga0183683_100555663300029309MarineMQIDLDQAQSAYQSLSEQERELIREAMDSPLASVLSKVFPDLMSALGSFNKPRRKMDAAQRQMAAGMLMR
Ga0183683_101896133300029309MarineMEVDMEAADAAYQALSEQEKEIVREALDSPLAAVLSKIFPDLMDSLGQFNRPRRKMDAEMRQVAAGMLMR
Ga0185543_102254413300029318MarineKSEPVWQPNGFLMMQVDMEAADKAYQALSEQEKEIIREALDSPLAGVLSKIFPEIMQAIGSFNKPRRKMDADMRQVAAGMLMR
Ga0185543_102317233300029318MarineKGLYVMQIDLDQAQSAYQNLSEQERELIREAMDSPLASVLSKVFPDLMSALGSFNKPRRKMDAAQRRMAAGMLMR
Ga0183748_103982033300029319MarineMEVDMERANEAYQALSEQEKEIIREAMDSPLAAVLGKVIPEMMQAIGSLNRPRRKMDQAQRDMAARMLMG
Ga0183755_100486583300029448MarineMIEIDMDRADDAYQALSEQEKEIIREALDSPLAGVMNKIFPEIMQAIGTFQKPRRKMDAEMRQMAAGMLMR
Ga0183755_103557733300029448MarineMEIDMESADAAYQALSEQEKEIVREALDSPLAAVLSKIFPELMSSLGQFNRPRRKMDAEMRQVAAGMLMR
Ga0183755_109631523300029448MarineMQIDMEQAQAVYNSLTEQERELIREAMDSPLAGVLSKIFPDLMGALGSFNKPRRKMDAAQRQMAAGMLMG
Ga0183757_100793853300029787MarineMEMDMEKAQAAYASLSEQERELIREAMDSPLAGVLAKIFPDLVSMLGSFNKPRRKMDAAQREMAAGMLMG
Ga0183757_101957123300029787MarineMEIDMESADAAYQALSEQEKEIVREALDSPLAAVLSKIFPDLMTSLGQFNRPRRKMDAEMRQVAAGMLMR
Ga0307488_1030071023300031519Sackhole BrineMKMDMEQAKAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG
Ga0307376_1057426133300031578SoilELWLMEMDMEQAKAAYQSLSEQERELIREAMDSQLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMG
Ga0316203_121901023300032274Microbial MatMEMNMEQAQAAYASLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRKMDAAQRQMAAGMLMR
Ga0348335_012672_539_7513300034374AqueousMEMDMEQAKAAYQSLSEQERELIREAMDSPLAGVLAKIFPDLIGALGSFNKPRRQMDAAQRQMAAGMLMG
Ga0348335_047517_381_5933300034374AqueousMEIDLAAADAAYQGLSEQEKEIVREALDSPLAAVLSKIFPELMTAIGTLNRPRRKMDAEMQQVAARMLQQ
Ga0348336_008689_2_2083300034375AqueousMQIDMEQAQAAYQSLSEQERELIREAMDSPLAAVLSKVFPDLMGALGGFNRPRRKMDAQMQQMAAQMLQ
Ga0348336_028092_3_2003300034375AqueousMEIDLAAADANYQGLSEQEKEIVREALDSPLAAVLSKIFPELMTAIGTLNRPRRKMDAEMQQVTAR
Ga0348337_136568_338_5503300034418AqueousMEIDLAAADANYQGLSEQEKEIVREALDSPLAAVLSKIFPELMTAIGTLNKPRRKMDAEMQQVAARMLQR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.