| Basic Information | |
|---|---|
| Family ID | F027633 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 194 |
| Average Sequence Length | 48 residues |
| Representative Sequence | VENDFPLQPEHTSFVARAGSAFAGTMGKAASSVKLLSFSGKIHLKKR |
| Number of Associated Samples | 173 |
| Number of Associated Scaffolds | 194 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.53 % |
| % of genes near scaffold ends (potentially truncated) | 95.88 % |
| % of genes from short scaffolds (< 2000 bps) | 84.54 % |
| Associated GOLD sequencing projects | 164 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.907 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.794 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.165 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.00% β-sheet: 0.00% Coil/Unstructured: 80.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 194 Family Scaffolds |
|---|---|---|
| PF01202 | SKI | 87.63 |
| PF01594 | AI-2E_transport | 7.22 |
| PF01118 | Semialdhyde_dh | 1.55 |
| PF14559 | TPR_19 | 0.52 |
| PF05222 | AlaDh_PNT_N | 0.52 |
| PF13349 | DUF4097 | 0.52 |
| PF02774 | Semialdhyde_dhC | 0.52 |
| PF00696 | AA_kinase | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 194 Family Scaffolds |
|---|---|---|---|
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 7.22 |
| COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 0.52 |
| COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.91 % |
| Unclassified | root | N/A | 3.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001565|A35518A_1148855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300001593|JGI12635J15846_10040619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3628 | Open in IMG/M |
| 3300001990|JGI24737J22298_10143004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300004152|Ga0062386_100420082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1079 | Open in IMG/M |
| 3300004468|Ga0068977_1258340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300005167|Ga0066672_10043557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2537 | Open in IMG/M |
| 3300005167|Ga0066672_10803289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300005177|Ga0066690_10872713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300005331|Ga0070670_100030748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4624 | Open in IMG/M |
| 3300005336|Ga0070680_100051175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3370 | Open in IMG/M |
| 3300005337|Ga0070682_100139391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1651 | Open in IMG/M |
| 3300005354|Ga0070675_100343987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1321 | Open in IMG/M |
| 3300005355|Ga0070671_101614974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300005436|Ga0070713_100179668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1901 | Open in IMG/M |
| 3300005450|Ga0066682_10507485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300005451|Ga0066681_10147547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1380 | Open in IMG/M |
| 3300005468|Ga0070707_100408901 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300005518|Ga0070699_101730812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300005532|Ga0070739_10137448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1316 | Open in IMG/M |
| 3300005534|Ga0070735_10716701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300005540|Ga0066697_10625237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300005542|Ga0070732_10863219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300005554|Ga0066661_10340175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 920 | Open in IMG/M |
| 3300005557|Ga0066704_10721041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300005561|Ga0066699_10267543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1211 | Open in IMG/M |
| 3300005577|Ga0068857_100141556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2174 | Open in IMG/M |
| 3300005598|Ga0066706_11276772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300005602|Ga0070762_10441866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300005718|Ga0068866_10418509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 869 | Open in IMG/M |
| 3300005834|Ga0068851_10022211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3087 | Open in IMG/M |
| 3300006046|Ga0066652_100839618 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300006050|Ga0075028_100675237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300006162|Ga0075030_100486990 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 981 | Open in IMG/M |
| 3300006172|Ga0075018_10412497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300006173|Ga0070716_101442410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300006176|Ga0070765_100965851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 805 | Open in IMG/M |
| 3300006354|Ga0075021_10844032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300006579|Ga0074054_11684065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300006800|Ga0066660_10599006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
| 3300006804|Ga0079221_11668312 | Not Available | 518 | Open in IMG/M |
| 3300006854|Ga0075425_102417738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300006871|Ga0075434_100115406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2698 | Open in IMG/M |
| 3300006904|Ga0075424_100178054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2256 | Open in IMG/M |
| 3300009088|Ga0099830_10004519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7841 | Open in IMG/M |
| 3300009089|Ga0099828_10047686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3542 | Open in IMG/M |
| 3300009137|Ga0066709_100114353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3351 | Open in IMG/M |
| 3300009522|Ga0116218_1489131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300009665|Ga0116135_1008901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3658 | Open in IMG/M |
| 3300009665|Ga0116135_1440377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300010048|Ga0126373_12210648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300010048|Ga0126373_12224090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300010358|Ga0126370_11673293 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 611 | Open in IMG/M |
| 3300010361|Ga0126378_10479590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1359 | Open in IMG/M |
| 3300010361|Ga0126378_10509940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1318 | Open in IMG/M |
| 3300010361|Ga0126378_12356843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300010373|Ga0134128_12116179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300010376|Ga0126381_103527506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300010376|Ga0126381_103539056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300010376|Ga0126381_103619810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300010379|Ga0136449_100141483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4754 | Open in IMG/M |
| 3300010379|Ga0136449_100158225 | All Organisms → cellular organisms → Bacteria | 4421 | Open in IMG/M |
| 3300010379|Ga0136449_100837114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1512 | Open in IMG/M |
| 3300011061|Ga0138534_1000316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300011120|Ga0150983_11048568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1527 | Open in IMG/M |
| 3300011305|Ga0138532_1026619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300012200|Ga0137382_11058128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300012210|Ga0137378_10627253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
| 3300012357|Ga0137384_11439912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300012363|Ga0137390_11027972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300012929|Ga0137404_10811609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 850 | Open in IMG/M |
| 3300012930|Ga0137407_10219105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1714 | Open in IMG/M |
| 3300012960|Ga0164301_10971410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300012975|Ga0134110_10347422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300012985|Ga0164308_10418043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1101 | Open in IMG/M |
| 3300013832|Ga0120132_1022909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1112 | Open in IMG/M |
| 3300014489|Ga0182018_10181379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1187 | Open in IMG/M |
| 3300014498|Ga0182019_10364153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
| 3300014501|Ga0182024_10686489 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300014657|Ga0181522_10711799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300014968|Ga0157379_12342326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300015264|Ga0137403_10555043 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300015372|Ga0132256_102702106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300016341|Ga0182035_10962916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300017656|Ga0134112_10147241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
| 3300017822|Ga0187802_10031779 | All Organisms → cellular organisms → Bacteria | 1876 | Open in IMG/M |
| 3300017822|Ga0187802_10342102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300017927|Ga0187824_10089254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 984 | Open in IMG/M |
| 3300017933|Ga0187801_10262997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300017937|Ga0187809_10268604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300017974|Ga0187777_10337299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1035 | Open in IMG/M |
| 3300017995|Ga0187816_10043880 | All Organisms → cellular organisms → Bacteria | 1851 | Open in IMG/M |
| 3300018001|Ga0187815_10378731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300018006|Ga0187804_10259346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300018008|Ga0187888_1047396 | All Organisms → cellular organisms → Bacteria | 2000 | Open in IMG/M |
| 3300018058|Ga0187766_10379318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 931 | Open in IMG/M |
| 3300018058|Ga0187766_10835994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300018085|Ga0187772_10430310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300018086|Ga0187769_10088678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2208 | Open in IMG/M |
| 3300018086|Ga0187769_10110833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1980 | Open in IMG/M |
| 3300018088|Ga0187771_10249182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1481 | Open in IMG/M |
| 3300018088|Ga0187771_10310449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1322 | Open in IMG/M |
| 3300018468|Ga0066662_11347396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300018482|Ga0066669_11218978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300019275|Ga0187798_1440251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300019278|Ga0187800_1811697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300020002|Ga0193730_1128850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300020170|Ga0179594_10313154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300020579|Ga0210407_10822451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300020580|Ga0210403_10558603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 927 | Open in IMG/M |
| 3300020580|Ga0210403_11431851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300020581|Ga0210399_10080121 | All Organisms → cellular organisms → Bacteria | 2653 | Open in IMG/M |
| 3300020582|Ga0210395_10159173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1687 | Open in IMG/M |
| 3300020582|Ga0210395_10614748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300020583|Ga0210401_10108969 | All Organisms → cellular organisms → Bacteria | 2600 | Open in IMG/M |
| 3300021180|Ga0210396_11247569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300021432|Ga0210384_10088982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2773 | Open in IMG/M |
| 3300021477|Ga0210398_11184608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300021560|Ga0126371_13063208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300022525|Ga0242656_1015609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1079 | Open in IMG/M |
| 3300022724|Ga0242665_10157427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300025321|Ga0207656_10731107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300025898|Ga0207692_10697055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300025903|Ga0207680_11338584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300025905|Ga0207685_10220600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
| 3300025905|Ga0207685_10321196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300025914|Ga0207671_10404846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1085 | Open in IMG/M |
| 3300025916|Ga0207663_10077722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2161 | Open in IMG/M |
| 3300025917|Ga0207660_10097024 | All Organisms → cellular organisms → Bacteria | 2196 | Open in IMG/M |
| 3300025925|Ga0207650_10347871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1219 | Open in IMG/M |
| 3300025927|Ga0207687_10299990 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1294 | Open in IMG/M |
| 3300025928|Ga0207700_10074268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2630 | Open in IMG/M |
| 3300025929|Ga0207664_10470071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1124 | Open in IMG/M |
| 3300025929|Ga0207664_11972084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300025938|Ga0207704_11315184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300025939|Ga0207665_10860681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300025949|Ga0207667_10655685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1055 | Open in IMG/M |
| 3300025981|Ga0207640_12046527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300025986|Ga0207658_10545593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1037 | Open in IMG/M |
| 3300026078|Ga0207702_11101825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300026291|Ga0209890_10093207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1053 | Open in IMG/M |
| 3300026308|Ga0209265_1071850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1016 | Open in IMG/M |
| 3300026446|Ga0257178_1025743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300026499|Ga0257181_1047995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300027071|Ga0209214_1004070 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 3300027076|Ga0208860_1005202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1108 | Open in IMG/M |
| 3300027174|Ga0207948_1030525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300027502|Ga0209622_1095550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300027609|Ga0209221_1009356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2509 | Open in IMG/M |
| 3300027651|Ga0209217_1187210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300027667|Ga0209009_1182409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300027846|Ga0209180_10114963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1541 | Open in IMG/M |
| 3300027857|Ga0209166_10617059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300027882|Ga0209590_10039931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2549 | Open in IMG/M |
| 3300027884|Ga0209275_10671237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300027894|Ga0209068_10273972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 942 | Open in IMG/M |
| 3300027905|Ga0209415_11091932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300027911|Ga0209698_10752749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300028047|Ga0209526_10274163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1148 | Open in IMG/M |
| 3300028792|Ga0307504_10120077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
| 3300029883|Ga0311327_10629948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300030586|Ga0265393_1112594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300030707|Ga0310038_10214028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
| 3300030760|Ga0265762_1037348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
| 3300031090|Ga0265760_10149920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300031231|Ga0170824_120356351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1012 | Open in IMG/M |
| 3300031241|Ga0265325_10342521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300031573|Ga0310915_11267110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300031718|Ga0307474_10391882 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300031719|Ga0306917_10561716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300031720|Ga0307469_11433806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300031740|Ga0307468_101580901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300031753|Ga0307477_10604551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300031754|Ga0307475_10743455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300031764|Ga0318535_10289796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300031823|Ga0307478_10728008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
| 3300031879|Ga0306919_10472271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 966 | Open in IMG/M |
| 3300031910|Ga0306923_11699924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300031942|Ga0310916_10391544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1182 | Open in IMG/M |
| 3300031996|Ga0308176_10280635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1613 | Open in IMG/M |
| 3300032180|Ga0307471_100705078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1174 | Open in IMG/M |
| 3300032205|Ga0307472_100549085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
| 3300032770|Ga0335085_10816342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1025 | Open in IMG/M |
| 3300032805|Ga0335078_10452984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1665 | Open in IMG/M |
| 3300032805|Ga0335078_11581238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300032892|Ga0335081_10162561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3167 | Open in IMG/M |
| 3300032892|Ga0335081_10336063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1977 | Open in IMG/M |
| 3300032892|Ga0335081_12278577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300033808|Ga0314867_146426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300033887|Ga0334790_100361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.79% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.15% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.15% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.15% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.64% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.64% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.12% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.12% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.61% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.09% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.09% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.58% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.06% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.55% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.55% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.55% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.55% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.03% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.03% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.03% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.03% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.03% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.52% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.52% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.52% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.52% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.52% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.52% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.52% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.52% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.52% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001565 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-5cm-18A)- 1 week illumina new | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Host-Associated | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004468 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011061 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 12 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011305 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 10 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027076 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300030586 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE041SO (Eukaryote Community Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A35518A_11488551 | 3300001565 | Permafrost | IDVVARSVQGQVENDFQLQPKHTAFPVKAGSAFAGTVGKAASSVKLFSFSGKIHLKKR* |
| JGI12635J15846_100406195 | 3300001593 | Forest Soil | AYASIEVVARSVQGTVEKDFPLEPEHTSFVPRAGSAFAGTMGEAASSVKLLSFSGKIHLKKR* |
| JGI24737J22298_101430041 | 3300001990 | Corn Rhizosphere | VTARSNQGRVDSDFSLEPKHTPFIAKAGSYFSGTLNKAASSVRLMSFSGKIHLKKRQ* |
| Ga0062386_1004200821 | 3300004152 | Bog Forest Soil | VENDFPLQPEHTSFVTRAGSAFAGTMGKAASSVKLLSFSGKIHLKKRLTQ* |
| Ga0068977_12583402 | 3300004468 | Peatlands Soil | SIEVVARSVQGKVENDFPLQPEHTSFVARAGSAFAGTVGQAASSVKLLSFSGKIHLKKREQ* |
| Ga0066672_100435571 | 3300005167 | Soil | LQPKVHTSFLVKEGSSFAGTINKAASSVWLRTFSGKIHLKRR* |
| Ga0066672_108032891 | 3300005167 | Soil | VLARSTNGPVQSDFSLEPKHTPFAMKVGSAFAGTLGKAASSVNLFSFSGKIHLKKRQN* |
| Ga0066690_108727132 | 3300005177 | Soil | PVQSDFSLEPKHTPFAMKVGSAFAGTLGKAASSVNLFSFSGKIHLKKRQN* |
| Ga0070670_1000307486 | 3300005331 | Switchgrass Rhizosphere | FSLEPKHTPFIAKAGSYFSGTLNKAASSVRLMSFSGKIHLKKRQ* |
| Ga0070680_1000511755 | 3300005336 | Corn Rhizosphere | DASFDVTARSVRGKVENDFLLEPKHTPFVVRAGSAFAGTMNKAASSVRLFSFSGKIHLKKR* |
| Ga0070682_1001393911 | 3300005337 | Corn Rhizosphere | ENDFLLEPKHTPFVVRAGSAFAGTMNKAASSVRLFSFSGKIHLKKR* |
| Ga0070675_1003439873 | 3300005354 | Miscanthus Rhizosphere | PKHTPFVVRAGSAFAGTMNKAASSVRLFSFSGKIHLKKR* |
| Ga0070671_1016149741 | 3300005355 | Switchgrass Rhizosphere | IDVVARSVNGSVENDFPLEPEHTSFVVKAGSAFAGTLGKAASSVKLFTFSGKIHLKKR* |
| Ga0070713_1001796684 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | EPKHTPFIAKAGSYFSGTLNKAASSVRLMSFSGKIHLKKRQ* |
| Ga0066682_105074852 | 3300005450 | Soil | FPLQPKHTPFVVKAGSAFAGTMNRAASSVKLFSFSGKIHLKKR* |
| Ga0066681_101475471 | 3300005451 | Soil | APDDASIEVIAHSVRGKVENDFRLQPKHTPFTIKAGSAFAGTMNKAASSVKLFSFSGKIHLKKR* |
| Ga0070707_1004089013 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | PKHTPFAMKVGSAFAGTWGKAASSVSLFSFSGKIHLKKRQN* |
| Ga0070699_1017308121 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | PKKHTTFPVVAGSSFAGTIGKAASSVVLRTFSGKIRLKKR* |
| Ga0070739_101374483 | 3300005532 | Surface Soil | QSDFSLEPKHAPFIMRGANSLSGTMGKAASSSVKLFSFSGKIRLKKRQNSTTAQ* |
| Ga0070735_107167011 | 3300005534 | Surface Soil | LDPKHAPFLVRGANSLSGTLGKAASSVKLFSFSGKIRLKKRQN* |
| Ga0066697_106252372 | 3300005540 | Soil | ARSTNGIVQSDFSLDPKHAPFLVRGANSLSGTIGKAASSVKLFSFSGKIRLKKRQN* |
| Ga0070732_108632191 | 3300005542 | Surface Soil | KVHTSFLVKEGSSFAGTINKAASSVWLRTFSGKIHLKRR* |
| Ga0066661_103401753 | 3300005554 | Soil | HTPFAMKVGSAFAGTLGKAASSVNLFSFSGKIHLKKRQN* |
| Ga0066704_107210412 | 3300005557 | Soil | VESDFSLDPKHAPFFVRGANSFSGTLNKAASSVKLFSLSGKIHLKKR* |
| Ga0066699_102675433 | 3300005561 | Soil | ENDFPLEPKHTPFVVKAGSAFAGTMNKAASSVRLFSFSGKIHLKKR* |
| Ga0068857_1001415561 | 3300005577 | Corn Rhizosphere | ASFDVTARSVRGKVENDFLLEPKHTPFVVRAGSAFAGTMNKAASSVRLFSFSGKIHLKKR |
| Ga0066706_112767722 | 3300005598 | Soil | ARSTNGPVQSDFSLEPKHTTFAMKVGSAFAGTLNKAASSVNLFSFSGKIHLKKRQN* |
| Ga0070762_104418661 | 3300005602 | Soil | PEHTSFVPRAGSAFAGTMGEAASSVKLLSFSGKIHLKKR* |
| Ga0068866_104185091 | 3300005718 | Miscanthus Rhizosphere | PLEPEHTSFVVKAGSAFAGTLGKAASSVKLFTFSGKIHLKKR* |
| Ga0068851_100222111 | 3300005834 | Corn Rhizosphere | NDFLLEPKHTPFVVRAGSAFAGTMNKAASSVRLFSFSGKIHLKKR* |
| Ga0066652_1008396181 | 3300006046 | Soil | KHSSIYSRGGSALVGTMGKAASAVKLVSFSGKIHLKKRQN* |
| Ga0075028_1006752371 | 3300006050 | Watersheds | GKVLTDFPLQPEHTSFIARAGSAFAGTMGKAASSVKLLSFSGKIHLKKR* |
| Ga0075030_1004869903 | 3300006162 | Watersheds | SIEVVARSVQGKVENDFPLQPEHTSFVARAGSAFAGTMGKAASSVKLLSFSGKIHLKKR* |
| Ga0075018_104124971 | 3300006172 | Watersheds | VVARSVQGKVENDFPLIPEHTTFIARAGSAFAGTMGKAASSVKLLSFSGKIHLKKR* |
| Ga0070716_1014424102 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | SIDVTARSVRGKVENDFLLEPKHTNFAMKAGSAFAGTMNKAASSVKLFSFSGRIHLKSLQATR* |
| Ga0070765_1009658511 | 3300006176 | Soil | VARSVQGTVEKDFPLEPEHTSFVPRAGSAFAGTMGEAASSVKLLSFSGKIHLKKR* |
| Ga0075021_108440321 | 3300006354 | Watersheds | SVQGKVVNDFPLQPEHTSFPAKVGSAFAGTMGKAASSVKLLSFSGRIHLKKR* |
| Ga0074054_116840651 | 3300006579 | Soil | SDLRLQPKVHTSFLVKEGSSFAGTINKAASSVWLRTFSGKIHLKKR* |
| Ga0066660_105990063 | 3300006800 | Soil | VENDFRLQPKHTPFTIKAGSAFAGTMNKAASSVKLFSFSGKIHLKKR* |
| Ga0079221_116683122 | 3300006804 | Agricultural Soil | SLEPKHAPFAAKEGSAFSGTLGMAASSVRLFSFSGKIHLKKRHN* |
| Ga0075425_1024177382 | 3300006854 | Populus Rhizosphere | NDFLLEPKHTPFAVKAGSAFAGTMNKAASSVRLFSFSGKIHLKKR* |
| Ga0075434_1001154064 | 3300006871 | Populus Rhizosphere | RSDQGRVDSDFSLEPKHTPFLASAGSAFAGTLGKAASSVKLFSFSGKIHLKKRQN* |
| Ga0075424_1001780541 | 3300006904 | Populus Rhizosphere | DVPLQPKSHTSFLIKQGSSFAGTINKAASSVWLRTFSGKIHLKKR* |
| Ga0099830_100045191 | 3300009088 | Vadose Zone Soil | RGKVENDFPLQPKHTPFVIKAGSAFAGTMGKAASSVRLLSFSGKIHLKKH* |
| Ga0099828_100476861 | 3300009089 | Vadose Zone Soil | FVVKAGSAFAGTMNKAASSVRLFSFSGKIHLKKR* |
| Ga0066709_1001143535 | 3300009137 | Grasslands Soil | TNGPVQSDFSLEPKHTPFSAKVGGAFSGTLGMAAYSVKLFSFSGKIHLKKRQN* |
| Ga0116218_14891312 | 3300009522 | Peatlands Soil | DPSHSSFVTRAGSAFAGTVGKAASSVKLISFSGKIHLKKRLGR* |
| Ga0116135_10089015 | 3300009665 | Peatland | SVQGTVEKDFPLQPEHTSFVPRAGSAFAGTMGEAASSVKLLSFSGKIHLKKR* |
| Ga0116135_14403771 | 3300009665 | Peatland | QTTPFLMRAESAFSGTLGKAASSVKLHSFSGKIHLKKRSTKSK* |
| Ga0126373_122106482 | 3300010048 | Tropical Forest Soil | LQPKHTPFTVKVGSAFAGTMGKAASSVKLLSFSGKIHFRRR* |
| Ga0126373_122240902 | 3300010048 | Tropical Forest Soil | FPLQPKHTPFTVKVGSAFAGTMGKAASSVKLLSFSGKIYFRKR* |
| Ga0126370_116732932 | 3300010358 | Tropical Forest Soil | QLEPKHTSFVVRAGSAFAGTMNKAASSVRLFSFSGKIHLKKR* |
| Ga0126378_104795901 | 3300010361 | Tropical Forest Soil | HTSFAQIPGSAFAGTMGKAASSVVLRTFSGKIHLKKR* |
| Ga0126378_105099403 | 3300010361 | Tropical Forest Soil | VENDFPLQPKHTPFTVKVGSAFAGTMGKAASSVKLLSFSGKIHFRKR* |
| Ga0126378_123568432 | 3300010361 | Tropical Forest Soil | RSVTGLVENDFPLQPKHTPFTVKVGSAFAGTMGKAASSVKLLSFSGKIHFRRR* |
| Ga0134128_121161791 | 3300010373 | Terrestrial Soil | EPKHTPFYVKGGSAFAGTLNKAASSVKLFSFSGKIHLKKRQN* |
| Ga0126381_1035275062 | 3300010376 | Tropical Forest Soil | PLQPKHTPFTVKVGSAFAGTMGKAASSVKLLSFSGKIYFRKR* |
| Ga0126381_1035390562 | 3300010376 | Tropical Forest Soil | ENDFPLQPKHTPFTVKVGSAFAGTMGKAASSVKLLSFSGKIYFRKR* |
| Ga0126381_1036198102 | 3300010376 | Tropical Forest Soil | ENDFPLQPKHTPFTVKVGSAFAGTMGKAASSVKLLSFSGKIHFRRR* |
| Ga0136449_1001414836 | 3300010379 | Peatlands Soil | VENDFPLQPEHTSFVARAGSAFAGTMGKAASSVKLLSFSGKIHLKKR* |
| Ga0136449_1001582251 | 3300010379 | Peatlands Soil | QGKVENDFQLHPPHSSFVSRAGSAFAGTMGKAASTVKLLSFSGKIHLKKR* |
| Ga0136449_1008371141 | 3300010379 | Peatlands Soil | TPFAIKAGSAFAGTVGKAASSVKLFSISGKIHLKKR* |
| Ga0138534_10003162 | 3300011061 | Peatlands Soil | SIEVVARSVQGRVENDFPLQPEHTSFAPRAGSTFAGTMGEAASSVKLLSFSGKIHLKKREQ* |
| Ga0150983_110485681 | 3300011120 | Forest Soil | HTPFVIKAGSAFAGTLNKAASSVKLLSFSGKIHLKKR* |
| Ga0138532_10266191 | 3300011305 | Peatlands Soil | PEHTSFVARAGSAFAGTMGKAASSVKLLSFSGKIHLKKREQ* |
| Ga0137389_101416421 | 3300012096 | Vadose Zone Soil | HDDIPLQPKNHNWFPTKVGSAFAGTINKAASSVVLRTFSGKIHLKKRSEK* |
| Ga0137382_110581282 | 3300012200 | Vadose Zone Soil | GPVQSDFSLEFKHTPFATKVGSAFSGTLGMAASSVRLFSFSGKIHLKKRQN* |
| Ga0137378_106272531 | 3300012210 | Vadose Zone Soil | APFLLKSGSAFSGTLGKAASSVKLFSFSGKIHLKKRQN* |
| Ga0137384_114399121 | 3300012357 | Vadose Zone Soil | QSDFSLEPKHAPFAMKVGSAFAGTLNKAASSVNLFSFSGKIHLKKRQN* |
| Ga0137375_106551462 | 3300012360 | Vadose Zone Soil | QVQDDVPLQPKTHTSFLVKEGSSFAGTINKAASSVWLRTFSGKIHLKKR* |
| Ga0137390_110279721 | 3300012363 | Vadose Zone Soil | NDFLLEPKHTPFVVKAGSAFAGTMNKAASSVRLFSFSGKIHLKKR* |
| Ga0137404_108116093 | 3300012929 | Vadose Zone Soil | GTVDSDFSLEPRHTSFTVKAGSAFAGTMNKALSMVRLRSFSGKIHLKKR* |
| Ga0137407_102191054 | 3300012930 | Vadose Zone Soil | TPFVVKAGSAFAGTMNKAASSVRLFSFSGKIHLKKR* |
| Ga0164301_109714102 | 3300012960 | Soil | VQSDFSLEPKHTPFAAKVGSAFAGTLGKAASSVNLFSFSGKIHLKKRQN* |
| Ga0134110_103474221 | 3300012975 | Grasslands Soil | TPFVVKAGSAFAGTMNRAASSVKLFSFSGKIHLKKR* |
| Ga0164308_104180433 | 3300012985 | Soil | ARSVRGKVENDFLLEPKHTPFVVRAGSAFAGTMNKAASSVRLFSFSGKIHLKKR* |
| Ga0120132_10229091 | 3300013832 | Permafrost | QGQVENDFQLQPKHTAFPVKAGSAFAGTVGKAASSVKLFSFSGKIHLKKR* |
| Ga0182018_101813793 | 3300014489 | Palsa | FALKAGSAFAGTMGKAASSVKLFSISGKIHLKKR* |
| Ga0182019_103641533 | 3300014498 | Fen | VARSVNGTVENDFPLQPEHTSFVVKAGSAFAGTMGKAASSVKLLSFSGKIHLKKR* |
| Ga0182024_106864891 | 3300014501 | Permafrost | FVTRAGSAFAGTVGQAASSVNLLSFSGKIHLKKREQ* |
| Ga0181522_107117992 | 3300014657 | Bog | LMARAGSAFAGTVGKAASSVKLLSFSGKIHLKKR* |
| Ga0157379_123423261 | 3300014968 | Switchgrass Rhizosphere | DFPLEPEHTSFVVKAGSAFAGTLGKAASSVKLFTFSGKIHLKKR* |
| Ga0137403_105550432 | 3300015264 | Vadose Zone Soil | VTARSVRGKVENDFPLEPKHTPFVVKAGSAFAGTMNKAASSVRLFSFSGKIHLKKR* |
| Ga0132256_1027021062 | 3300015372 | Arabidopsis Rhizosphere | PDDASIEVIAHSVRGKVENDFRLQPKHTPFTIKAGSAFAGTMNKAASSVKLFSFSGKIHLKKR* |
| Ga0182035_109629161 | 3300016341 | Soil | KNHTFFSQVPGSAFAGTMGKAASSVVLRTFSGKIHLKKR |
| Ga0134112_101472413 | 3300017656 | Grasslands Soil | FQPKKHTTFPVVAGSSFAGTIGKAASSVVLRTFSGKIRLKKR |
| Ga0187802_100317794 | 3300017822 | Freshwater Sediment | VARSVQGRVENDFPLQPEHTSFAPRAGSTFAGTMGEAASSVKLLSFSGKIHLKKR |
| Ga0187802_103421021 | 3300017822 | Freshwater Sediment | SIDVVAHSIRGKVENDFLLQPERYSFIAGAGSAFAGTMGKAASSVKLLSFSGKIHLKKR |
| Ga0187824_100441993 | 3300017927 | Freshwater Sediment | GQVQNDVPLQPKVHTSFLVREGSSFAGTINKAASSVWLRTFSGRIHLKKR |
| Ga0187824_100892543 | 3300017927 | Freshwater Sediment | EPKHTPFVVKAGSAFAGTMNKAASSVRLFSFSGKIHLKKR |
| Ga0187801_102629971 | 3300017933 | Freshwater Sediment | KVQNDFPLQPEHTSFVARAGSAFAGTVGQAASSVKLLSFSGKIHLKKREQ |
| Ga0187809_102686042 | 3300017937 | Freshwater Sediment | AFASIEVVARSVQGRVENDFPLQPEHTSFAPRAGSTFAGTMGEAASSVKLLSFSGKIHLKKR |
| Ga0187777_103372993 | 3300017974 | Tropical Peatland | DVMASSTQGKVENDFLLQPTHTSLAAKAGSAFAGTMGKAASSVRLLSFSGKIHLKKR |
| Ga0187816_100438804 | 3300017995 | Freshwater Sediment | GRVENDFPLQPEHTSFAPRAGSTFAGTMGEAASSVKLLSFSGKIHLKKR |
| Ga0187815_103787312 | 3300018001 | Freshwater Sediment | ASIDVVASSAQGKVENDFPLQPSHTSFAAKAGSAFAGTMGKAASSVKLLSFSGKIHLKKR |
| Ga0187804_102593462 | 3300018006 | Freshwater Sediment | STQGKVTNDFPLQPARSSFAAKAGSAFAGTMGMAASSVKLFSFSGKIHLKKR |
| Ga0187888_10473964 | 3300018008 | Peatland | VVARSVQGRVDNDFPLRPEHTTFVPQAGSAFAGTMGEAASSVKLLSFSGKIHLKKR |
| Ga0187766_103793181 | 3300018058 | Tropical Peatland | ASIDVVASSERGKVENDFPLQPAHSSFVSRAGSAFAGTMGKAASSVKLLSFSGKIHLKKR |
| Ga0187766_108359942 | 3300018058 | Tropical Peatland | IDVMASSTQGKVENDFPLQPTHTSLAAKAGSAFAGTMGKAASSVRLLSFSGKIHLKKR |
| Ga0187772_104303103 | 3300018085 | Tropical Peatland | ASSTQGKVENDFPLQPSHTSFAARAGSAFAGTMGKAASSVKLLSFSGKIHLKKR |
| Ga0187769_100886784 | 3300018086 | Tropical Peatland | FVQRAGSAFAGTLGKAASSVKLLSFSGKIHLKKRQ |
| Ga0187769_101108331 | 3300018086 | Tropical Peatland | TQGKVVNDFPLQPAHTSFAAKAGTAFAGTMGKAASSVKLLSFSGKIHLKKR |
| Ga0187771_102491823 | 3300018088 | Tropical Peatland | ASIDVVAESVKGKVVNDFSLQPAHSSFVERAGSAFAGTLGKAASSVKLLSFSGKIHLKKR |
| Ga0187771_103104491 | 3300018088 | Tropical Peatland | NDFPLQPVHTSFAARAGSAFAGTMGKAASSVKLLSFSGKIHLKKR |
| Ga0066662_113473962 | 3300018468 | Grasslands Soil | STNGLVQSDFSLEPKHAPFLVRGANSLSGTIGKAAASSVNLFSFSGKIRLKKRQN |
| Ga0066669_112189781 | 3300018482 | Grasslands Soil | KHTPFAMKVGSAFAGTLGKAASSVNLFSFSGKIHLKKRQN |
| Ga0187798_14402512 | 3300019275 | Peatland | SVKGKVVNDFPLRPTNDTFVQRAGSAFAGTLGKAASSVKLLSFSGKIHLKKRQ |
| Ga0187800_18116971 | 3300019278 | Peatland | ASIDVVAESVKGKVVNDFPLRPTNDTFVARAGSAFAGTLGKAASSVKLLSFSGKIHLKKR |
| Ga0193730_11288501 | 3300020002 | Soil | PEHTSFVVKAGSAFAGTLGKAASSVKLFTFSGKIHLKKR |
| Ga0179594_103131541 | 3300020170 | Vadose Zone Soil | LLEPKHTPFVVKAGSAFAGTMNKAASSVRLFSFSGKIHLKKR |
| Ga0210407_108224511 | 3300020579 | Soil | RSSNGAVQSDFSLEPKHTPFVAAVGSAFHGTLNKAASSVSLFSFSGRIHLKKRQN |
| Ga0210403_105586033 | 3300020580 | Soil | KVDNDFPLEPEHTSFVPRAGSAFAGTVGQAASSVNLLSFSGKIHLKKREQ |
| Ga0210403_114318512 | 3300020580 | Soil | ASIDVVARSVQGKVENDFPLLPEHTSFVTRAGSAFAGTMGKAASSVKLLSFSGKIHLKKR |
| Ga0210399_100801214 | 3300020581 | Soil | DFPLQPEHTSFAPRAGSTFAGTMGEAASSVKLLSFSGKIHLKKR |
| Ga0210395_101591734 | 3300020582 | Soil | AQGKVENDFPLQPPHSSFVSRAGSAFAGTMGKAASTVKLLSFSGKIHLKKR |
| Ga0210395_106147482 | 3300020582 | Soil | FVVKAGSAFAGTMNKAASSVRLFSFSGKIHLKKRSETR |
| Ga0210401_101089694 | 3300020583 | Soil | NDFPLQPEHTSFAPRAGSTFAGTMGEAASSVKLLSFSGKIHLKKR |
| Ga0210396_112475691 | 3300021180 | Soil | TSFVPRAGSAFAGTMGEAGSSVKLLSFSGKIHLKKR |
| Ga0210384_100889824 | 3300021432 | Soil | DVTARSVQGQVENDFPLQPKHTPFPIKAGSAFAGTVGKAASSVKLFSFSGKIHLKKR |
| Ga0210398_111846082 | 3300021477 | Soil | VDNDFTLQPEHTSFVTRAGSAFAGTVGQAASSVNLLSFSGKIHLKKREQ |
| Ga0126371_130632082 | 3300021560 | Tropical Forest Soil | DDASIEVIAHSVKGKVENDFRLQPKHTPFTIKAGSAFAGTMNKAASSVRLFSFSGKIHLKKR |
| Ga0242656_10156091 | 3300022525 | Soil | IEVVARSVQGRVENDFPLQPEHTSFAPRAGSTFAGTMGEAASSVKLLSFSGKIHLKKR |
| Ga0242664_10815101 | 3300022527 | Soil | GEVQNDVPLQPKVHTSFLVRQGSSFAGTINKAASSVWLRTFSGRIHLKKR |
| Ga0242665_101574272 | 3300022724 | Soil | IDVTARSVRGKVENDFLLEPKHTPFVVRAGSAFAGTMNKAASSVRLFSFSGKIHLKKR |
| Ga0207656_107311071 | 3300025321 | Corn Rhizosphere | SVRGKVENDFLLEPKHTPFVVRAGSAFAGTMNKAASSVRLFSFSGKIHLKKR |
| Ga0207692_106970551 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | YAKGGSAFAGTLGKAASSVKLFSFSGKIHLKKRQN |
| Ga0207680_113385841 | 3300025903 | Switchgrass Rhizosphere | SSEGRVDSDFSLEPKHTPFIAKAGSYFSGTLNKAASSVRLMSFSGRIHLKKRQ |
| Ga0207685_102206002 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VRGKVENDFLLEPKHTNFAMKAGSAFAGTMNKAASSVKLFSFSGRIHLKSLQATR |
| Ga0207685_103211961 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VHTSFLVKEGSSFAGTINKAASSVWLRTFSGKIHLKRR |
| Ga0207671_104048463 | 3300025914 | Corn Rhizosphere | KVENDFLLEPKHTNFAMKAGSAFAGTMNKAASSVKLFSFSGRIHLKSLQATR |
| Ga0207663_100777224 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | PKHTPFLASAGSAFAGTLGKAASSVKLFSFSGKIHLKKRQN |
| Ga0207660_100970244 | 3300025917 | Corn Rhizosphere | KHTPFIAKAGSYFSGTLNKAASSVRLMSFSGKIHLKKRQ |
| Ga0207650_103478711 | 3300025925 | Switchgrass Rhizosphere | GRVDSDFSLEPKHTPFIAKAGSYFSGTLNKAASSVRLMSFSGKIHLKKRQ |
| Ga0207687_102999901 | 3300025927 | Miscanthus Rhizosphere | HTPFIAKAGSYFSGTLNKAASSVRLMSFSGKIHLKKRQ |
| Ga0207700_100742681 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | FSLEPKHTPFIAKAGSYFSGTLNKAASSVRLMSFSGKIHLKKRQ |
| Ga0207664_104700711 | 3300025929 | Agricultural Soil | RVESDFSLEPKHTPFYAKGGSAFAGTLGMAASSVKLFSFSGRIHLKKRQ |
| Ga0207664_119720841 | 3300025929 | Agricultural Soil | DFSLDPKHAPFLIRGANSLSGTIGKAASSVKLFSFSGKIRLKKRQN |
| Ga0207704_113151841 | 3300025938 | Miscanthus Rhizosphere | VRGKVENDFLLEPKHTPFVVRAGSAFAGTMNKAASSVRLFSFSGKIHLKKR |
| Ga0207665_108606813 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | SIDVTARSVRGKVENDFLLEPKHTNFAMKAGSAFAGTMNKAASSVKLFSFSGRIHLKSLQATR |
| Ga0207667_106556852 | 3300025949 | Corn Rhizosphere | VDSDFSLEPKHTPFYAKAGSYFSGTLGKAASSVKLMSFSGKIHLKKRQ |
| Ga0207640_120465271 | 3300025981 | Corn Rhizosphere | PLEPEHTSFVVKAGSAFAGTLGKAASSVKLFTFSGKIHLKKR |
| Ga0207658_105455933 | 3300025986 | Switchgrass Rhizosphere | LLEPKHTNFAMKAGSAFAGTMNKAASSVKLFSFSGRIHLKSLQATR |
| Ga0207702_111018252 | 3300026078 | Corn Rhizosphere | FVVKAGSAFAGTMNKAASSVRLFSFSGKIHLKKRSN |
| Ga0209890_100932073 | 3300026291 | Soil | SIDVTARSEQGKVENDFELQPKHTWFPIKAGSAFAGTVGKAASSVKLFSISGKIHLKKR |
| Ga0209265_10718501 | 3300026308 | Soil | VLARSDQGHVDSDFSLEPKHTPFYAKGGSAFAGTLGKAASSVKLFSFSGKIHLKKRQN |
| Ga0257178_10257432 | 3300026446 | Soil | KVENDFLLEPKHTPFVVKAGSAFAGTMNKAASSVRLFSFSGKIHLKKR |
| Ga0257181_10479951 | 3300026499 | Soil | GKVENDFLLEPKHTPFVVKAGSAFAGTMNKAASSVRLFSFSGKIHLKKR |
| Ga0209214_10040703 | 3300027071 | Forest Soil | KVHTSFLVKEGSSFAGTINKAASSVWLRTFSGKIHLKKR |
| Ga0208860_10052023 | 3300027076 | Forest Soil | NGAVQSDFSLEPKHTPFVAAVGSAFHGTLNKAASSVSLFSFSGRIHLKKRQN |
| Ga0207948_10305252 | 3300027174 | Forest Soil | ASIEVVARSVQGRVENDFPLQPEHTSFVARAGSAFAGTMGEAASSVKLLSFSGKIHLKKH |
| Ga0209622_10955501 | 3300027502 | Forest Soil | TPFTIKAGSAFAGTMNKAASSVKLFSFSGKIHLKKR |
| Ga0209221_10093561 | 3300027609 | Forest Soil | GTVEKDFPLEPEHTSFVPRAGSAFAGTMGEAASSVKLLSFSGKIHLKKR |
| Ga0209217_11872102 | 3300027651 | Forest Soil | PKNHNWFPTKVGSAFSGTINKAASSVVLRTFSGKIHLKKRSEK |
| Ga0209009_11824092 | 3300027667 | Forest Soil | IDVTARSVRGKVENDFLLEPKHTPFVVKAGSAFAGTMNKAASSVRLFSFSGKIHLKKRSETR |
| Ga0209180_101149631 | 3300027846 | Vadose Zone Soil | LEPKHAPFLLKSGSAFSGTLGKAASSVKLFSFSGKIHLKKRQN |
| Ga0209166_106170591 | 3300027857 | Surface Soil | SHTSFASRAGSAFAGTINKAASSVKLLSFSGKIHLKKRQ |
| Ga0209590_100399311 | 3300027882 | Vadose Zone Soil | KVENDFPLQPKHTPFAIKAGSAFAGTMGKAASSVKLLSFSGKIHLKKR |
| Ga0209275_106712372 | 3300027884 | Soil | LQPEHTSFVPRAGSAFAGTMGEAASSVKLLSFSGKIHLKKR |
| Ga0209068_102739721 | 3300027894 | Watersheds | SVQGKVVNDFPLQPEHTSFPAKVGSAFAGTMGKAASSVKLLSFSGRIHLKKR |
| Ga0209415_110919322 | 3300027905 | Peatlands Soil | NDFQLHPPHSSFVSRAGSAFAGTMGKAASTVKLLSFSGKIHLKKR |
| Ga0209698_107527491 | 3300027911 | Watersheds | TPFIVREGSSFAGTINKAASIVWLRTFSGRIHLKKH |
| Ga0209526_102741631 | 3300028047 | Forest Soil | SVRGKVENDFSLEPKHTPFVVKAGSAFAGTMNKAASSVRLFSFSGKIHLKKR |
| Ga0137415_113771022 | 3300028536 | Vadose Zone Soil | GQVQNDVRLEPKAHTSFLVKEGSSFAGTINKAASSVWLRTFSGKIHLKKR |
| Ga0307504_101200773 | 3300028792 | Soil | HTSFLVKQGSSFAGTINKAASSVWLRTFSGKIHLKKR |
| Ga0311327_106299482 | 3300029883 | Bog | TYASIDVSASSMYGQVDNDFPLTPRHSSMAARAGSSFFGTIGKAASSVKLHSFSGKIHFKKRIASN |
| Ga0265393_11125941 | 3300030586 | Soil | ARSVQGRVENDFPLQPEHTSFTPRAGSTFAGTMGEAASSVKLLSFSGKIHLKKR |
| Ga0310038_102140283 | 3300030707 | Peatlands Soil | HTSFVARAGSAFAGTMGEAASSVKLLSFSGKIHLKKR |
| Ga0265762_10373481 | 3300030760 | Soil | VARSVQGTVEKDFPLQPEHTSFVPRAGSAFAGTMGEAASSVKLLSFSGKIHLKKR |
| Ga0265760_101499202 | 3300031090 | Soil | EKDFPLQPEHTSFVPRAGSAFAGTMGEAASSVKLLSFSGKIHLKKR |
| Ga0170824_1203563513 | 3300031231 | Forest Soil | ARSTNGIVQSDFSLDPKHAPFLVRGANSLSGTLGKAASSVKLFSFSGKIRLKKRQN |
| Ga0265325_103425212 | 3300031241 | Rhizosphere | KGTVENDFPLQPEHTSFVVKAGSAFAGTVGKAASSVKLFSFSGKIHLKKR |
| Ga0310915_112671101 | 3300031573 | Soil | ENDFPLQPTHTSLAAKAGSAFAGTMGKAASSVRLLSFSGKIHLKKR |
| Ga0307474_103918821 | 3300031718 | Hardwood Forest Soil | PMQPKTHTSFLAREGSSFAGTINKAASSVWLRTFSGRIHLKKR |
| Ga0306917_105617161 | 3300031719 | Soil | IDVMASSTEGKVENDFPLQPTHTSLAAKAGSAFAGTMGKAASSVRLLSFSGKIHLKKR |
| Ga0307469_114338062 | 3300031720 | Hardwood Forest Soil | PTDASFDVTARSVRGKVENDFLLEPKHTPFVVRAGSAFAGTMNKAASSVRLFSFSGKIHLKKR |
| Ga0307468_1015809012 | 3300031740 | Hardwood Forest Soil | DFPLEPKHTPFVVKAGSAFAGTMNKAASSVRLFSFSGKIHLKKR |
| Ga0307477_106045512 | 3300031753 | Hardwood Forest Soil | PKTHTSFLAREGSSFAGTINKAASSVWLRTFSGKIHLKKR |
| Ga0307475_107434552 | 3300031754 | Hardwood Forest Soil | HTAFPIKAGSAFAGTVGKAASSVKLFSFSGKIHLKKR |
| Ga0318535_102897961 | 3300031764 | Soil | PKVHTSFLVREGSSFAGTFNKAASSVWLRTFSGRIHLKKR |
| Ga0307478_107280082 | 3300031823 | Hardwood Forest Soil | KAHTSFLVKEGSSFAGTINKAASSVWLRTFSGKIHLKKR |
| Ga0306919_104722713 | 3300031879 | Soil | ASIDVMASSTEGKVENDFPLQPTHTSLAAKAGSAFAGTMGKAASSVRLLSFSGKIHLKKR |
| Ga0306923_116999241 | 3300031910 | Soil | GKVENDFLLQPTHTSLAAKAGSAFAGTMGKAASSVRLLSFSGKIHLKKR |
| Ga0310916_103915441 | 3300031942 | Soil | PLQPTHTSLAAKAGSAFAGTMGKAASSVRLLSFSGKIHLKKR |
| Ga0308176_102806351 | 3300031996 | Soil | PKHTSFVVKAGSAFAGTMNKAASSVKLFSMSGKIHLKKR |
| Ga0307471_1007050783 | 3300032180 | Hardwood Forest Soil | NHNWFPTKVGSAFSGTINKAASSVVLRTFSGKIHLKKRSEK |
| Ga0307472_1005490851 | 3300032205 | Hardwood Forest Soil | FLLEPKHTPFVVKAGSAFAGTMNKAASSVRLFSFSGKIHLKKR |
| Ga0335085_108163421 | 3300032770 | Soil | SSAQGKVENDFYLQPSHTSFAARAGSAFAGTIGKAASSVKLFSVSGKIHLKKR |
| Ga0335078_104529843 | 3300032805 | Soil | SIDVIARSEKGTVENDFPLQPEHTSFVVKAGSAFAGTVGKAASSVKLFSFSGKIHLKKR |
| Ga0335078_115812382 | 3300032805 | Soil | TNGIVQSDFSLEPKHAPFIVKSANSLSGTLGKAASSVKLFSFSGRIRLKKRQN |
| Ga0335081_101625611 | 3300032892 | Soil | ASSTQGKVENDFPLQPTHTSLAAKAGSAFAGTMGKAASSVRLLSFSGKIHLKKR |
| Ga0335081_103360631 | 3300032892 | Soil | QGKVENDFRLQPSHSSFAAKAGSAFAGTVGKAASSVKLLSFSGKIHLKKR |
| Ga0335081_122785772 | 3300032892 | Soil | IDVTARSEQGKVESDFALSPSYTSFAVRAGSAFAGTMGKAASSVKLFSFSGRIHLRKR |
| Ga0314867_146426_2_196 | 3300033808 | Peatland | TPSYASIEVVASSEQGKVENDFRLQPSHSSFAAKAGSAFAGTVGKAASSVKLLSFSGKIHLKKR |
| Ga0334790_100361_1_135 | 3300033887 | Soil | TLQPEHTSFVPRAGSAFAGTVGQAASSVNLLSFSGKIHLKKREQ |
| ⦗Top⦘ |