| Basic Information | |
|---|---|
| Family ID | F027632 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 194 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LQFTSPTKPALITGSAGDGDDSAPDYRYLVVPLRALASA |
| Number of Associated Samples | 159 |
| Number of Associated Scaffolds | 194 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.52 % |
| % of genes near scaffold ends (potentially truncated) | 97.42 % |
| % of genes from short scaffolds (< 2000 bps) | 94.33 % |
| Associated GOLD sequencing projects | 155 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.742 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (34.536 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.165 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.938 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.96% β-sheet: 0.00% Coil/Unstructured: 91.04% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 194 Family Scaffolds |
|---|---|---|
| PF08044 | DUF1707 | 74.23 |
| PF00580 | UvrD-helicase | 0.52 |
| PF14224 | DUF4331 | 0.52 |
| PF03176 | MMPL | 0.52 |
| PF02768 | DNA_pol3_beta_3 | 0.52 |
| PF12840 | HTH_20 | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 194 Family Scaffolds |
|---|---|---|---|
| COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 0.52 |
| COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 0.52 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.52 |
| COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 0.52 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.52 |
| COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.74 % |
| Unclassified | root | N/A | 25.26 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002568|C688J35102_120894028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2085 | Open in IMG/M |
| 3300004472|Ga0068974_1054412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1278 | Open in IMG/M |
| 3300004478|Ga0068972_1073356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 882 | Open in IMG/M |
| 3300004977|Ga0072329_1049500 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300005329|Ga0070683_101300945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 699 | Open in IMG/M |
| 3300005334|Ga0068869_101287524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 644 | Open in IMG/M |
| 3300005355|Ga0070671_101389983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 620 | Open in IMG/M |
| 3300005439|Ga0070711_101277139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae | 636 | Open in IMG/M |
| 3300005439|Ga0070711_101331917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 623 | Open in IMG/M |
| 3300005439|Ga0070711_101812252 | Not Available | 535 | Open in IMG/M |
| 3300005440|Ga0070705_100345781 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300005537|Ga0070730_10682512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 652 | Open in IMG/M |
| 3300005541|Ga0070733_10437980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 872 | Open in IMG/M |
| 3300005610|Ga0070763_10765682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 569 | Open in IMG/M |
| 3300005610|Ga0070763_10801377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 556 | Open in IMG/M |
| 3300005615|Ga0070702_100456046 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300006031|Ga0066651_10432579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 699 | Open in IMG/M |
| 3300006050|Ga0075028_100582082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 662 | Open in IMG/M |
| 3300006059|Ga0075017_101147911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 608 | Open in IMG/M |
| 3300006162|Ga0075030_100298650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1288 | Open in IMG/M |
| 3300006172|Ga0075018_10453869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 661 | Open in IMG/M |
| 3300006176|Ga0070765_101629292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 607 | Open in IMG/M |
| 3300006755|Ga0079222_10519812 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300006804|Ga0079221_10827263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 668 | Open in IMG/M |
| 3300006854|Ga0075425_101177022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 872 | Open in IMG/M |
| 3300006903|Ga0075426_10590945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 828 | Open in IMG/M |
| 3300009520|Ga0116214_1348701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 573 | Open in IMG/M |
| 3300009523|Ga0116221_1251197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 764 | Open in IMG/M |
| 3300009551|Ga0105238_12034497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 608 | Open in IMG/M |
| 3300009698|Ga0116216_10278532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1020 | Open in IMG/M |
| 3300009698|Ga0116216_10592554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 668 | Open in IMG/M |
| 3300009764|Ga0116134_1029132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2199 | Open in IMG/M |
| 3300010152|Ga0126318_10587733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 856 | Open in IMG/M |
| 3300010152|Ga0126318_10843332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 568 | Open in IMG/M |
| 3300010152|Ga0126318_10904289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1113 | Open in IMG/M |
| 3300010320|Ga0134109_10192550 | Not Available | 750 | Open in IMG/M |
| 3300010322|Ga0134084_10419677 | Not Available | 526 | Open in IMG/M |
| 3300010360|Ga0126372_12628034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 555 | Open in IMG/M |
| 3300010366|Ga0126379_12508379 | Not Available | 614 | Open in IMG/M |
| 3300010371|Ga0134125_11873942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 652 | Open in IMG/M |
| 3300010865|Ga0126346_1009355 | Not Available | 621 | Open in IMG/M |
| 3300010865|Ga0126346_1255774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 701 | Open in IMG/M |
| 3300010865|Ga0126346_1263846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 605 | Open in IMG/M |
| 3300010880|Ga0126350_11981196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
| 3300011053|Ga0138531_178335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1244 | Open in IMG/M |
| 3300011058|Ga0138541_1026692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1303 | Open in IMG/M |
| 3300011120|Ga0150983_10927085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1137 | Open in IMG/M |
| 3300012199|Ga0137383_10235684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1341 | Open in IMG/M |
| 3300012400|Ga0134048_1270763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 678 | Open in IMG/M |
| 3300012404|Ga0134024_1216087 | Not Available | 631 | Open in IMG/M |
| 3300012929|Ga0137404_10764065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 877 | Open in IMG/M |
| 3300012987|Ga0164307_11310818 | Not Available | 606 | Open in IMG/M |
| 3300013307|Ga0157372_11824359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 699 | Open in IMG/M |
| 3300014969|Ga0157376_11976606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 621 | Open in IMG/M |
| 3300016270|Ga0182036_10942701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 709 | Open in IMG/M |
| 3300016341|Ga0182035_11461082 | Not Available | 615 | Open in IMG/M |
| 3300016371|Ga0182034_11974655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
| 3300016422|Ga0182039_10632823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 938 | Open in IMG/M |
| 3300017928|Ga0187806_1291992 | Not Available | 573 | Open in IMG/M |
| 3300017932|Ga0187814_10420510 | Not Available | 522 | Open in IMG/M |
| 3300017946|Ga0187879_10438202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 724 | Open in IMG/M |
| 3300017948|Ga0187847_10808062 | Not Available | 531 | Open in IMG/M |
| 3300017959|Ga0187779_10463164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 834 | Open in IMG/M |
| 3300017970|Ga0187783_10964434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 614 | Open in IMG/M |
| 3300017970|Ga0187783_11242228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 537 | Open in IMG/M |
| 3300017974|Ga0187777_10821026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 665 | Open in IMG/M |
| 3300018012|Ga0187810_10224340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 767 | Open in IMG/M |
| 3300018025|Ga0187885_10560352 | Not Available | 508 | Open in IMG/M |
| 3300018037|Ga0187883_10620121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 562 | Open in IMG/M |
| 3300018038|Ga0187855_10503134 | Not Available | 706 | Open in IMG/M |
| 3300018044|Ga0187890_10151631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1328 | Open in IMG/M |
| 3300018046|Ga0187851_10612276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 615 | Open in IMG/M |
| 3300018468|Ga0066662_12690097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 526 | Open in IMG/M |
| 3300020077|Ga0206351_10164551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 621 | Open in IMG/M |
| 3300020081|Ga0206354_10328996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 711 | Open in IMG/M |
| 3300020579|Ga0210407_10862762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 696 | Open in IMG/M |
| 3300020581|Ga0210399_11364090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 556 | Open in IMG/M |
| 3300021181|Ga0210388_10224059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1648 | Open in IMG/M |
| 3300021401|Ga0210393_10049056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3318 | Open in IMG/M |
| 3300021401|Ga0210393_10090605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2429 | Open in IMG/M |
| 3300021401|Ga0210393_11073807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
| 3300021402|Ga0210385_10503494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 919 | Open in IMG/M |
| 3300021404|Ga0210389_10819802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 726 | Open in IMG/M |
| 3300021405|Ga0210387_10216295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1667 | Open in IMG/M |
| 3300021407|Ga0210383_10517989 | Not Available | 1029 | Open in IMG/M |
| 3300021420|Ga0210394_11144807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 670 | Open in IMG/M |
| 3300021432|Ga0210384_11415206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 600 | Open in IMG/M |
| 3300021474|Ga0210390_10479626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1048 | Open in IMG/M |
| 3300021474|Ga0210390_11257156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 595 | Open in IMG/M |
| 3300021476|Ga0187846_10006606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5801 | Open in IMG/M |
| 3300021476|Ga0187846_10180934 | Not Available | 887 | Open in IMG/M |
| 3300021479|Ga0210410_11567945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
| 3300022467|Ga0224712_10639692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 521 | Open in IMG/M |
| 3300022522|Ga0242659_1081971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 615 | Open in IMG/M |
| 3300022527|Ga0242664_1033482 | Not Available | 876 | Open in IMG/M |
| 3300022527|Ga0242664_1041668 | Not Available | 811 | Open in IMG/M |
| 3300022528|Ga0242669_1059591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 670 | Open in IMG/M |
| 3300022528|Ga0242669_1071520 | Not Available | 629 | Open in IMG/M |
| 3300022708|Ga0242670_1023737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 751 | Open in IMG/M |
| 3300022709|Ga0222756_1027468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 766 | Open in IMG/M |
| 3300022717|Ga0242661_1116735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 572 | Open in IMG/M |
| 3300022718|Ga0242675_1089490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 577 | Open in IMG/M |
| 3300022721|Ga0242666_1113704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 636 | Open in IMG/M |
| 3300025898|Ga0207692_10198875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1177 | Open in IMG/M |
| 3300025911|Ga0207654_10911049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 638 | Open in IMG/M |
| 3300025914|Ga0207671_11051176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 641 | Open in IMG/M |
| 3300026217|Ga0209871_1036331 | Not Available | 927 | Open in IMG/M |
| 3300026911|Ga0209620_1006893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 910 | Open in IMG/M |
| 3300027497|Ga0208199_1121661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 534 | Open in IMG/M |
| 3300027590|Ga0209116_1052555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 881 | Open in IMG/M |
| 3300027765|Ga0209073_10031234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1651 | Open in IMG/M |
| 3300027853|Ga0209274_10027029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2640 | Open in IMG/M |
| 3300027855|Ga0209693_10313467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 764 | Open in IMG/M |
| 3300027855|Ga0209693_10351649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 715 | Open in IMG/M |
| 3300027908|Ga0209006_10457417 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300028793|Ga0307299_10383779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 527 | Open in IMG/M |
| 3300028877|Ga0302235_10422378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
| 3300028879|Ga0302229_10356526 | Not Available | 653 | Open in IMG/M |
| 3300028906|Ga0308309_10935089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 752 | Open in IMG/M |
| 3300028906|Ga0308309_11578679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
| 3300029636|Ga0222749_10166661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1083 | Open in IMG/M |
| 3300029701|Ga0222748_1027084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 875 | Open in IMG/M |
| 3300029701|Ga0222748_1033664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 815 | Open in IMG/M |
| 3300030058|Ga0302179_10159893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 995 | Open in IMG/M |
| 3300030545|Ga0210271_10321051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 746 | Open in IMG/M |
| 3300030582|Ga0210261_1202039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
| 3300030595|Ga0210276_10637425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 685 | Open in IMG/M |
| 3300030598|Ga0210287_1256026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
| 3300030626|Ga0210291_10022017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1232 | Open in IMG/M |
| 3300030730|Ga0307482_1067535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 912 | Open in IMG/M |
| 3300030730|Ga0307482_1248129 | Not Available | 558 | Open in IMG/M |
| 3300030738|Ga0265462_10121204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1228 | Open in IMG/M |
| 3300030738|Ga0265462_11114421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 694 | Open in IMG/M |
| 3300030738|Ga0265462_11405264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 642 | Open in IMG/M |
| 3300030743|Ga0265461_10192699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1234 | Open in IMG/M |
| 3300030743|Ga0265461_11680614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 702 | Open in IMG/M |
| 3300030743|Ga0265461_12338949 | Not Available | 624 | Open in IMG/M |
| 3300030969|Ga0075394_10999234 | Not Available | 532 | Open in IMG/M |
| 3300030973|Ga0075395_11467227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 910 | Open in IMG/M |
| 3300031231|Ga0170824_100818238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 517 | Open in IMG/M |
| 3300031231|Ga0170824_117250445 | Not Available | 833 | Open in IMG/M |
| 3300031231|Ga0170824_124185125 | Not Available | 986 | Open in IMG/M |
| 3300031236|Ga0302324_102914275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 572 | Open in IMG/M |
| 3300031469|Ga0170819_13210695 | Not Available | 654 | Open in IMG/M |
| 3300031469|Ga0170819_17411785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1218 | Open in IMG/M |
| 3300031546|Ga0318538_10412898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 730 | Open in IMG/M |
| 3300031561|Ga0318528_10812172 | Not Available | 500 | Open in IMG/M |
| 3300031572|Ga0318515_10118841 | Not Available | 1396 | Open in IMG/M |
| 3300031573|Ga0310915_10944863 | Not Available | 603 | Open in IMG/M |
| 3300031616|Ga0307508_10768953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 578 | Open in IMG/M |
| 3300031681|Ga0318572_10124696 | Not Available | 1473 | Open in IMG/M |
| 3300031708|Ga0310686_107886485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 720 | Open in IMG/M |
| 3300031708|Ga0310686_110192875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 639 | Open in IMG/M |
| 3300031708|Ga0310686_113355014 | Not Available | 751 | Open in IMG/M |
| 3300031713|Ga0318496_10005605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5698 | Open in IMG/M |
| 3300031744|Ga0306918_10419395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1044 | Open in IMG/M |
| 3300031753|Ga0307477_10792446 | Not Available | 630 | Open in IMG/M |
| 3300031765|Ga0318554_10071689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1920 | Open in IMG/M |
| 3300031765|Ga0318554_10165727 | Not Available | 1256 | Open in IMG/M |
| 3300031771|Ga0318546_10948742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 605 | Open in IMG/M |
| 3300031782|Ga0318552_10299588 | Not Available | 817 | Open in IMG/M |
| 3300031792|Ga0318529_10043248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1918 | Open in IMG/M |
| 3300031792|Ga0318529_10087880 | Not Available | 1391 | Open in IMG/M |
| 3300031795|Ga0318557_10259786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 796 | Open in IMG/M |
| 3300031797|Ga0318550_10351449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 714 | Open in IMG/M |
| 3300031821|Ga0318567_10592073 | Not Available | 630 | Open in IMG/M |
| 3300031832|Ga0318499_10138320 | Not Available | 949 | Open in IMG/M |
| 3300031845|Ga0318511_10269728 | Not Available | 766 | Open in IMG/M |
| 3300031938|Ga0308175_103181770 | Not Available | 509 | Open in IMG/M |
| 3300031962|Ga0307479_10671670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1016 | Open in IMG/M |
| 3300032010|Ga0318569_10442099 | Not Available | 606 | Open in IMG/M |
| 3300032043|Ga0318556_10635499 | Not Available | 556 | Open in IMG/M |
| 3300032044|Ga0318558_10263515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 849 | Open in IMG/M |
| 3300032060|Ga0318505_10601047 | Not Available | 517 | Open in IMG/M |
| 3300032066|Ga0318514_10043825 | Not Available | 2144 | Open in IMG/M |
| 3300032067|Ga0318524_10234845 | Not Available | 942 | Open in IMG/M |
| 3300032090|Ga0318518_10205864 | Not Available | 1007 | Open in IMG/M |
| 3300032094|Ga0318540_10519049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 575 | Open in IMG/M |
| 3300032119|Ga0316051_1022087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 589 | Open in IMG/M |
| 3300032160|Ga0311301_12648028 | Not Available | 554 | Open in IMG/M |
| 3300032515|Ga0348332_13485891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1358 | Open in IMG/M |
| 3300032756|Ga0315742_11732664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 682 | Open in IMG/M |
| 3300032782|Ga0335082_10999647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 701 | Open in IMG/M |
| 3300032805|Ga0335078_10963221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1016 | Open in IMG/M |
| 3300032805|Ga0335078_12077919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 604 | Open in IMG/M |
| 3300032892|Ga0335081_10042325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 7220 | Open in IMG/M |
| 3300032897|Ga0335071_10251352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1721 | Open in IMG/M |
| 3300033134|Ga0335073_11143261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 788 | Open in IMG/M |
| 3300033158|Ga0335077_11635924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 611 | Open in IMG/M |
| 3300033158|Ga0335077_11675299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 602 | Open in IMG/M |
| 3300033158|Ga0335077_12030754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 533 | Open in IMG/M |
| 3300033158|Ga0335077_12203395 | Not Available | 506 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 34.54% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.67% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.15% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.12% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.09% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.09% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.58% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.06% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.06% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.06% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.06% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.06% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.06% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.55% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.55% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.03% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.03% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.03% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.03% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.52% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.52% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.52% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.52% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004472 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004478 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004977 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 67 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010865 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011053 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 9 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011058 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 22 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012404 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300026911 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030545 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030578 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO105-VCO054SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030582 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE022SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030595 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO083SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030598 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030626 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030973 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032119 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J35102_1208940281 | 3300002568 | Soil | KDPDAGAAAPEQARICLQFTSPTKPALITGSAGDGDDSAPDYRYLVVPLRALASA* |
| Ga0068974_10544123 | 3300004472 | Peatlands Soil | SFIPDEARIRLEFTNPTKPALITGSAGPGDQSAPDYRYLVVPLRALTSA* |
| Ga0068972_10733561 | 3300004478 | Peatlands Soil | LQFTSPAKPALITGSTGPGDESAPDYRYLVVPLRALASA* |
| Ga0072329_10495003 | 3300004977 | Peatlands Soil | ARICLQFTSPAKPALITGSTGPGDESAPDYRYLVVPLRALTSA* |
| Ga0070683_1013009452 | 3300005329 | Corn Rhizosphere | LQFTSPSKPALITGSAGDGDAAAAPDYRYLVVPLRALASA* |
| Ga0068869_1012875241 | 3300005334 | Miscanthus Rhizosphere | ARIRLQFTSPTKPALITGSTGNGDKPTPDYRYLVVPLRALAGA* |
| Ga0070671_1013899832 | 3300005355 | Switchgrass Rhizosphere | EQARICLQFTSPSKPALITGSAGDGDAAAPDYRYLVVPLRALASA* |
| Ga0070711_1012771391 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | CLQFTSPSKPALITGSAGDGDAAPDYRYLVVPLRALASA* |
| Ga0070711_1013319171 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LQFTSPTKPALITGSTGNGDEPAPDYRYLVVPLRTLAGT* |
| Ga0070711_1018122521 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | PAPEQARICLQFTSPSKPALITGSAGDGDAATPDYRYLVVPLRALASA* |
| Ga0070705_1003457813 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | PVPDEARIRLQFTSPTKPALITGSTGNGDKPTPDYRYLVVPLRALAGA* |
| Ga0070730_106825122 | 3300005537 | Surface Soil | LQFTSPTKPALITASTGDGDDRAPDYRYLVVPLRALASA* |
| Ga0070733_104379803 | 3300005541 | Surface Soil | PGPDGRIRLQFTGPTKPALITGSPKAGDESAPDYRYLVVPLRALADA* |
| Ga0070763_107656822 | 3300005610 | Soil | FTSPTKPALITGSAGPGDESAPDYRYLVVPLRTLASV* |
| Ga0070763_108013771 | 3300005610 | Soil | PEKDATAAPAEGRIRLQFTSPTKPALITGSPGMKGAGEVGGESAPDYRYLVVPLRALTSA |
| Ga0070702_1004560461 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | PDEARIRLQFTSPTKPALITGSTGNGDKPTPDYRYLVVPLRALAGA* |
| Ga0066651_104325791 | 3300006031 | Soil | SPTKPALITGSTGNGDEPAPDYRYLVVPLRTLAGT* |
| Ga0075028_1005820822 | 3300006050 | Watersheds | DEARIRLEFTSPTKPALITGSAGPGDESAPDYRYLVVPLRALASA* |
| Ga0075017_1011479112 | 3300006059 | Watersheds | TSPTKPALITGSAGPGDQSAPDYRYLVVPLRALASA* |
| Ga0075030_1002986501 | 3300006162 | Watersheds | AKEGRIRLQFTGPTKPALITGSPRMTGAGEVRGAIRGESAPDYRYLVVPLRALASA* |
| Ga0075018_104538692 | 3300006172 | Watersheds | QFTSPSKPALITGSTGNGDESAPDYRYLVVPLRALNGA* |
| Ga0070765_1016292921 | 3300006176 | Soil | EARIRLQFTSPTKPALITGSPGPSDEADEAAPDYRYLVVPLRALAST* |
| Ga0079222_105198121 | 3300006755 | Agricultural Soil | ARIRLQFTSPTKPALITGSTGDGDEPAPDYRYLVVPLRALAGA* |
| Ga0079221_108272631 | 3300006804 | Agricultural Soil | QFTSPTKPAVITGSTGNGDEPAPDYRYLVVPLRALAGA* |
| Ga0075425_1011770223 | 3300006854 | Populus Rhizosphere | QARICLQFTSPSKPALITGSAGDGDAAAPDYRYLVVPLRALASA* |
| Ga0075426_105909451 | 3300006903 | Populus Rhizosphere | PTKPALITGSIGNGDEPAPDYRYLVVPLRTLAGA* |
| Ga0116214_13487012 | 3300009520 | Peatlands Soil | ARIRLEFTSPTKPALITGRAGPGDQSVPDYRYLVVPLRALASA* |
| Ga0116221_12511971 | 3300009523 | Peatlands Soil | GAAPGPDGRIRLQFTGPTKPALITGSPKAGDESAPDYRYLVVPLRALADA* |
| Ga0105238_120344971 | 3300009551 | Corn Rhizosphere | PTKPALITGSTGNGDEPAPDYRYLVVPLRALAGA* |
| Ga0116216_102785323 | 3300009698 | Peatlands Soil | NSEKPSSIPDEARIRLEFTSPTKPALITGSAGPGDQSAPDYRYLVVPLRTLASA* |
| Ga0116216_105925541 | 3300009698 | Peatlands Soil | RLQFTGPTKPALITGSPKAGDESAPDYRYLVVPLRALADT* |
| Ga0116134_10291325 | 3300009764 | Peatland | KSERDGTATPAEGRIRLQFTSPAKPALITGSPRAGDESAPDYRYLVVPLRALTSA* |
| Ga0126318_105877331 | 3300010152 | Soil | PTKPALITGSTGNGDEPVPDYRYLVVPLRALAGA* |
| Ga0126318_108433321 | 3300010152 | Soil | APEQARICLQFTSPSKPALITGSAGDGDDAAPDYRYLVVPLRALASA* |
| Ga0126318_109042893 | 3300010152 | Soil | TSPTRPALITGLKGRADSAPDYRYLVVPLRELVTA* |
| Ga0134109_101925501 | 3300010320 | Grasslands Soil | FTSPTKPALITGSTGNGDEPTPDYRYLVVPLRALAGA* |
| Ga0134084_104196771 | 3300010322 | Grasslands Soil | PEQARICLQFTSPTKPALITGSTGDGDDSTPDYRYLVVPLRALASA* |
| Ga0126372_126280342 | 3300010360 | Tropical Forest Soil | TSPTKPALITGSAGDDDETPDYRYLVVPLRALASA* |
| Ga0126379_125083791 | 3300010366 | Tropical Forest Soil | PDRDQTPVATQGRIRLQFTSPTKPALITGSPQVKGAGEVGGEPAPDYRYLVVPLRALTSA |
| Ga0134125_118739421 | 3300010371 | Terrestrial Soil | CLQFTSPSKPALITGSAGDGDAAAPDYRYLVVPLRALASA* |
| Ga0126346_10093551 | 3300010865 | Boreal Forest Soil | AAPEQARICLQFTSPTKPALITGSAGDGDDSAPDYRYLVVPLRALASA* |
| Ga0126346_12557742 | 3300010865 | Boreal Forest Soil | LQFTSPTKPALITGSPGMKGAGEAGGESAPDYRYLVVPLRALASA* |
| Ga0126346_12638461 | 3300010865 | Boreal Forest Soil | STKPALITGSSGADGQAAPDYRYLVVPLRSLASA* |
| Ga0126350_119811962 | 3300010880 | Boreal Forest Soil | SGKPDRDGTAAEGRIRLQFTSPTKPALITGSQGMKGAGEAGGQSAPDYRYLVVPLRALASA* |
| Ga0138531_1783351 | 3300011053 | Peatlands Soil | RPTKPALITGRAGPGDQSVPDYRYLVVPLRALTSA* |
| Ga0138541_10266923 | 3300011058 | Peatlands Soil | SEKPSSIPDEARIRLQFTSSTKPALITGSAGPDDESAPHYRYLVVPLRALTSA* |
| Ga0150983_109270851 | 3300011120 | Forest Soil | RLQFTSPTKPALITGRARAGDDSEPDYRYLVVPLRALVG* |
| Ga0150983_151607283 | 3300011120 | Forest Soil | RIRLQFTSPTKPAVITGGARAADEPVPDFRYLVVPLRSLTSA* |
| Ga0137383_102356841 | 3300012199 | Vadose Zone Soil | LQFTSPTKPALITGSTGNGDEPAPDYRYLVVPLRALADA* |
| Ga0134048_12707631 | 3300012400 | Grasslands Soil | LQFTSPTKPALITGSTGNGDEPAPDYRYLVVPLRALAGA* |
| Ga0134024_12160871 | 3300012404 | Grasslands Soil | LQFTSPTKPALITGSTGNGDEPAPDYRYLVVPLRTLAGA* |
| Ga0137404_107640652 | 3300012929 | Vadose Zone Soil | VPGPEQARICLQFTSPTKPALITASAGDGDDSAPDYRYLVVPLRALASA* |
| Ga0164307_113108181 | 3300012987 | Soil | ARICLQFTSPSKPALITGSAGDGDAAPDYRYLVVPLRALASA* |
| Ga0157372_118243591 | 3300013307 | Corn Rhizosphere | PTKPALITGSTGNGDEPAPDYRYLVVPLRTLAGA* |
| Ga0157376_119766061 | 3300014969 | Miscanthus Rhizosphere | QFTSPTKPALITGSTGNGDEPAPDYRYLVVPLRALAGA* |
| Ga0182036_109427011 | 3300016270 | Soil | VPAAKEGRIRLQFTSPTKPALITGRPQMKGAGEVGGESAPDYRYLVVPLRALTSA |
| Ga0182035_114610821 | 3300016341 | Soil | IRLQFTGPTKPALITGSPPMKGAAQENAPDYRYLVVPLRALASA |
| Ga0182034_119746551 | 3300016371 | Soil | KEGRIRLQFTGPTKPALITGSPAMNGAGGGGAASAPDYRYLVVPLRALASA |
| Ga0182039_106328231 | 3300016422 | Soil | VAKEGRIRLQFTSPTKPALITGSPRADDESAPDYRYLV |
| Ga0187806_12919921 | 3300017928 | Freshwater Sediment | RLQFTGPTKPALITGSPRMTGAGEVGGESAPDYRYLVVPLRALASA |
| Ga0187814_104205101 | 3300017932 | Freshwater Sediment | ATQGRIRLQFTGPTKPALITGSPRMTGAGEVGGEFAPDFRYLVVPLRALASA |
| Ga0187879_104382021 | 3300017946 | Peatland | IRLQFTSPTKPALITGSARVGDDSDPDYRYLVVPLRALAG |
| Ga0187847_108080621 | 3300017948 | Peatland | TSATKPALITGSARAGDDSVPDYRYLVVPLRALTG |
| Ga0187779_104631641 | 3300017959 | Tropical Peatland | KPALITGSPSVKGAGEVGGESAPDYRYLVVPLRALTSA |
| Ga0187783_109644341 | 3300017970 | Tropical Peatland | LGREGAAQGPGGRIRLQFTGPTKPALITGSAKAGDESAPDYRYLVVPLRALADA |
| Ga0187783_112422282 | 3300017970 | Tropical Peatland | TGPTKPALITGSPKAGDEAAPDYRYLVVPLRALADA |
| Ga0187777_108210261 | 3300017974 | Tropical Peatland | TKPALITGRPRMKGAGEVGGESAPDFRYLVVPLRALASA |
| Ga0187810_102243401 | 3300018012 | Freshwater Sediment | SPTKPALITGSPGADDESAPDYRYLVVPLRALTSA |
| Ga0187885_105603522 | 3300018025 | Peatland | EEARIRLQFTSPTKPALITGSARVGDDSDPDYRYLVVPLRALAG |
| Ga0187883_106201211 | 3300018037 | Peatland | KPALITGSPGSGSPGPDGPAVPDYRYLVVPLRSLASA |
| Ga0187855_105031342 | 3300018038 | Peatland | FTSPTKPALITGRARADDEADPDYRYLVVPLRALVG |
| Ga0187890_101516311 | 3300018044 | Peatland | PSPEEARIRLQFTSPTKPALITGSARVGDDSDPDYRYLVVPLRALAG |
| Ga0187851_106122761 | 3300018046 | Peatland | RIRLQFTSPTKPALITGSARVGDDSDPDYRYLVVPLRTLAG |
| Ga0066662_126900972 | 3300018468 | Grasslands Soil | RICLQFTSPTKPALITGSAGDGDDSAPDYRYLVVPLRALASA |
| Ga0206351_101645511 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | ICLQFTSPSKPALITGSAGDGDDAAPDYRYLVVPLRALASA |
| Ga0206354_103289962 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | CLQFTSPTKPALITGSAGDGDDSAPDYRYLVVPLRALASA |
| Ga0210407_108627623 | 3300020579 | Soil | SPTKPALITGSAGPGDESVPDYRYLVVPLRTLTSA |
| Ga0210399_113640901 | 3300020581 | Soil | APAEGRIRLQFTSPTKPAVITGRPGMKRAGEAGGESAPDYRYLVVPLRALASG |
| Ga0210388_102240594 | 3300021181 | Soil | ARIRLQFTSPTKPALITGSAGPGDDSAPDYRYLVVPLRALAST |
| Ga0210393_100490567 | 3300021401 | Soil | TSPTKPALITASPRPGEESVPDYRYLVVPLRALADA |
| Ga0210393_100906055 | 3300021401 | Soil | ERAASIPDEARIRLEFTSPTKPALITGSAGPGDESAPDYRYLVVPLRTLASV |
| Ga0210393_110738072 | 3300021401 | Soil | EARIRLQFTSPTKPALITGSAGPGDDSAPDYRYLVVPLRALASA |
| Ga0210385_105034942 | 3300021402 | Soil | TAAEGRIRLQFTSPTKPALITGSPGPGDTSAPDYRYLVVPLRALASA |
| Ga0210389_108198021 | 3300021404 | Soil | QFTSPTKPALITGSTGNGDEPAPDYRYLVVPLRTLAGA |
| Ga0210387_102162952 | 3300021405 | Soil | KPEKDATAAPAEGRIRLQFTSPTKPALITGSPGMEGAGEVGGESAPDYRYLVVPLRALAS |
| Ga0210383_105179891 | 3300021407 | Soil | TSPTKPALITGSPGPGDTSAPDYRYLVVPLRALASA |
| Ga0210394_111448071 | 3300021420 | Soil | GKPDRDGTAAEGRIRLQFTSPTKPALITGSPGPGDTSAPDYRYLVVPLRALASA |
| Ga0210384_114152061 | 3300021432 | Soil | TSPTKPALITGSTGNGDEPAPDYRYLVVPLRTLAGT |
| Ga0210390_104796261 | 3300021474 | Soil | PSQEGCVRLEFTSPTKPALITASPRPGEESVPDYRYLVVPLRALADA |
| Ga0210390_112571561 | 3300021474 | Soil | IPDEARIRLEFTSPTKPALITGSAGPGDESAPDYRYLVVPLRTLASV |
| Ga0187846_100066068 | 3300021476 | Biofilm | QFTGPTKPALITGSPRAGDESVPDFRYLVVPLRALADA |
| Ga0187846_101809342 | 3300021476 | Biofilm | PALITGSPRMKGAGEVRGAIRGESDPDYRYLVVPLRSLASA |
| Ga0210410_115679452 | 3300021479 | Soil | KPDRDGTAAEGRIRLQFTSPTKPALITGSPGPGDPSAPDYRYLVVPLRALTSA |
| Ga0224712_106396922 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | LQFTSPTKPALITGSAGDGDDSAPDYRYLVVPLRALASA |
| Ga0242659_10819712 | 3300022522 | Soil | AESAEDARIRLQFTSPTKPAVITGTVREHTGEAPDFRYLVVPLRALASA |
| Ga0242664_10334823 | 3300022527 | Soil | TSPTKPALITGSAGPGDDSAPDYRYLVVPLRALAST |
| Ga0242664_10416681 | 3300022527 | Soil | LQFTSPTKPALITGSARPHDESAPDYRYLVVPLRALASA |
| Ga0242669_10595911 | 3300022528 | Soil | TSPTKPALITGSSAADGQAVPDYRYLVVPLRSLASA |
| Ga0242669_10715201 | 3300022528 | Soil | RICLQFTSPTKPALITGSAGPGDDSAPDYRYLVVPLRALASA |
| Ga0242670_10237371 | 3300022708 | Soil | TSPTKPALITGSTGNGDEPAPDYRYLVVPLRTLAGA |
| Ga0222756_10274681 | 3300022709 | Soil | RIRLQFTSPTKPAVITGTVREHTGEAPDFRYLVVPLRALASA |
| Ga0242661_11167351 | 3300022717 | Soil | RIRLQFTGPTEPALITGSPKAGDESAPDYRYLVVPLRALADA |
| Ga0242675_10894901 | 3300022718 | Soil | TSPTKPAVITGTVREHTGEAPDFRYLVVPLRALASA |
| Ga0242666_11137041 | 3300022721 | Soil | RIRLQFTSPTKPAVITGGARAADEPVPDFRYLVVPLRSLTSA |
| Ga0207692_101988753 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | FTSPTKPALITGSTGNGDEPAPDYRYLVVPLRALAGA |
| Ga0207654_109110491 | 3300025911 | Corn Rhizosphere | SPTKPALITGSTGDGDEPAPDYRYLVVPLRTLAGA |
| Ga0207671_110511761 | 3300025914 | Corn Rhizosphere | RIRLQFTSPTKPALITGSTGDGDEPAPDYRYLVVPLRTLAGA |
| Ga0209871_10363313 | 3300026217 | Permafrost Soil | QDTDPPPDEARICLQFTSPTKPALITGSARPGDESAPDYRYLVVPLRALTG |
| Ga0209620_10068933 | 3300026911 | Forest Soil | RLQFTSPTKPALITGSTGNGDKPTPDYRYLVVPLRALAGA |
| Ga0208199_11216611 | 3300027497 | Peatlands Soil | ARIRLEFTSPTKPALITGRAGPGDQSVPDYRYLVVPLRALASA |
| Ga0209116_10525553 | 3300027590 | Forest Soil | FTSPTKPALITGRARDDDDSDPDYRYLVVPLRALAG |
| Ga0209073_100312341 | 3300027765 | Agricultural Soil | SSPTKPALITGSTGNGDEPAPDYRYLVVPLRALAGA |
| Ga0209274_100270292 | 3300027853 | Soil | SGKPEKDATAAPAEGRIRLQFTSPTKPALITGSPGPGEESAPDYRYLVVPLRALTST |
| Ga0209693_103134672 | 3300027855 | Soil | ARIRLEFTSPTKPALITGSAGPGDESAPDYRYLVVPLRTLASV |
| Ga0209693_103516492 | 3300027855 | Soil | QFTSPTKPALITGSPKPGDESAPDYRYLVVPLRALAS |
| Ga0209006_104574173 | 3300027908 | Forest Soil | SIPDQARIRLEFTSPTKPALITGSAGPGDESAPDYRYLVVPLRTLASV |
| Ga0307299_103837791 | 3300028793 | Soil | LQFTSPTKPALITGSTGNGDEPAPDYRYLVVPLRALAGA |
| Ga0302235_104223781 | 3300028877 | Palsa | RIRLQFTSPTKPALITGSARAGDESDPDYRYLVVPLRALVG |
| Ga0302229_103565261 | 3300028879 | Palsa | RILLQFTSPTKPALITGSARAGDDSDPDYRYLVVPLRALVG |
| Ga0308309_109350892 | 3300028906 | Soil | EKAQNSEKAAPDEARIRLQFTSPTKPALITGSPGPSDEADEAAPDYRYLVVPLRALAST |
| Ga0308309_115786791 | 3300028906 | Soil | TAAPAEGRIRLQFTSPTKPALITGSPDMTGAGEVGGESAPDYRYLVVPLRALASG |
| Ga0222749_101666611 | 3300029636 | Soil | LQFTSPTKPALITGSTGNGDEPAPDYRYLVVPLRTLAGT |
| Ga0222748_10270842 | 3300029701 | Soil | RIRLQFTSPTKPALITGSPGMKGAGEVGGESAPDYRYLVVPLRALTSA |
| Ga0222748_10336641 | 3300029701 | Soil | FTSPTKPALITGSAGPGDESAPDYRYLVVPLRTLTSA |
| Ga0302179_101598931 | 3300030058 | Palsa | RIRLQFTSPTKPALITGIARVGDDSDPDYRYLVVPLRALVG |
| Ga0210271_103210511 | 3300030545 | Soil | TSPTKPALITGSARPGDEKTPDYRYLVVPLRTLSGT |
| Ga0210275_101426182 | 3300030578 | Soil | LLYHFISRLFFSSSPTKPALITGSAGGDDSDPDYRYLVVPLRALAG |
| Ga0210261_12020392 | 3300030582 | Soil | DGRIRLQFTGPTKPALITGSPKAGDESAPDYRYLVVPLRALADA |
| Ga0210276_106374251 | 3300030595 | Soil | YISLPKPGPDGRIRLQFTGPTKPALIAGSPKAGDESAPDYRYLVVPLRALADA |
| Ga0210287_12560261 | 3300030598 | Soil | TAAPAEGRIRLQFTSPTKPALITGSPGMKGAGEVDGESAPDYRYLVVPLRALASA |
| Ga0210291_100220173 | 3300030626 | Soil | LQFTSPTKPALITGSAGPGDESAPDYRYLVVPLRALSSA |
| Ga0307482_10675351 | 3300030730 | Hardwood Forest Soil | RIRLEFTSPTKPALITGSAGPGDQSAPDYRYLVVPLRTLTSA |
| Ga0307482_12481291 | 3300030730 | Hardwood Forest Soil | LQFTSPTKPALITGSPDMKGAGEVGGESAPDYRYLVVPLRALASG |
| Ga0265462_101212043 | 3300030738 | Soil | EFTSPTKPALITGSARPGDEKAPDYRYLVVPLRTLAGT |
| Ga0265462_111144212 | 3300030738 | Soil | LEFTSPTKPALITGSAGPGDESAPDYRYLVVPLRTLASA |
| Ga0265462_114052642 | 3300030738 | Soil | LLFIYFFSPTKPALITGSSAADGQAVPDYRYLVVPLRSLASA |
| Ga0265461_101926993 | 3300030743 | Soil | LEFTSPTKPALITGSARPGDEKAPDYRYLVVPLRTLAGT |
| Ga0265461_116806141 | 3300030743 | Soil | SPTKPALITGRAGPGDHSVPDYRYLVVPLRALASA |
| Ga0265461_123389491 | 3300030743 | Soil | SPTKPALITGSAGPGDESAPDYRYLVVPLRALSSA |
| Ga0075394_109992342 | 3300030969 | Soil | QFTSPTKPALITGLKGRADSAPDYRYLVVPLRELVTA |
| Ga0075395_114672273 | 3300030973 | Soil | QNADKAPAVSDEARIRLQFTSPTKPALITGSTGNGGEPAPDYRYLVVPLRALAGA |
| Ga0170824_1008182382 | 3300031231 | Forest Soil | FLFFQQFTSPTKPALITASTGDGDDSAPDYRYLVVPLRALASA |
| Ga0170824_1172504453 | 3300031231 | Forest Soil | LQFTSPTKPALITGLKGRADSAPDYRYLVVPLRELVTA |
| Ga0170824_1241851251 | 3300031231 | Forest Soil | IPDEARICLQFTSPTKPALITGSAGPGDDSAPDYRYLVVPLRALASA |
| Ga0302324_1029142751 | 3300031236 | Palsa | AAPAADGDGDDGGGGGEARIRLQFTGPTKPAVITGTKRDCAGSAPDFRYLVVPLRSLASA |
| Ga0170819_132106952 | 3300031469 | Forest Soil | FTSPTKPALITGSTGNGGEPAPDYRYLVVPLRALAGA |
| Ga0170819_174117851 | 3300031469 | Forest Soil | SPTKPALITASTGDGDDSAPDYRYLVVPLRALASA |
| Ga0318538_104128981 | 3300031546 | Soil | SPTKPALITGSTGNGDEPAPDYRYLVVPLRALADA |
| Ga0318528_108121721 | 3300031561 | Soil | QDQDGTSAAKEGRIRLQFTGPTKPALITGSPQVKGAGEVGGEPAPDYRYLVVPLRALTTA |
| Ga0318515_101188412 | 3300031572 | Soil | AKEGRIRLQFTGPTKPALITGSPQVKGAGEVGGEPAPDYRYLVVPLRALTTA |
| Ga0310915_109448632 | 3300031573 | Soil | QFTGPTKPALITGSPRADDEPAPDYRYLVVPLRALTSA |
| Ga0307508_107689531 | 3300031616 | Ectomycorrhiza | DAAEPGQARICLQFTSPTKPALITGSAGDGDGSAPDYRYLVVPLRALASA |
| Ga0318572_101246962 | 3300031681 | Soil | QFTGPTKPALITGSPQVKGAGEVGGEPAPDYRYLVVPLRALTTA |
| Ga0310686_1078864851 | 3300031708 | Soil | PAEGRIRLQFTSPTKPALITGSPGMKGAGPGEESAPDYRYLVVPLRALASA |
| Ga0310686_1101928752 | 3300031708 | Soil | GKPGREGAAPGPDGRIRLQFTGPTKPALITGSPKAGDESAPDYRYLVVPLRALADA |
| Ga0310686_1133550142 | 3300031708 | Soil | LQFTSPTKPALITGSPHMKGAGEVGGESDPDYRYLVVPLRALASG |
| Ga0318496_100056056 | 3300031713 | Soil | PTKPALITGSPQVKGAGEVGGEPAPDYRYLVVPLRALTTA |
| Ga0306918_104193951 | 3300031744 | Soil | FTSPTKPALITGSPKAGDESAPDYRYLVVPLRALAS |
| Ga0307477_107924461 | 3300031753 | Hardwood Forest Soil | GPTKPALITGSPRMTGAGEAGGESAPDFRYLVVPLRALASA |
| Ga0318554_100716891 | 3300031765 | Soil | QFTSPTKPALITGSPKAGDESAPDYRYLVVPLRALAS |
| Ga0318554_101657271 | 3300031765 | Soil | PSTPGSPAPQAQDGTTAAKEGRIRLQFTGPTKPALITGSPPMKGAAQENAPDYRYLVVPLRALASA |
| Ga0318546_109487421 | 3300031771 | Soil | GRIRLQFTSPTKPALITGSPGMKEAGEVGGESAPDYRYLVVPLRALASA |
| Ga0318552_102995881 | 3300031782 | Soil | LHLRAAKEGRIRLQFTSPTKPALITGRPQMKGAGEVGGESAPDYRYLVVPLRALASS |
| Ga0318529_100432485 | 3300031792 | Soil | AEKAPAAPDEARIRLEFTSPTKPALITGRTGNGDESAPDYRYLVVPLRALAGA |
| Ga0318529_100878802 | 3300031792 | Soil | RMRPSLAAASQDQDGTSAAKEGRIRLQFTGPTKPALITGSPQVKGAGEVGGEPAPDYRYLVVPLRALTTA |
| Ga0318557_102597861 | 3300031795 | Soil | APDEARIRLEFTSPTKPALITGRTGNGDESAPDYRYLVVPLRALAGA |
| Ga0318550_103514492 | 3300031797 | Soil | SPTKPALITGSTGNADEPTPDYRYLVVPLRALAGA |
| Ga0318567_105920731 | 3300031821 | Soil | QFTGPTKPALITGSPPMKGAAQENAPDYRYLVVPLRALASA |
| Ga0318499_101383201 | 3300031832 | Soil | LQFTGPTKPALITGSPQMKGAGEVGGESAPDYRYLVVPLRALASS |
| Ga0318511_102697281 | 3300031845 | Soil | PAAASQDQDGTSAAKEGRIRLQFTGPTKPALITGSPQVKGAGEVGGEPAPDYRYLVVPLRALTTA |
| Ga0308175_1031817701 | 3300031938 | Soil | AEGQNGDGGVPGPEQARICLQFTSPTKPALITGSAGDGDGSAPDYRYLVVPLRALASA |
| Ga0307479_106716702 | 3300031962 | Hardwood Forest Soil | DATAAPAEGRIRLQFTSPTKPALITGSPGLRGAGEGGESTPDYRYLVVPLRALASG |
| Ga0318569_104420991 | 3300032010 | Soil | FTGPTKPALITGSPRADDEPAPDYRYLVVPLRALTSA |
| Ga0318556_106354991 | 3300032043 | Soil | DQTPVATQGRIRLQFTSPTKPALITGSPQVKGAGEVGGEPAPDYRYLVVPLRALTTA |
| Ga0318558_102635151 | 3300032044 | Soil | DEARIRLEFTSPTKPALITGRTGNGDESAPDYRYLVVPLRALAGA |
| Ga0318505_106010471 | 3300032060 | Soil | LITGSPGMKGAGEVGGESAPDYRYLVVPLRALASA |
| Ga0318514_100438252 | 3300032066 | Soil | EGRIRLQFTGPTKPALITGSPQVKGAGEVGGEPAPDYRYLVVPLRALTTA |
| Ga0318524_102348452 | 3300032067 | Soil | LQFTSPTKPALITGSPRADAESAPDYRYLVVPLRALTSA |
| Ga0318518_102058641 | 3300032090 | Soil | LQFTGPTKPALITGSPRADDEPAPDYRYLVVPLRALTSA |
| Ga0318540_105190492 | 3300032094 | Soil | TSPAKPALITGSARPGDESAPDYRYLVVPLRALASA |
| Ga0316051_10220872 | 3300032119 | Soil | LQFTSPTKPALITGSSGADSQVAPDYRYLVVPLRSLASA |
| Ga0311301_126480282 | 3300032160 | Peatlands Soil | GSPAPQAQDGTTTAKEGRIRLQFTGPTKPALITGSPRMTGAGEVGGESAPDYRYLVVPLRALASA |
| Ga0348332_134858913 | 3300032515 | Plant Litter | LLYDRFDLGNSYRPAPAEGRIRLQFTGPTKPALITGSPGADGEPALDYRYLVVPLRALAS |
| Ga0315742_117326642 | 3300032756 | Forest Soil | PSVSGAQDAPAPAEGRIRLQFTSPTKPALITGSPGADGEAALDYRYLVVPLRALASV |
| Ga0335082_109996471 | 3300032782 | Soil | LQFTSPTKPALITGSVGDGDGSSPDYRYLVVPLRALASA |
| Ga0335078_109632211 | 3300032805 | Soil | FTSPTKPALITASAGDGDDSAPDYRYLVVPLRTLASA |
| Ga0335078_120779192 | 3300032805 | Soil | FTSPTKPALITGSAGNNDESVPDYRYLVVPLRALAGA |
| Ga0335081_100423251 | 3300032892 | Soil | AEGRIRLQFTSPTKPALITGSPQVKGEGEVGGESDPDYRYLVVPLRVLASA |
| Ga0335071_102513521 | 3300032897 | Soil | PDEARIRLQFTSPTKPALITASARAGDDSAPDYRYLVVPLRALAST |
| Ga0335073_111432613 | 3300033134 | Soil | RIRLQFTSPTKPALITGSPRAGADSAPDYRYLVVPLRVLTSA |
| Ga0335077_116359241 | 3300033158 | Soil | EGRIRLQFTSPTKPALITGSPQVKGEGEVGGESDPDYRYLVVPLRVLASA |
| Ga0335077_116752992 | 3300033158 | Soil | KAPTTPDEARIRLEFTSPTKPALITGRTGNGDGSAPDYRYLVVPLRALAGA |
| Ga0335077_120307541 | 3300033158 | Soil | SPDEARIRLQFTSPTKPALITASARAGDDSAPDYRYLVVPLRALASA |
| Ga0335077_122033951 | 3300033158 | Soil | GKLVRESAAPGPDGRIRLQFTGPTKPALITGSPKAGDESAPDYRYLVVPLRALADG |
| ⦗Top⦘ |