| Basic Information | |
|---|---|
| Family ID | F027603 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 194 |
| Average Sequence Length | 42 residues |
| Representative Sequence | GDKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNPND |
| Number of Associated Samples | 153 |
| Number of Associated Scaffolds | 194 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.09 % |
| % of genes near scaffold ends (potentially truncated) | 96.39 % |
| % of genes from short scaffolds (< 2000 bps) | 91.24 % |
| Associated GOLD sequencing projects | 147 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.938 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.340 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.711 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.938 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 20.59% Coil/Unstructured: 79.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 194 Family Scaffolds |
|---|---|---|
| PF01322 | Cytochrom_C_2 | 1.03 |
| PF12543 | DUF3738 | 0.52 |
| PF13249 | SQHop_cyclase_N | 0.52 |
| PF07690 | MFS_1 | 0.52 |
| PF05569 | Peptidase_M56 | 0.52 |
| PF02687 | FtsX | 0.52 |
| PF00069 | Pkinase | 0.52 |
| PF00512 | HisKA | 0.52 |
| PF00768 | Peptidase_S11 | 0.52 |
| PF13709 | DUF4159 | 0.52 |
| PF02517 | Rce1-like | 0.52 |
| PF00675 | Peptidase_M16 | 0.52 |
| PF00144 | Beta-lactamase | 0.52 |
| PF00656 | Peptidase_C14 | 0.52 |
| PF07743 | HSCB_C | 0.52 |
| PF09084 | NMT1 | 0.52 |
| PF10129 | OpgC_C | 0.52 |
| PF12680 | SnoaL_2 | 0.52 |
| PF04055 | Radical_SAM | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 194 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.06 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.03 |
| COG3909 | Cytochrome c556 | Energy production and conversion [C] | 1.03 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.52 |
| COG1076 | DnaJ domain-containing protein | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.52 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.52 |
| COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 0.52 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.52 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.45 % |
| Unclassified | root | N/A | 1.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001372|YBBDRAFT_1194824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300002124|C687J26631_10156197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300004114|Ga0062593_100037655 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2855 | Open in IMG/M |
| 3300004633|Ga0066395_10249850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 950 | Open in IMG/M |
| 3300004643|Ga0062591_101654014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300004799|Ga0058863_10694178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 740 | Open in IMG/M |
| 3300004803|Ga0058862_12870006 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005093|Ga0062594_101692248 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300005183|Ga0068993_10399126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300005330|Ga0070690_101094462 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300005330|Ga0070690_101347759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300005332|Ga0066388_100153964 | All Organisms → cellular organisms → Bacteria | 2881 | Open in IMG/M |
| 3300005332|Ga0066388_106140933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300005335|Ga0070666_10739518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 722 | Open in IMG/M |
| 3300005447|Ga0066689_10293163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
| 3300005456|Ga0070678_101897036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300005459|Ga0068867_101688177 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300005534|Ga0070735_10175125 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1322 | Open in IMG/M |
| 3300005540|Ga0066697_10471129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300005541|Ga0070733_10001808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 15684 | Open in IMG/M |
| 3300005541|Ga0070733_10982061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300005548|Ga0070665_101514477 | Not Available | 679 | Open in IMG/M |
| 3300005564|Ga0070664_100564742 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1053 | Open in IMG/M |
| 3300005564|Ga0070664_101321194 | Not Available | 681 | Open in IMG/M |
| 3300005586|Ga0066691_10671709 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300005712|Ga0070764_10500797 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 730 | Open in IMG/M |
| 3300005713|Ga0066905_100076496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2179 | Open in IMG/M |
| 3300005764|Ga0066903_102437184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1012 | Open in IMG/M |
| 3300005764|Ga0066903_103034920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 909 | Open in IMG/M |
| 3300005764|Ga0066903_105273667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300005764|Ga0066903_106957436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300005764|Ga0066903_107920781 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 545 | Open in IMG/M |
| 3300005764|Ga0066903_108542134 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005834|Ga0068851_11022880 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005840|Ga0068870_11354563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300005841|Ga0068863_102314848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300005842|Ga0068858_100524305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1146 | Open in IMG/M |
| 3300005921|Ga0070766_10358370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
| 3300005921|Ga0070766_10650386 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 711 | Open in IMG/M |
| 3300006102|Ga0075015_100751592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300006173|Ga0070716_101809906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300006358|Ga0068871_101063509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300006845|Ga0075421_101359681 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 783 | Open in IMG/M |
| 3300006845|Ga0075421_101741134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300006847|Ga0075431_101625930 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300006903|Ga0075426_11026022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300006904|Ga0075424_100363872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1541 | Open in IMG/M |
| 3300006954|Ga0079219_10976319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300007076|Ga0075435_101474256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300009090|Ga0099827_10271502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1430 | Open in IMG/M |
| 3300009094|Ga0111539_13459991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300009162|Ga0075423_12363034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300009174|Ga0105241_11652319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300009176|Ga0105242_10410560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1266 | Open in IMG/M |
| 3300009176|Ga0105242_12251074 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300009523|Ga0116221_1340070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300009839|Ga0116223_10648138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300010047|Ga0126382_10540613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
| 3300010048|Ga0126373_12338561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300010358|Ga0126370_11583550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300010362|Ga0126377_10019441 | All Organisms → cellular organisms → Bacteria | 5559 | Open in IMG/M |
| 3300010362|Ga0126377_12018928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300010362|Ga0126377_13318605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300010364|Ga0134066_10004714 | All Organisms → cellular organisms → Bacteria | 2478 | Open in IMG/M |
| 3300010366|Ga0126379_12370665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300010373|Ga0134128_10452941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1432 | Open in IMG/M |
| 3300010379|Ga0136449_100611624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1854 | Open in IMG/M |
| 3300010379|Ga0136449_103887929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300010379|Ga0136449_104335872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300010398|Ga0126383_12133367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300010403|Ga0134123_12029574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300010866|Ga0126344_1138765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1581 | Open in IMG/M |
| 3300010880|Ga0126350_10095881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300011119|Ga0105246_11953204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300011120|Ga0150983_12260884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300011120|Ga0150983_14314333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300011120|Ga0150983_14437177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300011120|Ga0150983_15140875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300011120|Ga0150983_15925271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300011269|Ga0137392_11043707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300011269|Ga0137392_11560986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300011421|Ga0137462_1121350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300012211|Ga0137377_10353044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1407 | Open in IMG/M |
| 3300012212|Ga0150985_121091190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 772 | Open in IMG/M |
| 3300012212|Ga0150985_121660970 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 1770 | Open in IMG/M |
| 3300012232|Ga0137435_1187715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300012469|Ga0150984_109545956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1563 | Open in IMG/M |
| 3300012487|Ga0157321_1003610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 930 | Open in IMG/M |
| 3300012906|Ga0157295_10192638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300012964|Ga0153916_12263375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300012984|Ga0164309_10508588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300013296|Ga0157374_10025131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5344 | Open in IMG/M |
| 3300013296|Ga0157374_12576112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300013306|Ga0163162_12783866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300013307|Ga0157372_10330663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1774 | Open in IMG/M |
| 3300013307|Ga0157372_10879224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1040 | Open in IMG/M |
| 3300013308|Ga0157375_12486633 | Not Available | 618 | Open in IMG/M |
| 3300014162|Ga0181538_10499373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300014201|Ga0181537_10506442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
| 3300014489|Ga0182018_10060037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2299 | Open in IMG/M |
| 3300014489|Ga0182018_10565050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300014495|Ga0182015_10934698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300014495|Ga0182015_10969698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300014838|Ga0182030_10294450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1796 | Open in IMG/M |
| 3300014969|Ga0157376_11377548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300015371|Ga0132258_10543154 | All Organisms → cellular organisms → Bacteria | 2912 | Open in IMG/M |
| 3300015372|Ga0132256_103683077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300015373|Ga0132257_102188870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 715 | Open in IMG/M |
| 3300015374|Ga0132255_101301552 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300015374|Ga0132255_102986074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300015374|Ga0132255_103411499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
| 3300015374|Ga0132255_103553396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300016357|Ga0182032_11600791 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300016371|Ga0182034_11915725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300016422|Ga0182039_12121854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300016445|Ga0182038_12044643 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300017943|Ga0187819_10763130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300017965|Ga0190266_10069936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1329 | Open in IMG/M |
| 3300017973|Ga0187780_10630006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300018476|Ga0190274_12717882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 592 | Open in IMG/M |
| 3300018476|Ga0190274_13752491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300019192|Ga0184603_129706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300020582|Ga0210395_10141966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1790 | Open in IMG/M |
| 3300021170|Ga0210400_11505972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300021171|Ga0210405_11364533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300021181|Ga0210388_10331840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1337 | Open in IMG/M |
| 3300021181|Ga0210388_10940263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300021181|Ga0210388_11121469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300021401|Ga0210393_10917554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300021404|Ga0210389_10061696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae | 2874 | Open in IMG/M |
| 3300021407|Ga0210383_11027324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300021475|Ga0210392_11432738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300021477|Ga0210398_10890349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300021559|Ga0210409_10021953 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6191 | Open in IMG/M |
| 3300021560|Ga0126371_12192907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300021861|Ga0213853_10343327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
| 3300021861|Ga0213853_11197657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1678 | Open in IMG/M |
| 3300022195|Ga0222625_1666693 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300022214|Ga0224505_10268172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300022528|Ga0242669_1038515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300022533|Ga0242662_10141318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300022533|Ga0242662_10295635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300022906|Ga0247766_1049302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
| 3300024552|Ga0256345_1064109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300025901|Ga0207688_10897784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300025903|Ga0207680_10087453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1973 | Open in IMG/M |
| 3300025920|Ga0207649_10597906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
| 3300025923|Ga0207681_11255082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300025927|Ga0207687_11270707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300025931|Ga0207644_10730837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
| 3300025935|Ga0207709_11596443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300025936|Ga0207670_11052245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300025937|Ga0207669_11298264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300025940|Ga0207691_11669972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300025941|Ga0207711_10871701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 837 | Open in IMG/M |
| 3300025944|Ga0207661_10402266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1242 | Open in IMG/M |
| 3300025945|Ga0207679_10684325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 930 | Open in IMG/M |
| 3300025960|Ga0207651_10022499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3855 | Open in IMG/M |
| 3300026089|Ga0207648_11493429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300026538|Ga0209056_10523277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300027812|Ga0209656_10036057 | All Organisms → cellular organisms → Bacteria | 2888 | Open in IMG/M |
| 3300027854|Ga0209517_10549011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300027867|Ga0209167_10000817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 20525 | Open in IMG/M |
| 3300027873|Ga0209814_10122569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1109 | Open in IMG/M |
| 3300027873|Ga0209814_10291458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300027874|Ga0209465_10106772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1375 | Open in IMG/M |
| 3300027874|Ga0209465_10390569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300029910|Ga0311369_11224911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300030000|Ga0311337_11468015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300031234|Ga0302325_10220651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3221 | Open in IMG/M |
| 3300031234|Ga0302325_12138973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300031538|Ga0310888_10038497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2167 | Open in IMG/M |
| 3300031668|Ga0318542_10204532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 996 | Open in IMG/M |
| 3300031681|Ga0318572_10809167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300031708|Ga0310686_101602779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1147 | Open in IMG/M |
| 3300031708|Ga0310686_108090908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300031858|Ga0310892_10888290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300031890|Ga0306925_10588749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1176 | Open in IMG/M |
| 3300031890|Ga0306925_11299929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300031896|Ga0318551_10673715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300031902|Ga0302322_100977864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1018 | Open in IMG/M |
| 3300031912|Ga0306921_10656062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1209 | Open in IMG/M |
| 3300031942|Ga0310916_10777979 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300031946|Ga0310910_10005658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7486 | Open in IMG/M |
| 3300031946|Ga0310910_11122489 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300031954|Ga0306926_12544852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300032001|Ga0306922_12307732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300032075|Ga0310890_11482551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300032261|Ga0306920_103199932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300032261|Ga0306920_104355948 | All Organisms → cellular organisms → Eukaryota | 508 | Open in IMG/M |
| 3300032421|Ga0310812_10381179 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300032829|Ga0335070_11869675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300033289|Ga0310914_11335058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300034820|Ga0373959_0217121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.34% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.64% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.64% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.09% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.09% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.09% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.58% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.06% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.06% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 2.06% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.06% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.55% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.55% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.55% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.03% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.03% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.03% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.03% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.03% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.03% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.03% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.03% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.03% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.03% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.03% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.52% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.52% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.52% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.52% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.52% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 0.52% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.52% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.52% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.52% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.52% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.52% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.52% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.52% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.52% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.52% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001372 | YB-Back-sed | Environmental | Open in IMG/M |
| 3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011421 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2 | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Host-Associated | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022906 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L223-509R-6 | Environmental | Open in IMG/M |
| 3300024552 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| YBBDRAFT_11948243 | 3300001372 | Marine Estuarine | VKVKFIPAQNGSPLGFLKTVTYPDGHVIVVSAGGPND* |
| C687J26631_101561971 | 3300002124 | Soil | GPNALHTGDNIKVKFIPAKDGGPVGFLQTVTMPDGRVIQISGGGPNE* |
| Ga0062593_1000376553 | 3300004114 | Soil | GENALHAGDMISVKFIPARNGSPLGFLKSVTMPDGRVIQISAGNAND* |
| Ga0066395_102498501 | 3300004633 | Tropical Forest Soil | GDKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNPND* |
| Ga0062591_1016540141 | 3300004643 | Soil | TGPNALHAGDMISVKFIPARSGAPLGFLKSVTMPDGRVVQISAGNAND* |
| Ga0058863_106941781 | 3300004799 | Host-Associated | KTGPNALHAGDNITVKFIPARNGSPLGFLKTVTLPDGRVIQISAGNAND* |
| Ga0058862_128700061 | 3300004803 | Host-Associated | GDNIKVKFLPAKDGSPLGFLKTVIMPDGRVIQISAGNPND* |
| Ga0062594_1016922482 | 3300005093 | Soil | DKIKVKFLPARNGSPLGFLKSVTLPDGRVIQISAGNPND* |
| Ga0068993_103991262 | 3300005183 | Natural And Restored Wetlands | DEISVKYIPARNGSPLGFLKSVTMPDGRVVQISAGNAND* |
| Ga0070690_1010944621 | 3300005330 | Switchgrass Rhizosphere | VGPTGQNALHQGDMVKVKYIPARNGSPLGFLKSVTYPDGRVVNISAGNPND* |
| Ga0070690_1013477592 | 3300005330 | Switchgrass Rhizosphere | NALHPGDKITVKILGARDGSPLGFLKTVTYPDGHVVQISAGNAND* |
| Ga0066388_1001539643 | 3300005332 | Tropical Forest Soil | TGDNITVKFLPARNGSPLGFLKTVIMPDGRVIQISAGNPND* |
| Ga0066388_1061409331 | 3300005332 | Tropical Forest Soil | NALHTGDKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNVND* |
| Ga0070666_107395182 | 3300005335 | Switchgrass Rhizosphere | GDEISVKFIPARNGSPLGFLKSVTMPDGRVIQISAGNAND* |
| Ga0066689_102931631 | 3300005447 | Soil | ALHAGDNISVKFLPARNGSPLGFLKTVIMPDGRVIQISAGNPND* |
| Ga0070678_1018970361 | 3300005456 | Miscanthus Rhizosphere | NALHAGDMISVKFIPARSGAPLGFLKSVTMPDGRVVQISAGNAND* |
| Ga0068867_1016881772 | 3300005459 | Miscanthus Rhizosphere | GQNALHQGDKITVKFIPARNGSPLGFLTSVKMPDGRVLNISSGNPND* |
| Ga0070735_101751253 | 3300005534 | Surface Soil | QGDKISVKFLPAKDGSPLGFLKTVIMPDGRVIQISAGNPND* |
| Ga0066697_104711292 | 3300005540 | Soil | KITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNPND* |
| Ga0070733_100018082 | 3300005541 | Surface Soil | MRSIPGGGIKTKFLPARDGSPPGFLKTVIMPDGRVIQISAGNPND* |
| Ga0070733_109820612 | 3300005541 | Surface Soil | DAIKVKFLPARDGSPLGFLKVVTMPDGRLIQIAAPNATE* |
| Ga0070665_1015144772 | 3300005548 | Switchgrass Rhizosphere | KTGPNAMKVGDTLVVKFIPARNGSPLGFLKSVTLPDGRVIQISAGNPND* |
| Ga0070664_1005647422 | 3300005564 | Corn Rhizosphere | NALHAGDEISVKFIPARNGSPLGFLKSVTMPDGRVVMISAGNAND* |
| Ga0070664_1013211942 | 3300005564 | Corn Rhizosphere | PNAMKVGDTLVVKFIPARNGSPLGFLKSVTLPDGRVIQISAGNPND* |
| Ga0066691_106717092 | 3300005586 | Soil | HTGDNIKVKFLPAKNGSPLGFLKSVTMPDGREIQISAVNPTD* |
| Ga0070764_105007971 | 3300005712 | Soil | RGIGKTGANALHAGDSIKVMFLPAKDGSPLGFLKTVTMPDGHVIQIAAPNATE* |
| Ga0066905_1000764962 | 3300005713 | Tropical Forest Soil | TVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNPND* |
| Ga0066903_1024371842 | 3300005764 | Tropical Forest Soil | PNALHAGDKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNPND* |
| Ga0066903_1030349202 | 3300005764 | Tropical Forest Soil | DKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNPND* |
| Ga0066903_1052736671 | 3300005764 | Tropical Forest Soil | PNALHAGDKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGDPND* |
| Ga0066903_1069574361 | 3300005764 | Tropical Forest Soil | ITVKFLPAKDGSPLGFLKTVTMPDGRVIQISAGNPND* |
| Ga0066903_1079207812 | 3300005764 | Tropical Forest Soil | PNALHQGDKITVKFLPAKDGSPLGFLKTVIMPDGRVIQISAGNPND* |
| Ga0066903_1085421341 | 3300005764 | Tropical Forest Soil | ALHQGDQVKVKYIPARNGSPLGFLKSVTYPDGRVVNISTGNPND* |
| Ga0068851_110228802 | 3300005834 | Corn Rhizosphere | PNALHTGDNITVKFLPAIDGSPLGFLKTVVMPDGRVIQIFAGNPND* |
| Ga0068870_113545632 | 3300005840 | Miscanthus Rhizosphere | DTIKATFIPARNGSPLGFLKSVTLTDGKVITISAGNPND* |
| Ga0068863_1023148482 | 3300005841 | Switchgrass Rhizosphere | HAGDMISVKFIPARNGSPLGFLKSVTMPDGRVVQISAGNAND* |
| Ga0068858_1005243051 | 3300005842 | Switchgrass Rhizosphere | ENALHAGDKISVKFIPARSGAPLGFLKSVTMPDGRVVQISAGNAND* |
| Ga0070766_103583701 | 3300005921 | Soil | VMFLPAKDGSPLGFLKTVTMPDGRVIEIAAPNATE* |
| Ga0070766_106503862 | 3300005921 | Soil | DHVKVMFLPAKDGSPLGFLKTVTMPDGHLIQIAAPNATE* |
| Ga0075015_1007515922 | 3300006102 | Watersheds | ISVKFLPAKDGSPLGFLKTVTMPDGRVIQISAGNPND* |
| Ga0070716_1018099061 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | KMKFLPARVGRPLGFLKTVIMPDGRVIRISAGNPSD* |
| Ga0068871_1010635091 | 3300006358 | Miscanthus Rhizosphere | AIKAKFIPAKDGSPLGFLKSVTYPDGHTVQISAGNPND* |
| Ga0075421_1013596812 | 3300006845 | Populus Rhizosphere | DKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAANPND* |
| Ga0075421_1017411342 | 3300006845 | Populus Rhizosphere | KFLPAKDGSPLGFLKTVVMPDGRVIQISAGNVND* |
| Ga0075431_1016259302 | 3300006847 | Populus Rhizosphere | GDKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAANPND* |
| Ga0075426_110260222 | 3300006903 | Populus Rhizosphere | NALHTGDNITVKFLPARNGSPLGFLKTVVMPDGRVIQISAGNPND* |
| Ga0075424_1003638722 | 3300006904 | Populus Rhizosphere | KITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNAND* |
| Ga0079219_109763192 | 3300006954 | Agricultural Soil | PITVKFIPAKDGSPLGFLKSVTYGDGHVIVVSGGNPND* |
| Ga0075435_1014742562 | 3300007076 | Populus Rhizosphere | KITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAANPND* |
| Ga0099827_102715022 | 3300009090 | Vadose Zone Soil | LREPPARDGSPLGFLKTVIMPDGRVIQISAGNPND* |
| Ga0111539_134599912 | 3300009094 | Populus Rhizosphere | LHAGDMISVKFIPARNGSPLGFLKSVTMPDGRVVQILAGNAND* |
| Ga0075423_123630341 | 3300009162 | Populus Rhizosphere | TGDMITVKFLPAKNGSPLGFLKTVIMPDGRVIQISAGNANC* |
| Ga0105241_116523191 | 3300009174 | Corn Rhizosphere | HAGDMISVKFIPARNGSPLGFLKSVTMPDGRVIQISAGNAND* |
| Ga0105242_104105602 | 3300009176 | Miscanthus Rhizosphere | HTGDAIKARFIPAKDGSPLGFLKSVTYPDGHVVQISAGNPND* |
| Ga0105242_122510741 | 3300009176 | Miscanthus Rhizosphere | ITVKFLPAKNGSPLCFLKTVVMPDGRVIQVSAGNPND* |
| Ga0116221_13400702 | 3300009523 | Peatlands Soil | AQRGVGRTGENALHNGDNIKIKFRPAKDGSPLGFLETVTMPDGRVINIAAPNATE* |
| Ga0116223_106481382 | 3300009839 | Peatlands Soil | KIRFRPAKDGSPLGFLLLVTMPDGHVIQVAAPNATE* |
| Ga0126382_105406133 | 3300010047 | Tropical Forest Soil | TGPNALHTGDKITVKFLPARDGSPLGFLKTVIMPDGRVIQISAGNANC* |
| Ga0126373_123385611 | 3300010048 | Tropical Forest Soil | KFLPAKDGSPRGFLKTVIMPDGRTIQISAGNPND* |
| Ga0126370_115835501 | 3300010358 | Tropical Forest Soil | TGPNALHTGDKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNPND* |
| Ga0126377_100194411 | 3300010362 | Tropical Forest Soil | TVKFLPARNGSPLGFLKTVIMPDGRVIQISAGNPND* |
| Ga0126377_120189282 | 3300010362 | Tropical Forest Soil | ALHTGDNITVKFLPARNGSPLGFLKTVIMPDGRVIQISAGNPND* |
| Ga0126377_133186052 | 3300010362 | Tropical Forest Soil | ALHAGDEISVKFIPARNGSPLGLLKAVTMPDGREVAISAGNAND* |
| Ga0134066_100047144 | 3300010364 | Grasslands Soil | ISVKFIPARNGSPLGFLKSVTMPDGRVVMISAGNAND* |
| Ga0126379_123706651 | 3300010366 | Tropical Forest Soil | KITVKFLPAKDGSPLGFLKTVIMPDGRVIQISAGNPND* |
| Ga0134128_104529411 | 3300010373 | Terrestrial Soil | RSGPNALHPGDKITVKFLGARDGSPFGFLKTVTMPDGRVIQISAGSAND* |
| Ga0136449_1006116242 | 3300010379 | Peatlands Soil | GRTGENALHNGDAIKIRFRPAKDGSPLGFLLLVTMPDGHVIQVAAPNATE* |
| Ga0136449_1038879292 | 3300010379 | Peatlands Soil | GENALHNGDNIKIKFRPAKDGSPLGFLETVTMPDGRVISIAAPNATE* |
| Ga0136449_1043358722 | 3300010379 | Peatlands Soil | IKIKFRPAKDGSPLGFLETVTMPDGRVISIAAPNATE* |
| Ga0126383_121333671 | 3300010398 | Tropical Forest Soil | ITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNPND* |
| Ga0134123_120295741 | 3300010403 | Terrestrial Soil | LHAGDNIKVKFIPAINGSPLGFLKSVTMPDGRVINISAGNPND* |
| Ga0126344_11387652 | 3300010866 | Boreal Forest Soil | ALHAGDNIKVMLLPAQDGSPLGFHKTVTMPDGHVIKIAAPNATE* |
| Ga0126350_100958811 | 3300010880 | Boreal Forest Soil | DQITVRYIPANNGSPLGFLKSVVMPDGREVKISAGNPTD* |
| Ga0105246_119532042 | 3300011119 | Miscanthus Rhizosphere | AGDKISVKFIPARSGAPLGFLKSVTMPDGRVVQISAGNAND* |
| Ga0150983_122608841 | 3300011120 | Forest Soil | KFRPAKDGSPLGFLETVTMPDGRVISIAAPNATE* |
| Ga0150983_143143331 | 3300011120 | Forest Soil | ALHTGDNISVKFLPAKDGSPLGFLKTVTYPDGHVIQISAGNPND* |
| Ga0150983_144371771 | 3300011120 | Forest Soil | IKVKFLPAKDGSPLGFLKTVIMPDGRVIQISAGNAND* |
| Ga0150983_151408751 | 3300011120 | Forest Soil | TGPNALHLGDNIKVKFIPAGNGSPLGFLKTVTMPDGRMISISAGNPND* |
| Ga0150983_159252712 | 3300011120 | Forest Soil | HAGDNIKVMFLPAKDGSPLGFLKTVTMPDGRLIQIAAPNATE* |
| Ga0137392_110437071 | 3300011269 | Vadose Zone Soil | GDKVTVKFLGARDGSPLGFLKTVVLPDGRVIQISGGNPTD* |
| Ga0137392_115609861 | 3300011269 | Vadose Zone Soil | NITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNPND* |
| Ga0137462_11213502 | 3300011421 | Soil | TGPNALHAGDMIKVTFIPARSGAPLGFLKSVTMPDGRVVQISAGNAND* |
| Ga0137377_103530441 | 3300012211 | Vadose Zone Soil | KFIPARNGSPLGFLKSVTMPDGRVIQISAGNPND* |
| Ga0150985_1210911901 | 3300012212 | Avena Fatua Rhizosphere | LHAGDNISVKFIPAKNGSPLGFLKSVTLPDGRVITISAGQAND* |
| Ga0150985_1216609703 | 3300012212 | Avena Fatua Rhizosphere | GDNISVKFVPAKNGSPLGFLKSVTFPDGHVVQISAGNAND* |
| Ga0137435_11877151 | 3300012232 | Soil | LHTGDQIKVKFLPARDGSPLGFLKTVTMPDGRVITISGGNATD* |
| Ga0150984_1095459563 | 3300012469 | Avena Fatua Rhizosphere | GKTGANALHTGDKITVKFLPAKDGSPLGFLKTVIMPDGRAIQISAGNPND* |
| Ga0157321_10036101 | 3300012487 | Arabidopsis Rhizosphere | TGENALHAGDEISVKFIPARNGSPLGFLKSVTMPDGRVIQISAGNAND* |
| Ga0157295_101926381 | 3300012906 | Soil | EISVKFIPARNGSPLGFLKSVTMPDGRVVMISAGNAND* |
| Ga0153916_122633751 | 3300012964 | Freshwater Wetlands | DMISVKFIPARNGSPLGFLKSVTMPDGRVVQISAGNAND* |
| Ga0164309_105085881 | 3300012984 | Soil | LVSVKFIPAKNGSPLGFLKSVTFPDGHVVQISAGNAND* |
| Ga0157374_100251314 | 3300013296 | Miscanthus Rhizosphere | KILGARDGSPLGFLKTVTYPDGHVVQISAGNAND* |
| Ga0157374_125761121 | 3300013296 | Miscanthus Rhizosphere | VKFIPAKNGAPLGFLKSVTFPDGHVVQISAGNAND* |
| Ga0163162_127838661 | 3300013306 | Switchgrass Rhizosphere | GPNALKTGDAIKAKFIPAKDGSPLGFLKSVTYPDGHVVQISAGNPND* |
| Ga0157372_103306632 | 3300013307 | Corn Rhizosphere | PGDKITVKILGARDGSPLGFLKTVTYPDGHVVQISAGNAND* |
| Ga0157372_108792242 | 3300013307 | Corn Rhizosphere | ALHPGDKITVKILGAMDGSPLGFLKTVTYPDGHVVQISAGNAND* |
| Ga0157375_124866331 | 3300013308 | Miscanthus Rhizosphere | TLVVKFIPARNGSPLGFLKSVTLPDGRVIQISAGNPND* |
| Ga0181538_104993732 | 3300014162 | Bog | GIGRTGENALHNGDPIKIRFRPAKDGSPLGFLLLVTMPDGHVIQIAAPNATE* |
| Ga0181537_105064422 | 3300014201 | Bog | KFLPAKDGSPLGFLKTVTYPDGHVIQISAGNAND* |
| Ga0182018_100600371 | 3300014489 | Palsa | PGDNIKVMFLPAKDGSPLGFLKTVTMPDGRLVQIAAPNATE* |
| Ga0182018_105650501 | 3300014489 | Palsa | TGENALHNGDAIKIRFRPAKDGSPLGFLLLVTMPDGHVIQVAAPNATE* |
| Ga0182015_109346982 | 3300014495 | Palsa | KTGPNALHAGDAVKVMFLPAKDGSPLGFLKTVTMPDGRVIQIAAPNATE* |
| Ga0182015_109696982 | 3300014495 | Palsa | VKFLPAKDGSPLGFLKTVTMPDGRVIQISAGNAND* |
| Ga0182030_102944502 | 3300014838 | Bog | KFRPAKDGSPLGFLEIVTMPDGRQVMVAAPNATE* |
| Ga0157376_113775481 | 3300014969 | Miscanthus Rhizosphere | GPNALHTGDAIKARFIPAKDGSPLGFLKSVTYPDGHVVQISAGNPND* |
| Ga0132258_105431541 | 3300015371 | Arabidopsis Rhizosphere | ISVKFIPARNGSPLGFLKSVTMPDGRLIQISAGNAND* |
| Ga0132256_1036830772 | 3300015372 | Arabidopsis Rhizosphere | HTGDKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNPND* |
| Ga0132257_1021888702 | 3300015373 | Arabidopsis Rhizosphere | VSVKFIPAKNGAPLGFLKSVTYPDGHVVQISAGNAND* |
| Ga0132255_1013015521 | 3300015374 | Arabidopsis Rhizosphere | KTGPNALHTGDNIKVKFLPAKDGSPLGFLKTVTMPDGRVISISAGNAND* |
| Ga0132255_1029860741 | 3300015374 | Arabidopsis Rhizosphere | NALHSGDKITVKFLPARNGSPLGFLKTVVMPDGRVIQVSMGNPND* |
| Ga0132255_1034114992 | 3300015374 | Arabidopsis Rhizosphere | NALHTGDKITVKFLPARNGSPLGFLKTVVMPDGRVIQISAGNPND* |
| Ga0132255_1035533961 | 3300015374 | Arabidopsis Rhizosphere | ALHAGDKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNAND* |
| Ga0182032_116007911 | 3300016357 | Soil | DNIKVKFIPAKDGSPLGFLKTVIMPDGRVIQISAGNPND |
| Ga0182034_119157251 | 3300016371 | Soil | TGDKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNPND |
| Ga0182039_121218541 | 3300016422 | Soil | TVKFLPARDGSPLGFLKTVIMPDGRVIQISAGNPND |
| Ga0182038_120446431 | 3300016445 | Soil | HQGDKITVKFLPAKDGSPLGFLKTVIMPDGRVIQISAGNPND |
| Ga0187819_107631301 | 3300017943 | Freshwater Sediment | HAGDTIKVMFLPAKDGSPLGFLKTVTMPDGHVIQIAAPNATE |
| Ga0190266_100699361 | 3300017965 | Soil | NALHAGDMIKVSFIPARSGAPLGFLKSVTMPDGRVVQISAGNAND |
| Ga0187780_106300061 | 3300017973 | Tropical Peatland | HQGDEVKVKFLPARDGSPLGFLRTVIMPDGRVIQIAAGTPNE |
| Ga0190274_127178822 | 3300018476 | Soil | SVKFIPARNGSPLGFLKSVTMPDGRVIQISAGNAND |
| Ga0190274_137524911 | 3300018476 | Soil | TGPNAIRTGDSIKIKFLPAKNGSPLGFLQSVTMPDGRVIQISGGGANE |
| Ga0184603_1297061 | 3300019192 | Soil | NALHNGDAIKIRFRPAKDGSPLGFLLLVTMPDGHVIQVAAPNATE |
| Ga0210395_101419662 | 3300020582 | Soil | KVMFLPARDGSPLGFLKTVTMPDGHVIQIAAPNATE |
| Ga0210400_115059722 | 3300021170 | Soil | NALHTGDNITVKFLPAKDGSPLGFLKTVIMPDGRVIQISAGNAND |
| Ga0210405_113645332 | 3300021171 | Soil | ITVKFLPAKDGSPLGFLKSVTMPDGRVIQISAGNPND |
| Ga0210388_103318402 | 3300021181 | Soil | LHAGDSIKVMFLPAKDGSPLGFLKTVTMPDGHVIEIAAPNATE |
| Ga0210388_109402631 | 3300021181 | Soil | DNALHNGDAIKIRFRPAKDGSPLGFLLLVTMPDGHVIQVAAPNATE |
| Ga0210388_111214692 | 3300021181 | Soil | KVMFLPAKDGSPLGFLKTVTMPDGRVIQIAAPNATE |
| Ga0210393_109175541 | 3300021401 | Soil | TGENALHNGDAIKIRFRPAKDGSPLGFLLLVTMPDGHVIQVAAPNATE |
| Ga0210389_100616963 | 3300021404 | Soil | TGPNALHTGDNITVKFLPAKDGSPLGFLKTVIMPDGRVIQISAGNAND |
| Ga0210383_110273241 | 3300021407 | Soil | DNIKVKFLPAKDGSPLGFLKTVIMPDGRVIQISAGNPND |
| Ga0210392_114327382 | 3300021475 | Soil | LHTRDEIKVKFLPARDGIPLGFLKTVIIPDRRVIQISAGNPNGNPND |
| Ga0210398_108903492 | 3300021477 | Soil | KTGPNALHAGDNIKVMFLPAKDGSPLGFLKTVTMPDGRVIQIAAPNATE |
| Ga0210409_100219533 | 3300021559 | Soil | VKFLPARDGSPLGFLNTVIMPDGRVIQISAGNPND |
| Ga0126371_121929071 | 3300021560 | Tropical Forest Soil | NALHQGDKITVKFLPAKDGSPLGFLKTVIMPDGRTIQISAGNPND |
| Ga0213853_103433271 | 3300021861 | Watersheds | SISVKFLPAKDGSPLGFLKTVTMPDGRVIQISAGNPND |
| Ga0213853_111976571 | 3300021861 | Watersheds | HNGDSIKVKFRPAKDGSPLGFLQTVTMPDGRVIQIAAPNATE |
| Ga0222625_16666931 | 3300022195 | Groundwater Sediment | NIKVKFLPAKNGSPLGFLKSVTMPDGRVIVVSAGNAND |
| Ga0224505_102681721 | 3300022214 | Sediment | NAIHPGDKIKFKFLPAKDGSPLGFLQTVTMPDGRVIQISGGGPNE |
| Ga0242669_10385151 | 3300022528 | Soil | GKTGPNALRTGDEIKVKFLRAREGSPLGFLKNVIMSDGRVIRISAGNPND |
| Ga0242662_101413182 | 3300022533 | Soil | ALHSGDKITVKFFPAKDGSPLGALRTVIMPDGRVIQISSGSPND |
| Ga0242662_102956351 | 3300022533 | Soil | KVMFLPAKDGSPLGFLKTVTMPDGHVIQIAAPNATE |
| Ga0247766_10493022 | 3300022906 | Plant Litter | GIGRTGENALHAGDMISVKFIPARNGSPLGFLKSVTMPDGRVIQISAGNAND |
| Ga0256345_10641091 | 3300024552 | Freshwater | VKFLPAKDGSPLGFLKTVTYPDGHVIQISAGNAND |
| Ga0207688_108977842 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | ALHAGDMITVKFIPARNGSPLGFLKSVTMPDGRVVQISAGNAND |
| Ga0207680_100874532 | 3300025903 | Switchgrass Rhizosphere | GENALHAGDEISVKFIPARNGSPLGFLKSVTMPDGRVIQISAGNAND |
| Ga0207649_105979062 | 3300025920 | Corn Rhizosphere | VKFIPARNGSPLGFLKSVTMPDGRVVQISAGNAND |
| Ga0207681_112550821 | 3300025923 | Switchgrass Rhizosphere | GDKIKVKFLPAKNGSPLGFLKTVVMPDGREIQISAGNPND |
| Ga0207687_112707072 | 3300025927 | Miscanthus Rhizosphere | ARFIPAKDGSPLGFLKSVTYPDGHVVQISAGNPND |
| Ga0207644_107308372 | 3300025931 | Switchgrass Rhizosphere | HAGDKISVKFIPARSGAPLGFLKSVTMPDGRVVQISAGNAND |
| Ga0207709_115964432 | 3300025935 | Miscanthus Rhizosphere | GPNALHTGDAIKARFIPAKDGSPLGFLKSVTYPDGHVVQISAGNPND |
| Ga0207670_110522452 | 3300025936 | Switchgrass Rhizosphere | AMKVGDTLVVKFIPARNGSPLGFLKSVTLPDGRVIQISAGNPND |
| Ga0207669_112982641 | 3300025937 | Miscanthus Rhizosphere | KTGPNALHPGDKITVKILGARDGSPLGFLKTVTYPDGHVVQISAGNAND |
| Ga0207691_116699722 | 3300025940 | Miscanthus Rhizosphere | ALHAGDEISVKYIPARNGSPLGFLKSVTMPDGRVVVISAGNAND |
| Ga0207711_108717011 | 3300025941 | Switchgrass Rhizosphere | ALHPGDKITVKILGARDGSPLGFLKTVTYPDGHVVQISAGNAND |
| Ga0207661_104022662 | 3300025944 | Corn Rhizosphere | ITVKILGARDGSPLGFLKTVTYPDGHVVQISAGNAND |
| Ga0207679_106843251 | 3300025945 | Corn Rhizosphere | GPNALHAGDEISVKFIPARNGSPLGFLKSVTMPDGRVVMISAGNAND |
| Ga0207651_100224995 | 3300025960 | Switchgrass Rhizosphere | RGIGRTGENALHAGDKISVKFIPARSGAPLGFLKSVTMPDGRVVQISAGNAND |
| Ga0207648_114934291 | 3300026089 | Miscanthus Rhizosphere | RLAQRGIGPTGQNALHQGDKITVKFIPARNGSPLGFLTSVKMPDGRVLNISSGNPND |
| Ga0209056_105232771 | 3300026538 | Soil | PNALHTGDKITVKFFPARDGSPLGALKTVVMPDGRVIQISSGNVND |
| Ga0209656_100360574 | 3300027812 | Bog Forest Soil | ALHTGDEIKVKFLPAKDGSPLGFLKTVIMPDGRVIQTSAGRPND |
| Ga0209517_105490111 | 3300027854 | Peatlands Soil | HNGDAIKIRFRPAKDGSPLGFLLLVTMPDGHVIQVAAPNATE |
| Ga0209167_1000081719 | 3300027867 | Surface Soil | MRSIPGGGIKTKFLPARDGSPPGFLKTVIMPDGRVIQISAGNPND |
| Ga0209814_101225691 | 3300027873 | Populus Rhizosphere | GDKITVKFLPARDGSPLGFLKTVVMPDGRVIQISAGNPND |
| Ga0209814_102914582 | 3300027873 | Populus Rhizosphere | GDKITVKFLPAKNGSPLGFLKTVVMPDGRVIQISAGNPND |
| Ga0209465_101067722 | 3300027874 | Tropical Forest Soil | ITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGDPND |
| Ga0209465_103905691 | 3300027874 | Tropical Forest Soil | ITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNPND |
| Ga0311369_112249111 | 3300029910 | Palsa | ALHAGDSIKVMFLPAKDGSPLGFLKTVTMPDGHVIEIAAPNATE |
| Ga0311337_114680152 | 3300030000 | Fen | GKIGPNALHTGDNIKVKFLPAKDNSPLGFLKSVTYPDGHVIQISAGVGNE |
| Ga0302325_102206511 | 3300031234 | Palsa | GDAIKIRFRPAKDGSPLGFLLLVTMPDGHVITVAAPNATE |
| Ga0302325_121389731 | 3300031234 | Palsa | HAGDAIKVMFLPAKDGSPLGFLKTVTMPDGHVIQIAAPNATE |
| Ga0310888_100384971 | 3300031538 | Soil | GDEISVKFIPARNGSPLGFLKSVTMPDGRVIQISAGNAND |
| Ga0318542_102045322 | 3300031668 | Soil | LHAGDKISVKLLPARDGSPLGFLKTVTMPDGRVIQISAGNPND |
| Ga0318572_108091672 | 3300031681 | Soil | DKISVKLLPARDGSPLGFLKTVTMPDGRVIQISAGNPND |
| Ga0310686_1016027791 | 3300031708 | Soil | IKVMFLPAKDGSPLGFLKTVTMPDGRVIQIAAPNATE |
| Ga0310686_1080909082 | 3300031708 | Soil | LKLLPARDGSPLGFFKTVIMPDGRVVRISAGNPND |
| Ga0310892_108882902 | 3300031858 | Soil | NALHAGDMIKVLFIPARSGAPLGFLKSVTMPDGRVVQISAGNAND |
| Ga0306925_105887492 | 3300031890 | Soil | LHVGDNIKVKFIPAKDGSPLGFLKTVIMPDGRTIQISAGNPND |
| Ga0306925_112999291 | 3300031890 | Soil | RAGDNITVKFLPARDGSPLGFLKTVIMPDGRVIQISADNPND |
| Ga0318551_106737152 | 3300031896 | Soil | GPNALHAGDKISVKLLPARDGSPLGFLKTVTMPDGRVIQISAGNPND |
| Ga0302322_1009778641 | 3300031902 | Fen | IGPNALHTGDNIKVKFLPAKDNSPLGFLKSVTYPDGHVIQISAGIGNE |
| Ga0306921_106560621 | 3300031912 | Soil | MLRAGDNITVKFLPARDGSPLGFLKTVIMPDGRVIQISADNPND |
| Ga0310916_107779791 | 3300031942 | Soil | LHAGDNIKVKFLPARNGSPLGFLKTVIMPDGRVIQISAGNPND |
| Ga0310910_1000565811 | 3300031946 | Soil | SVKLLPARDGSPLGFLKTVTMPDGRVIQISAGNPND |
| Ga0310910_111224892 | 3300031946 | Soil | LHVGDNIKVKFIPAKDGSPLGFLKTVIMPDGRVIQISAGNPND |
| Ga0306926_125448522 | 3300031954 | Soil | VKFLPARDTSPLGFLKTVIMPDGRVVQISAGNPND |
| Ga0306922_123077322 | 3300032001 | Soil | GPNALHVGDNITVKFLPAKDGSPLGFLKTVIMPDGRVIQISAGNPND |
| Ga0310890_114825511 | 3300032075 | Soil | MIKVQFIPARSGAPLGFLKSVTMPDGRVVQISAGNAND |
| Ga0306920_1031999321 | 3300032261 | Soil | GDDITVKFLPARNGSPLGFLKTVIMPDGRVIQISAGNPND |
| Ga0306920_1043559481 | 3300032261 | Soil | VTVKYAPARDGSPLGFLKSITTPDGKVINISAGAASD |
| Ga0310812_103811791 | 3300032421 | Soil | GPNALHTGDKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNPND |
| Ga0335070_118696752 | 3300032829 | Soil | KITVKFLPAKDGSPLGFLKTVIMPDGRVIQISAGNPND |
| Ga0310914_113350582 | 3300033289 | Soil | DNITVKFLPARDESPLGFLKTVIMPDGRVIEISADNPND |
| Ga0373959_0217121_394_510 | 3300034820 | Rhizosphere Soil | KITVKFLPARDGSPLGFLKTVVMPDGRVIQISAGNAND |
| ⦗Top⦘ |