| Basic Information | |
|---|---|
| Family ID | F027586 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 194 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MDPTTVMAVICSVVVFAGWLVLPHSPTTVKPVVVSEEREPVRVSA |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 194 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 91.75 % |
| % of genes near scaffold ends (potentially truncated) | 16.49 % |
| % of genes from short scaffolds (< 2000 bps) | 71.65 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.392 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (28.351 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.392 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (70.619 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.03% β-sheet: 0.00% Coil/Unstructured: 73.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 194 Family Scaffolds |
|---|---|---|
| PF00909 | Ammonium_transp | 56.70 |
| PF04023 | FeoA | 27.32 |
| PF01979 | Amidohydro_1 | 3.61 |
| PF02535 | Zip | 3.09 |
| PF00753 | Lactamase_B | 1.55 |
| PF08818 | DUF1801 | 1.03 |
| PF04879 | Molybdop_Fe4S4 | 1.03 |
| PF04024 | PspC | 0.52 |
| PF07394 | DUF1501 | 0.52 |
| PF08494 | DEAD_assoc | 0.52 |
| PF13714 | PEP_mutase | 0.52 |
| PF04545 | Sigma70_r4 | 0.52 |
| PF01568 | Molydop_binding | 0.52 |
| PF01784 | NIF3 | 0.52 |
| PF06071 | YchF-GTPase_C | 0.52 |
| PF07883 | Cupin_2 | 0.52 |
| PF03916 | NrfD | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 194 Family Scaffolds |
|---|---|---|---|
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 56.70 |
| COG1918 | Fe2+ transport protein FeoA | Inorganic ion transport and metabolism [P] | 27.32 |
| COG0428 | Zinc transporter ZupT | Inorganic ion transport and metabolism [P] | 3.09 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 1.03 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 1.03 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 1.03 |
| COG0012 | Ribosome-binding ATPase YchF, GTP1/OBG family | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG0327 | Putative GTP cyclohydrolase 1 type 2, NIF3 family | Coenzyme transport and metabolism [H] | 0.52 |
| COG1201 | Lhr-like helicase | Replication, recombination and repair [L] | 0.52 |
| COG3323 | PII-like insert in the uncharacterized protein YqfO, YbgI/NIF3 family | Function unknown [S] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.91 % |
| Unclassified | root | N/A | 3.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000880|AL20A1W_1209047 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300001089|JGI12683J13190_1003980 | Not Available | 1835 | Open in IMG/M |
| 3300001089|JGI12683J13190_1023071 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300001145|JGI12682J13319_1003412 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
| 3300001154|JGI12636J13339_1050050 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300001160|JGI12654J13325_1013606 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300001536|A1565W1_11537690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 518 | Open in IMG/M |
| 3300001545|JGI12630J15595_10000877 | All Organisms → cellular organisms → Bacteria | 6249 | Open in IMG/M |
| 3300001545|JGI12630J15595_10003382 | All Organisms → cellular organisms → Bacteria | 3466 | Open in IMG/M |
| 3300001593|JGI12635J15846_10058936 | All Organisms → cellular organisms → Bacteria | 2888 | Open in IMG/M |
| 3300001661|JGI12053J15887_10030721 | All Organisms → cellular organisms → Bacteria | 3018 | Open in IMG/M |
| 3300001661|JGI12053J15887_10048846 | All Organisms → cellular organisms → Bacteria | 2368 | Open in IMG/M |
| 3300001661|JGI12053J15887_10305887 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100037347 | All Organisms → cellular organisms → Bacteria | 4350 | Open in IMG/M |
| 3300002557|JGI25381J37097_1005725 | All Organisms → cellular organisms → Bacteria | 2179 | Open in IMG/M |
| 3300002558|JGI25385J37094_10060881 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300002560|JGI25383J37093_10061087 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300002853|draft_1002902 | All Organisms → cellular organisms → Bacteria | 1738 | Open in IMG/M |
| 3300002908|JGI25382J43887_10189604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1000 | Open in IMG/M |
| 3300002909|JGI25388J43891_1039562 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300002911|JGI25390J43892_10105841 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300002912|JGI25386J43895_10200325 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300002915|JGI25387J43893_1067301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 529 | Open in IMG/M |
| 3300002917|JGI25616J43925_10278551 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300005166|Ga0066674_10103131 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300005167|Ga0066672_10063457 | All Organisms → cellular organisms → Bacteria | 2161 | Open in IMG/M |
| 3300005167|Ga0066672_10155906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1434 | Open in IMG/M |
| 3300005167|Ga0066672_10257295 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300005167|Ga0066672_10299825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1044 | Open in IMG/M |
| 3300005171|Ga0066677_10109359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1473 | Open in IMG/M |
| 3300005171|Ga0066677_10173698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1193 | Open in IMG/M |
| 3300005172|Ga0066683_10040133 | All Organisms → cellular organisms → Bacteria | 2735 | Open in IMG/M |
| 3300005174|Ga0066680_10012162 | All Organisms → cellular organisms → Bacteria | 4467 | Open in IMG/M |
| 3300005174|Ga0066680_10209772 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300005175|Ga0066673_10212285 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300005176|Ga0066679_10027753 | All Organisms → cellular organisms → Bacteria | 3086 | Open in IMG/M |
| 3300005176|Ga0066679_10070992 | All Organisms → cellular organisms → Bacteria | 2059 | Open in IMG/M |
| 3300005176|Ga0066679_10090601 | All Organisms → cellular organisms → Bacteria | 1843 | Open in IMG/M |
| 3300005176|Ga0066679_10716643 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300005177|Ga0066690_10197050 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300005179|Ga0066684_10877830 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300005180|Ga0066685_10340444 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300005181|Ga0066678_10128695 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
| 3300005184|Ga0066671_10000425 | All Organisms → cellular organisms → Bacteria | 13131 | Open in IMG/M |
| 3300005435|Ga0070714_100089211 | All Organisms → cellular organisms → Bacteria | 2699 | Open in IMG/M |
| 3300005435|Ga0070714_101950905 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300005445|Ga0070708_100791276 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300005445|Ga0070708_101237849 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300005446|Ga0066686_10202800 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300005447|Ga0066689_10157737 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300005450|Ga0066682_10978676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 500 | Open in IMG/M |
| 3300005454|Ga0066687_10014750 | All Organisms → cellular organisms → Bacteria | 3129 | Open in IMG/M |
| 3300005467|Ga0070706_100264722 | Not Available | 1604 | Open in IMG/M |
| 3300005468|Ga0070707_101412920 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300005471|Ga0070698_100000366 | All Organisms → cellular organisms → Bacteria | 46918 | Open in IMG/M |
| 3300005518|Ga0070699_100122171 | All Organisms → cellular organisms → Bacteria | 2291 | Open in IMG/M |
| 3300005518|Ga0070699_100814458 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300005518|Ga0070699_101042381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 750 | Open in IMG/M |
| 3300005518|Ga0070699_102229664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 500 | Open in IMG/M |
| 3300005536|Ga0070697_100000407 | All Organisms → cellular organisms → Bacteria | 33216 | Open in IMG/M |
| 3300005536|Ga0070697_100193234 | All Organisms → cellular organisms → Bacteria | 1728 | Open in IMG/M |
| 3300005536|Ga0070697_102142211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 500 | Open in IMG/M |
| 3300005552|Ga0066701_10086591 | Not Available | 1806 | Open in IMG/M |
| 3300005552|Ga0066701_10450636 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300005555|Ga0066692_10045968 | All Organisms → cellular organisms → Bacteria | 2403 | Open in IMG/M |
| 3300005555|Ga0066692_10235720 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300005556|Ga0066707_10537382 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300005558|Ga0066698_10079892 | All Organisms → cellular organisms → Bacteria | 2125 | Open in IMG/M |
| 3300005558|Ga0066698_10184783 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300005560|Ga0066670_10089734 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300005575|Ga0066702_10406270 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300005586|Ga0066691_10553336 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300005586|Ga0066691_10688927 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300006034|Ga0066656_10492483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 799 | Open in IMG/M |
| 3300006175|Ga0070712_100998850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 724 | Open in IMG/M |
| 3300006791|Ga0066653_10066870 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
| 3300006800|Ga0066660_10016088 | All Organisms → cellular organisms → Bacteria | 4229 | Open in IMG/M |
| 3300007740|Ga0104326_131757 | All Organisms → cellular organisms → Bacteria | 3167 | Open in IMG/M |
| 3300009012|Ga0066710_103036067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 652 | Open in IMG/M |
| 3300009038|Ga0099829_10845016 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300009143|Ga0099792_10171559 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300010861|Ga0126349_1278198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 540 | Open in IMG/M |
| 3300011270|Ga0137391_10724386 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300011271|Ga0137393_11676984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 525 | Open in IMG/M |
| 3300011992|Ga0120146_1002297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5865 | Open in IMG/M |
| 3300012011|Ga0120152_1022073 | All Organisms → cellular organisms → Bacteria | 2377 | Open in IMG/M |
| 3300012019|Ga0120139_1058960 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300012096|Ga0137389_10382938 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300012189|Ga0137388_10038138 | All Organisms → cellular organisms → Bacteria | 3806 | Open in IMG/M |
| 3300012205|Ga0137362_10356201 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300012208|Ga0137376_10218198 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
| 3300012208|Ga0137376_11144858 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300012361|Ga0137360_10448785 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300012927|Ga0137416_11021529 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300012927|Ga0137416_12189815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 508 | Open in IMG/M |
| 3300014150|Ga0134081_10211421 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300017654|Ga0134069_1029794 | Not Available | 1670 | Open in IMG/M |
| 3300018431|Ga0066655_10007144 | All Organisms → cellular organisms → Bacteria | 4650 | Open in IMG/M |
| 3300018431|Ga0066655_10441696 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300018433|Ga0066667_10481394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 1019 | Open in IMG/M |
| 3300018433|Ga0066667_10605250 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300018468|Ga0066662_10549581 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300018468|Ga0066662_10757539 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300018468|Ga0066662_10766167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 931 | Open in IMG/M |
| 3300018482|Ga0066669_10002712 | All Organisms → cellular organisms → Bacteria | 7397 | Open in IMG/M |
| 3300018482|Ga0066669_10006728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5479 | Open in IMG/M |
| 3300018482|Ga0066669_10198392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1534 | Open in IMG/M |
| 3300019885|Ga0193747_1051386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 1024 | Open in IMG/M |
| 3300019888|Ga0193751_1010994 | All Organisms → cellular organisms → Bacteria | 4751 | Open in IMG/M |
| 3300019888|Ga0193751_1057771 | All Organisms → cellular organisms → Bacteria | 1637 | Open in IMG/M |
| 3300020022|Ga0193733_1183498 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300021307|Ga0179585_1163422 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300021432|Ga0210384_11067834 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300021478|Ga0210402_11985052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 508 | Open in IMG/M |
| 3300021479|Ga0210410_10232716 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
| 3300022557|Ga0212123_10002409 | All Organisms → cellular organisms → Bacteria | 45159 | Open in IMG/M |
| 3300022557|Ga0212123_10048981 | All Organisms → cellular organisms → Bacteria | 3903 | Open in IMG/M |
| 3300022557|Ga0212123_10355633 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300024330|Ga0137417_1177254 | All Organisms → cellular organisms → Bacteria | 1570 | Open in IMG/M |
| 3300025929|Ga0207664_10408148 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300025929|Ga0207664_11239939 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300025939|Ga0207665_10172451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1563 | Open in IMG/M |
| 3300025939|Ga0207665_10210313 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
| 3300026277|Ga0209350_1017887 | All Organisms → cellular organisms → Bacteria | 2206 | Open in IMG/M |
| 3300026277|Ga0209350_1112190 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300026295|Ga0209234_1104447 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300026295|Ga0209234_1134377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 895 | Open in IMG/M |
| 3300026296|Ga0209235_1028666 | All Organisms → cellular organisms → Bacteria | 2892 | Open in IMG/M |
| 3300026296|Ga0209235_1053037 | All Organisms → cellular organisms → Bacteria | 1938 | Open in IMG/M |
| 3300026297|Ga0209237_1004118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 8815 | Open in IMG/M |
| 3300026297|Ga0209237_1026124 | All Organisms → cellular organisms → Bacteria | 3255 | Open in IMG/M |
| 3300026297|Ga0209237_1138064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 981 | Open in IMG/M |
| 3300026300|Ga0209027_1006049 | All Organisms → cellular organisms → Bacteria | 4550 | Open in IMG/M |
| 3300026301|Ga0209238_1081179 | Not Available | 1127 | Open in IMG/M |
| 3300026310|Ga0209239_1239098 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300026315|Ga0209686_1008863 | All Organisms → cellular organisms → Bacteria | 4261 | Open in IMG/M |
| 3300026317|Ga0209154_1116122 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300026317|Ga0209154_1236194 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300026317|Ga0209154_1257758 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300026318|Ga0209471_1000140 | All Organisms → cellular organisms → Bacteria | 53003 | Open in IMG/M |
| 3300026318|Ga0209471_1075822 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300026318|Ga0209471_1153388 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300026322|Ga0209687_1233471 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300026326|Ga0209801_1004172 | All Organisms → cellular organisms → Bacteria | 8133 | Open in IMG/M |
| 3300026327|Ga0209266_1027019 | All Organisms → cellular organisms → Bacteria | 3090 | Open in IMG/M |
| 3300026329|Ga0209375_1170162 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300026330|Ga0209473_1134134 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300026332|Ga0209803_1029695 | All Organisms → cellular organisms → Bacteria | 2601 | Open in IMG/M |
| 3300026334|Ga0209377_1105443 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300026499|Ga0257181_1059039 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300026529|Ga0209806_1059299 | All Organisms → cellular organisms → Bacteria | 1763 | Open in IMG/M |
| 3300026532|Ga0209160_1107127 | Not Available | 1403 | Open in IMG/M |
| 3300026532|Ga0209160_1171487 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300026538|Ga0209056_10436628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 764 | Open in IMG/M |
| 3300026548|Ga0209161_10015676 | All Organisms → cellular organisms → Bacteria | 5569 | Open in IMG/M |
| 3300026548|Ga0209161_10030267 | All Organisms → cellular organisms → Bacteria | 3745 | Open in IMG/M |
| 3300026551|Ga0209648_10115993 | All Organisms → cellular organisms → Bacteria | 2169 | Open in IMG/M |
| 3300027181|Ga0208997_1038835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 700 | Open in IMG/M |
| 3300027388|Ga0208995_1032819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 910 | Open in IMG/M |
| 3300027388|Ga0208995_1046870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 761 | Open in IMG/M |
| 3300027521|Ga0209524_1000835 | All Organisms → cellular organisms → Bacteria | 4878 | Open in IMG/M |
| 3300027521|Ga0209524_1056491 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300027521|Ga0209524_1065451 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300027537|Ga0209419_1019216 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300027591|Ga0209733_1013953 | All Organisms → cellular organisms → Bacteria | 2143 | Open in IMG/M |
| 3300027616|Ga0209106_1075372 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300027645|Ga0209117_1012183 | All Organisms → cellular organisms → Bacteria | 2883 | Open in IMG/M |
| 3300027645|Ga0209117_1040927 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300027651|Ga0209217_1018305 | All Organisms → cellular organisms → Bacteria | 2257 | Open in IMG/M |
| 3300027651|Ga0209217_1186293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 563 | Open in IMG/M |
| 3300027667|Ga0209009_1000003 | All Organisms → cellular organisms → Bacteria | 175882 | Open in IMG/M |
| 3300027678|Ga0209011_1025121 | All Organisms → cellular organisms → Bacteria | 1918 | Open in IMG/M |
| 3300027678|Ga0209011_1052940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 1239 | Open in IMG/M |
| 3300027681|Ga0208991_1112084 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300027727|Ga0209328_10123146 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300027748|Ga0209689_1040820 | All Organisms → cellular organisms → Bacteria | 2672 | Open in IMG/M |
| 3300027846|Ga0209180_10289533 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300027846|Ga0209180_10792116 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300027862|Ga0209701_10339165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 853 | Open in IMG/M |
| 3300027882|Ga0209590_10000038 | All Organisms → cellular organisms → Bacteria | 25072 | Open in IMG/M |
| 3300027882|Ga0209590_10159541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1404 | Open in IMG/M |
| 3300027882|Ga0209590_10341748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 964 | Open in IMG/M |
| 3300028536|Ga0137415_10037324 | All Organisms → cellular organisms → Bacteria | 4765 | Open in IMG/M |
| 3300028536|Ga0137415_10573836 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300028884|Ga0307308_10141881 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300028884|Ga0307308_10185726 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300031753|Ga0307477_10002037 | All Organisms → cellular organisms → Bacteria | 16003 | Open in IMG/M |
| 3300031753|Ga0307477_10128296 | All Organisms → cellular organisms → Bacteria | 1770 | Open in IMG/M |
| 3300031753|Ga0307477_10178361 | All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon | 1480 | Open in IMG/M |
| 3300031962|Ga0307479_10000171 | All Organisms → cellular organisms → Bacteria | 60746 | Open in IMG/M |
| 3300031962|Ga0307479_10046665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4163 | Open in IMG/M |
| 3300031962|Ga0307479_11753828 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300032180|Ga0307471_101485772 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300032205|Ga0307472_100396361 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 28.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 17.01% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 15.46% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.34% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.73% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.61% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.06% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.06% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.06% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.03% |
| Hydrocarbon Resource Environments | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Hydrocarbon Resource Environments | 0.52% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000880 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
| 3300001145 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001160 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002853 | PDIso9.ppmwps2 | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007740 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-9-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011992 | Permafrost microbial communities from Nunavut, Canada - A23_65cm_12M | Environmental | Open in IMG/M |
| 3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AL20A1W_12090472 | 3300000880 | Permafrost | MDPTTVMAVICSVVVFAGWLVLPHSPATVKTVAVSEERQPVAVSA* |
| JGI12683J13190_10039803 | 3300001089 | Forest Soil | MDATTVIAVICSVVVFAGWLVLPHSATTAKQVALSEERNPVAISA* |
| JGI12683J13190_10230711 | 3300001089 | Forest Soil | MDATTVIAVISCAIVLAGWLVLPSKMTTVKPVVVSEERKPVSVSA* |
| JGI12682J13319_10034123 | 3300001145 | Forest Soil | MDATTVIAIISCAIVLVGWLVLPHSATTVKPVVVSEEERAPVSVSA* |
| JGI12636J13339_10500501 | 3300001154 | Forest Soil | MDPTTVIAVVCSVVVFAGWLVLPHSATTAKQVALSEERNPVAISA* |
| JGI12654J13325_10136061 | 3300001160 | Forest Soil | MDATTVIAVICSAIVLAGWLVLPHSATTTVKVAAVVSEERERTPVSVSA* |
| A1565W1_115376902 | 3300001536 | Permafrost | MDPTTVMAVICSVVVFAGWLVLPHSPATVKTVAVSEERQPVPVSA* |
| JGI12630J15595_100008779 | 3300001545 | Forest Soil | MDATTVIAVISCAIVLCGWLVLPGSNTTVKPVVVSEERKPVSVSA* |
| JGI12630J15595_100033821 | 3300001545 | Forest Soil | MDATTVIAVICSVVVFAGWLVLPHSPATVKPAVVVSEEREPA |
| JGI12635J15846_100589362 | 3300001593 | Forest Soil | MDPTTVIAVICSVVVFAGWLVLPHSATTTVKVAAVSEERERTPVSVSA* |
| JGI12053J15887_100307212 | 3300001661 | Forest Soil | MDATTVLAVICSAIVFVGWLVLPHSATEKTLVVSEERKPVAVSA* |
| JGI12053J15887_100488464 | 3300001661 | Forest Soil | MDATTVIAVVCSVVLFAGWVVLPHSATTVKPVAVSEERKPVAISA* |
| JGI12053J15887_103058872 | 3300001661 | Forest Soil | MDATTVIAVICSVVVFAGWLVLPHSATTVTPVAVAEERKPVAI |
| JGIcombinedJ26739_1000373474 | 3300002245 | Forest Soil | MDATTVIAVICSVVVFAGWLVLPHSPATVKPAVVVSEEREPARVSA* |
| JGI25381J37097_10057253 | 3300002557 | Grasslands Soil | MDPTTVMAVVCSVVVFAGWLILPHSPTSIKPVVVSEEREPVRVSA* |
| JGI25385J37094_100608811 | 3300002558 | Grasslands Soil | MDATTVIAVICSVVVFAGWLVLPHSATTVKPMAVSEERKPVAISA* |
| JGI25383J37093_100610873 | 3300002560 | Grasslands Soil | RKELMDATTVIAVICSVVVFAGWLVLPHSATTVKPMAVSEERKPVAISA* |
| draft_10029022 | 3300002853 | Hydrocarbon Resource Environments | MDATTVIAVICSAVVFAGWLILPHSATTVKPVAVSEERQPIAVSA* |
| JGI25382J43887_101896042 | 3300002908 | Grasslands Soil | MDATTVLAIICSAIVFAGWVVLPHSATTIVKASVVSEERTPVSVSA* |
| JGI25388J43891_10395621 | 3300002909 | Grasslands Soil | MDATTVIAVICSVVVFAGWLVLPHSATTVQPVAVSEERKPVAISA* |
| JGI25390J43892_101058412 | 3300002911 | Grasslands Soil | MDPTTVMAVVCSVVVFAGWLILPHSPTSIKPAVVSEEREPVRVSA* |
| JGI25386J43895_102003252 | 3300002912 | Grasslands Soil | MDPTTVMAVLCSVVVFAGWLLLPHSATSVEPVVVSEERQPVPVSA* |
| JGI25387J43893_10673012 | 3300002915 | Grasslands Soil | MDATTVIAVISCAIVLAAWLVLPSKATTVKPVVVSEERKPVSISA* |
| JGI25616J43925_102785511 | 3300002917 | Grasslands Soil | MDATTVLAVICSAIVLAGWVVLPHSATAPVKASVVSEERTPVS |
| Ga0066674_101031312 | 3300005166 | Soil | MDPTTVMAVICSVVVFAGWLVLPHSPTSVKPVIVSEERQPAAVSA* |
| Ga0066672_100634573 | 3300005167 | Soil | MDATTVIAVICSVVVFAGWLVLPHSATTVKPVVIEEREPVRVSA* |
| Ga0066672_101559062 | 3300005167 | Soil | MDATTVIAVICSVVVFAGWLVLPHSATTVKPMAVAEERKPVAISA* |
| Ga0066672_102572952 | 3300005167 | Soil | MDPTTVMAVICSVIVFAGWLVLPHSAAAKPRVVSEERKPVRVSA* |
| Ga0066672_102998252 | 3300005167 | Soil | MDATTVIAVISCAIVLAAWLVLPSKATTVRPVVVSEERKPVSVSA* |
| Ga0066677_101093592 | 3300005171 | Soil | MDPTTVMAVICSVVVFAGWLVLPHSPTTVKPVVVSEEREPVRVSA* |
| Ga0066677_101736982 | 3300005171 | Soil | MDPTTVMAVVCSVVVFAGWLLLPHSPATVKPVVVSEEQEPARVSA* |
| Ga0066683_100401333 | 3300005172 | Soil | MDATTVIAVICSVAVFAGWLVLPHSATTVKPVAVSEERKPVAISA* |
| Ga0066680_100121622 | 3300005174 | Soil | MDATTVIAVISCAIVLCGWLVLPSSKTTVKPLVVSEEPEPVSVSA* |
| Ga0066680_102097722 | 3300005174 | Soil | MDPTTVMAVVCSVVVFAGWLLLPHSPTMVKPVVVSEEREPARVSA* |
| Ga0066673_102122852 | 3300005175 | Soil | MDPTTIMAVVCSVVVFAGWLLLPHSPTTVKPVVVSEEREPA |
| Ga0066679_100277533 | 3300005176 | Soil | MDATTVIAIISCAIVLAGWLVLPHSAATIKPVVFSEEERKPVSVSA* |
| Ga0066679_100709922 | 3300005176 | Soil | MDATTVIAVICSVVVFAGWLVLPHSATTVKPVVVEERQPVQVSA* |
| Ga0066679_100906012 | 3300005176 | Soil | MDATTVIAIISCAIVLAGWLVLPHSAATTVKPLVVSEEREPVSASA* |
| Ga0066679_107166431 | 3300005176 | Soil | MDATTVLAVICSAVVFVGWLVLPHSATEKTLVVSEERKPVAVSA* |
| Ga0066690_101970502 | 3300005177 | Soil | MDPTTIMAIACSVLVFTGWLVLPHAPKTVKPAVVVSEERQPVAISA* |
| Ga0066684_108778302 | 3300005179 | Soil | KTMDATTVIAVISCAIVLAAWLVLPSKATTVKPVVVSEERKPVSISA* |
| Ga0066685_103404442 | 3300005180 | Soil | MDATTVIAVICSVAVFAGWLVLPHSATTVQPVAVSEERKPVAISA* |
| Ga0066678_101286952 | 3300005181 | Soil | MDPTTVMAVICSVVVSAGWLVLPHSPTTVKPVVVSEEREPVRVSA* |
| Ga0066671_1000042513 | 3300005184 | Soil | MDPTTIMAIACSVLVFTGWLVLPHAPKTVKPAVVVSEERQPV |
| Ga0070714_1000892113 | 3300005435 | Agricultural Soil | MDPTTVMAVICSVVVFAGWLVLPHSPTAVKTMAVSEERQPVRVSA* |
| Ga0070714_1019509052 | 3300005435 | Agricultural Soil | MDATTVIAVISCAIVLGGWLVLPSSTPAVKPVLVSEERKPVSVSA* |
| Ga0070708_1007912762 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDATTVIAIISCAIVLAGWLVLPHSATTVKPVVVSEEERTPVSVSA* |
| Ga0070708_1012378492 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPTTIMAVICSVVVFAGWLVLPHSPTTVKTMAVSEEREPVRVSA* |
| Ga0066686_102028001 | 3300005446 | Soil | MDPTTIMAVVCSVVVFAGWLLLPHSPTTVKPVVVSEEREPARVSA* |
| Ga0066689_101577371 | 3300005447 | Soil | MDPTTLMAVMCSVVVFAGWLILPHSATTLKPVVVEEREPVQVSA* |
| Ga0066682_109786762 | 3300005450 | Soil | MDPTTVMAVVCSVVVFAGWLLLPHSPTTVKPVVVSEEREPVRVSA* |
| Ga0066687_100147504 | 3300005454 | Soil | MAVICSVVVFAGWLVLPHSPTTVKPVVVSEEREPVRVSA* |
| Ga0070706_1002647221 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MDATTVIAVISCAIVLCGWLVLPSSTTTVKPLVVSEEREPVSVSA* |
| Ga0070707_1014129202 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MDATTVIAVISCAIVLCGWLVLPSSKTTVKPLVVSEEPEP |
| Ga0070698_10000036613 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MDATTVLAVICSAIVFAGWVVLPHSATPIVKASVLSEERTPVSVSA* |
| Ga0070699_1001221713 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MDATTVIAVICSVVLFAGWLVLPHSAATVKPVAVSEERKPVAISA* |
| Ga0070699_1008144582 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MDATTVIAIISCAIVLAGWLVLPHSATTVKPIVVSEEERTSVSVSA* |
| Ga0070699_1010423811 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPTTVMAVICSVVVFAGWLVLPHSPTTVKTVAVSEEREPVRASA* |
| Ga0070699_1022296642 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MDATTVLAVICSAIVLAGWIVLPHSATTVKVATVVSEERTPVSVSA* |
| Ga0070697_10000040731 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MDATTVIAVISCAIVLCGWLVLPSSKTTVKPLVVSEEPERVAVSA* |
| Ga0070697_1001932342 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPTTVMAIICSVVVFAGWLFLPHTPTTVKPAVVVSEERQPVRASA* |
| Ga0070697_1021422111 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MDATTVIAIISCAIVLAGWLVLPHSATTVKPIVVSEEERTPVSVSA* |
| Ga0066701_100865911 | 3300005552 | Soil | MDATTVIAVISCAIVLCGWLVLPSSKTTVKPLVVSEEREPVSVSA* |
| Ga0066701_104506361 | 3300005552 | Soil | LMDPTTVMAVICSVVVFAGWLVLPHSPTSVKPVIVSEERQPAAVSA* |
| Ga0066692_100459681 | 3300005555 | Soil | MDATTVIAVICSVVVFAGWLVLPHSATTVQPVAVSEER |
| Ga0066692_102357201 | 3300005555 | Soil | EDKKTMDATTVIAVISCAIVLCGWLVLPSSKTTVKPLVVSEEPEPVSVSA* |
| Ga0066707_105373822 | 3300005556 | Soil | MAVVCSVVVFAGWLLLPHSPATVKPVVVSEEQEPARVSA* |
| Ga0066698_100798924 | 3300005558 | Soil | MDPTTVMAVVCSVVVFAGWLLLPHSPATVKPVVVSEEREPARVSA* |
| Ga0066698_101847832 | 3300005558 | Soil | MDATTVIAVICSVVVFAGWLVLPHSATTVKPVAVSEERKPVAISA* |
| Ga0066670_100897341 | 3300005560 | Soil | MDATTLIAVICSVVVFAGWLVLPHSATTVKPVAVSEERKPVAISA* |
| Ga0066702_104062701 | 3300005575 | Soil | MDPTTIMAIACSVLVFTGWLVLPHAPKTVKPAVVVSEERQPVA |
| Ga0066691_105533362 | 3300005586 | Soil | MDATTVIAVISCAIVLAAWLVLPSKATTVKPAVVSEERKPVSISA |
| Ga0066691_106889272 | 3300005586 | Soil | MDATTVIAVISCAIVLAAWLVLPSKATSVKPVVVSEERKPVSISA* |
| Ga0066656_104924832 | 3300006034 | Soil | MDPTTVMAVVCSVVVFAGWLLLPHSPTTVKPVVVSDEREPARVSA* |
| Ga0070712_1009988502 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPTTIMAVICSVVVFAGWLVLPHSPTTVKTMAVSEERQPVRVSA* |
| Ga0066653_100668703 | 3300006791 | Soil | MDPTTVMAVICSVVVFAGWLVLPHSPTSVKPVIVSEERQPVPVSA* |
| Ga0066660_100160887 | 3300006800 | Soil | CSVVVFAGWLILPHSPTSIKPVVVSEEREPVRVSA* |
| Ga0104326_1317574 | 3300007740 | Soil | VKEEKMDPTTVMAVICSVVIFAGWLVLPHSPASVKTVVVAEERQRVPVSA* |
| Ga0066710_1030360672 | 3300009012 | Grasslands Soil | MDPTTVMAVVCSVVVFAGWLLLPHSPATVKPVVVSEEREPARVSA |
| Ga0099829_108450161 | 3300009038 | Vadose Zone Soil | MDPTTVMAVICSVVVFAGWLVLPHSPTTVKTVAVSEERQPVRVSA* |
| Ga0099792_101715592 | 3300009143 | Vadose Zone Soil | MDATTVIAVICSVVVFAGWLVLPHSPTTVKTMAVSEERQPVRVSA* |
| Ga0126349_12781982 | 3300010861 | Boreal Forest Soil | MDATTVIAIISCAIVLAGWLVLPHSATTAKPIVVSEEERTPVSVSA* |
| Ga0137391_107243862 | 3300011270 | Vadose Zone Soil | MDATTVLAVICSAIVFVGWLILPHSATATEKTLVVSEGRTPVPVSA* |
| Ga0137393_116769841 | 3300011271 | Vadose Zone Soil | LKKEDKKTMDATTVIAVISCAIVLCGWLVLPSSKTTVKPLVVSEEPEPVSVSV* |
| Ga0120146_10022976 | 3300011992 | Permafrost | MDPTTVMAVVCSVVVFAGWLVLPHSPATVKTVAVAEERQRVPVSA* |
| Ga0120152_10220734 | 3300012011 | Permafrost | MDPTTAMAVVCSVVVFAGWLVLPHSPATVKTVAVAEERQRVPVSA* |
| Ga0120139_10589602 | 3300012019 | Permafrost | MDATTVLAVICSGVVFAGWLFLPHSPAPVKTVAVSEELA |
| Ga0137389_103829383 | 3300012096 | Vadose Zone Soil | MDATTVLAVICSAIVFAGWLVLPHSATATEKALVVSEERAPVPVSA* |
| Ga0137388_100381384 | 3300012189 | Vadose Zone Soil | MDATTVLAVICSAIVFVGWLILPHSATATEKTLVVSEERTPVPVSA* |
| Ga0137362_103562011 | 3300012205 | Vadose Zone Soil | MDATTVIAVICSVVVFAGWLVLPHSATTVKPVAVAEERKPVAISA* |
| Ga0137376_102181983 | 3300012208 | Vadose Zone Soil | MDPTTIMAVICSVVVFAGWLVLPHSPATVETVAVSEERQPVRASA* |
| Ga0137376_111448581 | 3300012208 | Vadose Zone Soil | MDATTVIAVICSVVVFAGWLVLPHSATTVQPVAVTEERKPVAISA* |
| Ga0137360_104487851 | 3300012361 | Vadose Zone Soil | MDATTVIAVICSVVVFAGWLVLPHSATTVQPVAVSEERNPVAISA* |
| Ga0137416_110215292 | 3300012927 | Vadose Zone Soil | MDATTVIAIISCAIVLAGWLVLPHSAATTVKPLVVSEEPEPVSA* |
| Ga0137416_121898152 | 3300012927 | Vadose Zone Soil | MDATTVLAVICSAIVLAGWIVLPHSATTVKVAAVVSEERERTPVSVSA* |
| Ga0134081_102114211 | 3300014150 | Grasslands Soil | MDATTVIAVICSVAVFAGWLVLPHSATTVQPVAVSEE |
| Ga0134069_10297942 | 3300017654 | Grasslands Soil | MDPTTVMAVICSVVVFAGWLLLPHSPTTVKPVVVSEEREPVRVSA |
| Ga0066655_100071443 | 3300018431 | Grasslands Soil | MDPTTVMAVVCSVVVFAGWLILPHSPTSIKPVVVSEEREPVRVSA |
| Ga0066655_104416962 | 3300018431 | Grasslands Soil | MDPTTVMAVVCSVVVFAGWLLLPHSPTTVKPVVVSDEREPARVSA |
| Ga0066667_104813942 | 3300018433 | Grasslands Soil | MDATTVIAVICSVVVFAGWLVLPHSATTVKPVVIEEREPVRVSA |
| Ga0066667_106052502 | 3300018433 | Grasslands Soil | MDPTTIMAVVCSVVVFAGWLLLPHSPTTVKPVVVSEEREPARVSA |
| Ga0066662_105495812 | 3300018468 | Grasslands Soil | MDPTTVMAVICSVVVSAGWLVLPHSPTTVKPVVVSEEREPVRVSA |
| Ga0066662_107575392 | 3300018468 | Grasslands Soil | MDPTTIMAIACSVLVFTGWLVLPHAPKTVKPAVVVSEERQPVAISA |
| Ga0066662_107661672 | 3300018468 | Grasslands Soil | MDPTTIMAIGCSVLVFAGWLVLPHSPKTVKPAVVVSEERQPVAVSA |
| Ga0066669_1000271211 | 3300018482 | Grasslands Soil | MDPTTVMAVVCSVVVFAGWLILPHSPTSIKPAVVSEEREPVRVSA |
| Ga0066669_100067287 | 3300018482 | Grasslands Soil | MDATTVIAVICSVVVFAGWLVLPHSATTVKSVAVSEERKPVAISA |
| Ga0066669_101983922 | 3300018482 | Grasslands Soil | MDPTTVMAVVCSVVVFAGWLLLPHSPTTVKPVVVSEEREPVRVSA |
| Ga0193747_10513862 | 3300019885 | Soil | MDPTTVMAVICSVVVFAGWLVLPHSPTTVRTVAVSEEREPVRASA |
| Ga0193751_10109942 | 3300019888 | Soil | MDATTVIAVISCAIVLCGWLVLPHSAMTTVKPLVVSEEERTPVSVSA |
| Ga0193751_10577712 | 3300019888 | Soil | MDPTTVMAVICSVVVFAGWLVLPHSPATVKTLAVSEERQPVSVSA |
| Ga0193733_11834982 | 3300020022 | Soil | MDPTTVMAVICSVVVFAGWLVLPHSPTTVKTMTVSEERKPVAISA |
| Ga0179585_11634221 | 3300021307 | Vadose Zone Soil | MDATTVIAVICSVVVFAGWLVLPHSATTVKPVAFAEERKPVAISA |
| Ga0210384_110678341 | 3300021432 | Soil | MDATTVIAIISCAIVLTGWLVLPHSATTVKPLVVSEEERTPVSVSA |
| Ga0210402_119850521 | 3300021478 | Soil | MDATTVIAIISCAIVLAGWLVLPHSATTVKPIVISEEERTPVSVSA |
| Ga0210410_102327163 | 3300021479 | Soil | MDATTVIAIISCAIVLAGWLVLPHSATTVKPLVVSEEERTPVSVSA |
| Ga0212123_1000240912 | 3300022557 | Iron-Sulfur Acid Spring | MDATTVLAVICSTIVFAGWLVLPHAPATVKTMAVSEERQPVAVSA |
| Ga0212123_100489812 | 3300022557 | Iron-Sulfur Acid Spring | MDATTVLAVICSVIVFAGWLVLPHSPASVKPMAVSEERQPVAVSA |
| Ga0212123_103556331 | 3300022557 | Iron-Sulfur Acid Spring | MDATTVIAVICSAVVFAGWLILPHSATTVKPVAVSEERQPIAVSA |
| Ga0137417_11772541 | 3300024330 | Vadose Zone Soil | MDATTVIAVICSVVVFAGWLVLPHSATTVKPVAVAEERKPVAISA |
| Ga0207664_104081482 | 3300025929 | Agricultural Soil | MDPTTVMAVICSVVVFAGWLVLPHSPTAVKTMAVSEERQPVRVSA |
| Ga0207664_112399391 | 3300025929 | Agricultural Soil | MDATTVIAIISCAIVLAGWLVLPHSATTVKPIVVSEEE |
| Ga0207665_101724512 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPTTVMAVICSVVVFAGWLVLPHSPTTVKTMAVSEEREPVRVSA |
| Ga0207665_102103133 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPTTIMAIICSVVVFAGWLFLPHSPTTVKPAVVVSEERQPVRASA |
| Ga0209350_10178873 | 3300026277 | Grasslands Soil | MDATTVIAVICSVVVFAGWLVLPHSATTVQPVAVSEERKPVAISA |
| Ga0209350_11121902 | 3300026277 | Grasslands Soil | MDATTVIAVISCAIVLAAWLVLPSKATTVKPVVVSEERKPVSISA |
| Ga0209234_11044472 | 3300026295 | Grasslands Soil | MDPTTIMAIACSLAVFAGWLVLPHSPKTVKPAVVVREERQPVAVSA |
| Ga0209234_11343772 | 3300026295 | Grasslands Soil | MDPTTLMAVMCSVVVFAGWLILPHSATTLKPVVVEEREPVQVSA |
| Ga0209235_10286664 | 3300026296 | Grasslands Soil | MDPTTVMAVICSVVVFAGWLVLPHSPTSVKPVIVSEERQPAAVSA |
| Ga0209235_10530372 | 3300026296 | Grasslands Soil | MDATTVIAVICSVVVFAGWLVLPHSATTVKPMAVSEERKPVAISA |
| Ga0209237_10041184 | 3300026297 | Grasslands Soil | MDPTTVMAVLCSVVVFAGWLLLPHSATSVEPVVVSEERQPVPVSA |
| Ga0209237_10261242 | 3300026297 | Grasslands Soil | MDATTVIAVICSVVVFAGWLVLPHSATTVKPMAVAEERKPVAISA |
| Ga0209237_11380642 | 3300026297 | Grasslands Soil | MDATTVIAVISCAIVLCGWLVLPSSKTTVKPLVVSEEPEPVSISA |
| Ga0209027_10060492 | 3300026300 | Grasslands Soil | MDPTTVMAVICSVIVFAGWLVLPHSPAAVKTMALSEEREPVAISA |
| Ga0209238_10811792 | 3300026301 | Grasslands Soil | MDATTVIAVISCAIVLAAWLVLPSKATTVKPVVVSE |
| Ga0209239_12390981 | 3300026310 | Grasslands Soil | MDATTLIAVICSVVVFAGWLVLPHSATTVKPVAVSEERKPVAISA |
| Ga0209686_10088632 | 3300026315 | Soil | MDPTTVMAVICSVVVFAGWLVLPHSPTTVKPVVVSEEREPVRVSA |
| Ga0209154_11161222 | 3300026317 | Soil | MDATTVIAVISCAIVLAAWLVLPSKATTVRPVVVSEERKPVSVSA |
| Ga0209154_12361942 | 3300026317 | Soil | MDPTTVMAVICSVIVFAGWLVLPHSAAAKPRVVSEERKPVRVSA |
| Ga0209154_12577582 | 3300026317 | Soil | MDATTVIAVICSVVVFAGWLVLPHSATTVQPVAVSEERKPVAI |
| Ga0209471_100014057 | 3300026318 | Soil | MDATTVIAVISCAIVLAAWLVLPSKATSVKPVVVSEERKPVSISA |
| Ga0209471_10758223 | 3300026318 | Soil | MDATTVIAIISCAIVLAGWLVLPHSAATTVKPLVVSEEREPVSASA |
| Ga0209471_11533882 | 3300026318 | Soil | MDATTVIAIISCAIVLAGWLVLPHSAATIKPVVFSEEERKPVSVSA |
| Ga0209687_12334711 | 3300026322 | Soil | PTTVMAVICSVIVFAGWLVLPHSAAAKPRVVSEERKPVRVSA |
| Ga0209801_10041727 | 3300026326 | Soil | MDATTVIAVICSVAVFAGWLVLPHSATTVQPVAVSEERKPVAISA |
| Ga0209266_10270192 | 3300026327 | Soil | MDATTVIAVICSVAVFAGWLVLPHSATTVKPVAVSEERKPVAISA |
| Ga0209375_11701622 | 3300026329 | Soil | VMAVVCSVVVFAGWLLLPHSPTTVKPVVVSEEREPVRVSA |
| Ga0209473_11341341 | 3300026330 | Soil | TMDPTTVMAVVCSVVVFAGWLLLPHSPTTVKPVVVSDEREPARVSA |
| Ga0209803_10296953 | 3300026332 | Soil | MDPTTVMAVVCSVVVFAGWLLLPHSPATVKPVVVSEEQEPARVSA |
| Ga0209377_11054431 | 3300026334 | Soil | KKTMDATTVIAVISCAIVLCGWLVLPSSKTTVKPLVVSEEPEPVSVSA |
| Ga0257181_10590391 | 3300026499 | Soil | MDATTVLAVICSAIVLAGWIVLPHSATTVKVAAVVSEERERTPVSVSA |
| Ga0209806_10592992 | 3300026529 | Soil | MDATTVLAVICSAVVFVGWLVLPHSATEKTLVVSEERKPVAVSA |
| Ga0209160_11071272 | 3300026532 | Soil | MDPTTVMAVVCSVVVFAGWLLLPHSPATVKPVVVSEEQ |
| Ga0209160_11714872 | 3300026532 | Soil | MDATTVIAVISCAIVLAAWLVLPSKATTVRPVVVSEERKPIASRRSPC |
| Ga0209056_104366282 | 3300026538 | Soil | MDPTTVMAVVCSVVVFAGWLLLPHSPTTVKPVVVSEEREPARVSA |
| Ga0209161_100156762 | 3300026548 | Soil | MDATTVIAVICSVVVFAGWLVLPHSATTVKPVAVSEERKPVAISA |
| Ga0209161_100302674 | 3300026548 | Soil | MDATTVIAVISCAIVLAAWLVLPSKATTVKPVVVSEERKPVSTSA |
| Ga0209648_101159932 | 3300026551 | Grasslands Soil | MDATTVLAVICSAIVLAGWIVLPHSATTVKVAAVVSEDRERTPVSVSA |
| Ga0208997_10388352 | 3300027181 | Forest Soil | MDATTVIAVISCAIVLAGWLVLPSKAAKTVKPVVVSEERKPVAVSA |
| Ga0208995_10328192 | 3300027388 | Forest Soil | MDATTVIAVVCSVVLFAGWVVLPHSATTVKPVAVSEERKPVAISA |
| Ga0208995_10468702 | 3300027388 | Forest Soil | MDATTVLAVICSAIVFVGWLVLPHSATEKTLVVSEERKPVAVSA |
| Ga0209524_10008357 | 3300027521 | Forest Soil | MDATTVIAVISCAIVLCGWLVLPGSNTTVKPVVVSEERKPVSVSA |
| Ga0209524_10564911 | 3300027521 | Forest Soil | MDATTVLAVICSAVVLAGWLVLPHSATTTVKVAAVVSEERERTPVPVSA |
| Ga0209524_10654512 | 3300027521 | Forest Soil | MDATTVIAVICSVVVFAGWLVLPHSPATAKPAVVVSEEREPARVSA |
| Ga0209419_10192163 | 3300027537 | Forest Soil | MDATTVIAVICSVVVFAGWLVLPHSPATVKPAVVVSEEREPARVSA |
| Ga0209733_10139532 | 3300027591 | Forest Soil | MDPTTVIAVICSVVVFAGWLVLPHSATTTVKVAAVSEERERTPVSVSA |
| Ga0209106_10753721 | 3300027616 | Forest Soil | MDPTTVMAVICSVVVFAGWLVLPHAPTTVKQVAVVSEERQPVPVSA |
| Ga0209117_10121832 | 3300027645 | Forest Soil | MDATTVIAVISCAIVLAGWLVLPSKMTTVKPVVVSEERKPVSVSA |
| Ga0209117_10409272 | 3300027645 | Forest Soil | MDATTVIAVICSVVVFAGWLVLPHSATTAKQVALSEERNPVAISA |
| Ga0209217_10183052 | 3300027651 | Forest Soil | MDATTVIAVICSAIVLAGWLVLPHSATTTVKVAAVVSEERERTPVSVSA |
| Ga0209217_11862932 | 3300027651 | Forest Soil | MDPTTVIAVICSVVVFAGWLVLPHSPTTVKPVAVSEERQPVRVSA |
| Ga0209009_10000034 | 3300027667 | Forest Soil | MDATTVIAIISCAIVLVGWLVLPHSATTVKPVVVSEEERAPVSVSA |
| Ga0209011_10251213 | 3300027678 | Forest Soil | MDATTVIAVISCAIVLAGWLVLPSKATTVKTVKPVVVSEERKPVSVSA |
| Ga0209011_10529401 | 3300027678 | Forest Soil | MDATTVIAIISCAIVLAGWLVLPHSAKTVKPVVVGEEQRTPVSVSA |
| Ga0208991_11120841 | 3300027681 | Forest Soil | MDATTVIAIISCAIVLAAWLVLPSKATPVKPVVVSEERKPVAVSA |
| Ga0209328_101231462 | 3300027727 | Forest Soil | MDPTTVIAVICSVVVFAGWLVLPHSPTVKPVAVSEERQPVRVSA |
| Ga0209689_10408204 | 3300027748 | Soil | GEFMDATTVIAVICSVVVFAGWLVLPHSATTVQPVAVSEERKPVAISA |
| Ga0209180_102895332 | 3300027846 | Vadose Zone Soil | MDATTVLAVICSAIVFVGWLILPHSATATEKTLVVSEERTPVPVSA |
| Ga0209180_107921162 | 3300027846 | Vadose Zone Soil | MDPTTVMAVICSVVVFAGWLVLPHSPTTVKTVAVSEERQPVRVSA |
| Ga0209701_103391652 | 3300027862 | Vadose Zone Soil | MDATTVLAVICSAIVFAGWVVLPHSATTTVKVAAVVSEERTPVSVSA |
| Ga0209590_1000003814 | 3300027882 | Vadose Zone Soil | MDATTVLAIICSAIVFAGWVVLPHSATTIVKASVVSEEERTPVSVSA |
| Ga0209590_101595412 | 3300027882 | Vadose Zone Soil | MDPTTVMAVICSVVVFAGWLVLPHSPTTVKPVAVSEERQPVAVSA |
| Ga0209590_103417482 | 3300027882 | Vadose Zone Soil | MDATTVIAVISCALVLCGWLVLPSSKTTVKPLVVSEEPEPVSVSA |
| Ga0137415_100373244 | 3300028536 | Vadose Zone Soil | MDATTVIAVVSCAIVLAAWLVLPSKATTVRPVVVSEERKPVSVSA |
| Ga0137415_105738362 | 3300028536 | Vadose Zone Soil | MDATTVFAVISCAIVFAGWLVLPHSATVKPVVVSEERKPVAVSA |
| Ga0307308_101418811 | 3300028884 | Soil | MDPTTVMAVICSVVVFAGWLVLPHSPTTVKTMTVSEERKP |
| Ga0307308_101857261 | 3300028884 | Soil | MAVICSVVVFAGWLVLPHSPTTVKTMTVSEERKPVAISA |
| Ga0307477_100020377 | 3300031753 | Hardwood Forest Soil | MDATTVIAIISCAIVLAGWLVLPHSATTVKPIVVSEEQRTPVSVSA |
| Ga0307477_101282963 | 3300031753 | Hardwood Forest Soil | MDATTVIAIISCAIVLAGWLVLPHSATTAKPIVVSEEERTPVSVSA |
| Ga0307477_101783611 | 3300031753 | Hardwood Forest Soil | MDPTTIMAIICSAVVFAGWLVLPHSPTTVKPEVVVSE |
| Ga0307479_1000017146 | 3300031962 | Hardwood Forest Soil | MDPTTIMAVVCSVIVFAGWLVLPHSPSAVKPAVLVSEERQPVRVSA |
| Ga0307479_100466652 | 3300031962 | Hardwood Forest Soil | MDPTTVIALICSAIVFAGWLVLPHSATVKPRVVSEERSEVSVSA |
| Ga0307479_117538282 | 3300031962 | Hardwood Forest Soil | MDPTTVIAVICSVVVFAGWLVLPHSAAPVKPVAVGEERKPVAISA |
| Ga0307471_1014857722 | 3300032180 | Hardwood Forest Soil | MDATTVIAVISCAIVLCGWLVLPSSTTTVKSIVVSEEREPVSVSA |
| Ga0307472_1003963613 | 3300032205 | Hardwood Forest Soil | SCAIVLAGWLVLPHSATTVKPVVVSEEERTPVSVSA |
| ⦗Top⦘ |