| Basic Information | |
|---|---|
| Family ID | F027512 |
| Family Type | Metagenome |
| Number of Sequences | 194 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MTVEEQIEEFLEMYGDRLPNPEHCPKEFEYYVKLYKYIKGLE |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 194 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 55.67 % |
| % of genes near scaffold ends (potentially truncated) | 18.04 % |
| % of genes from short scaffolds (< 2000 bps) | 80.93 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (37.113 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (39.175 % of family members) |
| Environment Ontology (ENVO) | Unclassified (82.990 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (88.144 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.43% β-sheet: 0.00% Coil/Unstructured: 58.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 194 Family Scaffolds |
|---|---|---|
| PF01027 | Bax1-I | 27.32 |
| PF09722 | Xre_MbcA_ParS_C | 5.67 |
| PF14236 | DUF4338 | 4.64 |
| PF02562 | PhoH | 1.55 |
| PF13884 | Peptidase_S74 | 1.55 |
| PF13392 | HNH_3 | 1.55 |
| PF00768 | Peptidase_S11 | 1.55 |
| PF01521 | Fe-S_biosyn | 1.03 |
| PF10902 | WYL_2 | 1.03 |
| PF01223 | Endonuclease_NS | 0.52 |
| PF06424 | PRP1_N | 0.52 |
| PF01592 | NifU_N | 0.52 |
| PF13455 | MUG113 | 0.52 |
| PF01844 | HNH | 0.52 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 194 Family Scaffolds |
|---|---|---|---|
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.55 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 1.55 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 1.55 |
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 1.03 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 1.03 |
| COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
| COG1864 | DNA/RNA endonuclease G, NUC1 | Nucleotide transport and metabolism [F] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.43 % |
| Unclassified | root | N/A | 35.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001968|GOS2236_1085780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1680 | Open in IMG/M |
| 3300001968|GOS2236_1091271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1630 | Open in IMG/M |
| 3300002835|B570J40625_101074331 | Not Available | 682 | Open in IMG/M |
| 3300002835|B570J40625_101357635 | Not Available | 588 | Open in IMG/M |
| 3300003277|JGI25908J49247_10044922 | All Organisms → Viruses → Predicted Viral | 1176 | Open in IMG/M |
| 3300003277|JGI25908J49247_10069872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
| 3300003411|JGI25911J50253_10179865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
| 3300005580|Ga0049083_10062932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1302 | Open in IMG/M |
| 3300005580|Ga0049083_10222426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
| 3300005581|Ga0049081_10073315 | All Organisms → Viruses → Predicted Viral | 1287 | Open in IMG/M |
| 3300005581|Ga0049081_10096617 | Not Available | 1103 | Open in IMG/M |
| 3300005581|Ga0049081_10102426 | All Organisms → Viruses → Predicted Viral | 1067 | Open in IMG/M |
| 3300005581|Ga0049081_10112547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1010 | Open in IMG/M |
| 3300005581|Ga0049081_10273482 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300005581|Ga0049081_10282395 | Not Available | 575 | Open in IMG/M |
| 3300005581|Ga0049081_10284571 | Not Available | 573 | Open in IMG/M |
| 3300005581|Ga0049081_10344193 | Not Available | 507 | Open in IMG/M |
| 3300005582|Ga0049080_10056701 | Not Available | 1350 | Open in IMG/M |
| 3300005582|Ga0049080_10200954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300005582|Ga0049080_10229940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300005582|Ga0049080_10233788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
| 3300005584|Ga0049082_10079792 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300005805|Ga0079957_1022253 | All Organisms → Viruses → Predicted Viral | 4387 | Open in IMG/M |
| 3300005805|Ga0079957_1071025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2010 | Open in IMG/M |
| 3300005805|Ga0079957_1355334 | Not Available | 640 | Open in IMG/M |
| 3300006484|Ga0070744_10189102 | Not Available | 587 | Open in IMG/M |
| 3300007548|Ga0102877_1128656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 718 | Open in IMG/M |
| 3300007625|Ga0102870_1199114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
| 3300007639|Ga0102865_1015439 | All Organisms → Viruses → Predicted Viral | 2151 | Open in IMG/M |
| 3300007972|Ga0105745_1237732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
| 3300008107|Ga0114340_1024117 | Not Available | 2836 | Open in IMG/M |
| 3300008110|Ga0114343_1039845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2411 | Open in IMG/M |
| 3300008113|Ga0114346_1241947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
| 3300008259|Ga0114841_1190088 | Not Available | 757 | Open in IMG/M |
| 3300008267|Ga0114364_1068491 | All Organisms → Viruses → Predicted Viral | 1203 | Open in IMG/M |
| 3300008448|Ga0114876_1019326 | All Organisms → Viruses → Predicted Viral | 3579 | Open in IMG/M |
| 3300009068|Ga0114973_10040112 | All Organisms → Viruses → Predicted Viral | 2797 | Open in IMG/M |
| 3300009068|Ga0114973_10072306 | All Organisms → Viruses → Predicted Viral | 1991 | Open in IMG/M |
| 3300009068|Ga0114973_10217180 | All Organisms → Viruses → Predicted Viral | 1040 | Open in IMG/M |
| 3300009068|Ga0114973_10220660 | All Organisms → Viruses → Predicted Viral | 1030 | Open in IMG/M |
| 3300009068|Ga0114973_10335786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 800 | Open in IMG/M |
| 3300009068|Ga0114973_10403092 | Not Available | 716 | Open in IMG/M |
| 3300009151|Ga0114962_10078626 | Not Available | 2095 | Open in IMG/M |
| 3300009151|Ga0114962_10206459 | All Organisms → Viruses → Predicted Viral | 1144 | Open in IMG/M |
| 3300009151|Ga0114962_10280566 | Not Available | 937 | Open in IMG/M |
| 3300009151|Ga0114962_10289261 | Not Available | 919 | Open in IMG/M |
| 3300009151|Ga0114962_10619408 | Not Available | 560 | Open in IMG/M |
| 3300009154|Ga0114963_10168398 | All Organisms → Viruses → Predicted Viral | 1287 | Open in IMG/M |
| 3300009154|Ga0114963_10176975 | All Organisms → Viruses → Predicted Viral | 1248 | Open in IMG/M |
| 3300009155|Ga0114968_10118696 | All Organisms → Viruses → Predicted Viral | 1598 | Open in IMG/M |
| 3300009155|Ga0114968_10265355 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum | 971 | Open in IMG/M |
| 3300009155|Ga0114968_10356117 | Not Available | 807 | Open in IMG/M |
| 3300009155|Ga0114968_10466273 | Not Available | 682 | Open in IMG/M |
| 3300009158|Ga0114977_10117830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1602 | Open in IMG/M |
| 3300009158|Ga0114977_10319863 | Not Available | 880 | Open in IMG/M |
| 3300009159|Ga0114978_10012388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6522 | Open in IMG/M |
| 3300009161|Ga0114966_10398392 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum | 806 | Open in IMG/M |
| 3300009161|Ga0114966_10509740 | Not Available | 684 | Open in IMG/M |
| 3300009161|Ga0114966_10752765 | Not Available | 529 | Open in IMG/M |
| 3300009164|Ga0114975_10426470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
| 3300009180|Ga0114979_10490358 | Not Available | 711 | Open in IMG/M |
| 3300009180|Ga0114979_10634280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Lacticaseibacillus → Lacticaseibacillus mingshuiensis | 609 | Open in IMG/M |
| 3300009180|Ga0114979_10652620 | Not Available | 598 | Open in IMG/M |
| 3300009181|Ga0114969_10327192 | Not Available | 897 | Open in IMG/M |
| 3300009181|Ga0114969_10372110 | Not Available | 825 | Open in IMG/M |
| 3300009181|Ga0114969_10391132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
| 3300009182|Ga0114959_10506096 | Not Available | 582 | Open in IMG/M |
| 3300009183|Ga0114974_10058494 | All Organisms → Viruses → Predicted Viral | 2561 | Open in IMG/M |
| 3300009183|Ga0114974_10285992 | Not Available | 974 | Open in IMG/M |
| 3300009183|Ga0114974_10403941 | Not Available | 781 | Open in IMG/M |
| 3300009184|Ga0114976_10127025 | All Organisms → Viruses → Predicted Viral | 1441 | Open in IMG/M |
| 3300009187|Ga0114972_10516199 | Not Available | 675 | Open in IMG/M |
| 3300009684|Ga0114958_10063143 | All Organisms → Viruses → Predicted Viral | 1962 | Open in IMG/M |
| 3300009684|Ga0114958_10142677 | All Organisms → Viruses → Predicted Viral | 1216 | Open in IMG/M |
| 3300010157|Ga0114964_10001403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 17576 | Open in IMG/M |
| 3300010157|Ga0114964_10053157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2114 | Open in IMG/M |
| 3300010157|Ga0114964_10294704 | Not Available | 769 | Open in IMG/M |
| 3300010158|Ga0114960_10249704 | Not Available | 906 | Open in IMG/M |
| 3300010334|Ga0136644_10014759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5363 | Open in IMG/M |
| 3300010334|Ga0136644_10231101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1093 | Open in IMG/M |
| 3300010334|Ga0136644_10392759 | Not Available | 788 | Open in IMG/M |
| 3300010334|Ga0136644_10500640 | Not Available | 678 | Open in IMG/M |
| 3300010885|Ga0133913_10781313 | Not Available | 2490 | Open in IMG/M |
| 3300010885|Ga0133913_11307402 | All Organisms → cellular organisms → Bacteria | 1851 | Open in IMG/M |
| 3300011010|Ga0139557_1072388 | Not Available | 575 | Open in IMG/M |
| 3300012012|Ga0153799_1001597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6505 | Open in IMG/M |
| 3300012663|Ga0157203_1004918 | All Organisms → Viruses → Predicted Viral | 2604 | Open in IMG/M |
| 3300012665|Ga0157210_1009512 | All Organisms → Viruses → Predicted Viral | 1748 | Open in IMG/M |
| 3300013004|Ga0164293_10156465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1688 | Open in IMG/M |
| 3300013004|Ga0164293_10192662 | All Organisms → Viruses → Predicted Viral | 1479 | Open in IMG/M |
| 3300013014|Ga0164295_10142417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1781 | Open in IMG/M |
| 3300013286|Ga0136641_1123214 | Not Available | 711 | Open in IMG/M |
| 3300013372|Ga0177922_10030340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 830 | Open in IMG/M |
| 3300013372|Ga0177922_10208060 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1345 | Open in IMG/M |
| 3300013372|Ga0177922_10558722 | All Organisms → Viruses → Predicted Viral | 1065 | Open in IMG/M |
| 3300013372|Ga0177922_10651324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
| 3300017701|Ga0181364_1019438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1120 | Open in IMG/M |
| 3300017722|Ga0181347_1080843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 948 | Open in IMG/M |
| 3300017723|Ga0181362_1106366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Lacticaseibacillus → Lacticaseibacillus mingshuiensis | 555 | Open in IMG/M |
| 3300017736|Ga0181365_1003994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3584 | Open in IMG/M |
| 3300017761|Ga0181356_1142818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
| 3300017761|Ga0181356_1211278 | Not Available | 569 | Open in IMG/M |
| 3300017766|Ga0181343_1097352 | Not Available | 837 | Open in IMG/M |
| 3300017777|Ga0181357_1100423 | All Organisms → Viruses → Predicted Viral | 1097 | Open in IMG/M |
| 3300017777|Ga0181357_1103175 | All Organisms → Viruses → Predicted Viral | 1079 | Open in IMG/M |
| 3300017777|Ga0181357_1177876 | Not Available | 770 | Open in IMG/M |
| 3300017778|Ga0181349_1217245 | Not Available | 653 | Open in IMG/M |
| 3300019784|Ga0181359_1033326 | All Organisms → Viruses → Predicted Viral | 1993 | Open in IMG/M |
| 3300019784|Ga0181359_1063929 | All Organisms → Viruses → Predicted Viral | 1404 | Open in IMG/M |
| 3300019784|Ga0181359_1087804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1157 | Open in IMG/M |
| 3300019784|Ga0181359_1099016 | Not Available | 1071 | Open in IMG/M |
| 3300019784|Ga0181359_1205956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
| 3300020151|Ga0211736_10687061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 653 | Open in IMG/M |
| 3300020151|Ga0211736_10980925 | All Organisms → Viruses → Predicted Viral | 2776 | Open in IMG/M |
| 3300020159|Ga0211734_10045047 | All Organisms → Viruses → Predicted Viral | 4428 | Open in IMG/M |
| 3300020159|Ga0211734_10808968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 734 | Open in IMG/M |
| 3300020160|Ga0211733_10161093 | All Organisms → Viruses → Predicted Viral | 3947 | Open in IMG/M |
| 3300020161|Ga0211726_10028423 | Not Available | 608 | Open in IMG/M |
| 3300020161|Ga0211726_10516543 | All Organisms → Viruses → Predicted Viral | 1350 | Open in IMG/M |
| 3300020161|Ga0211726_10597182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1316 | Open in IMG/M |
| 3300020161|Ga0211726_10658011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
| 3300020161|Ga0211726_10775207 | Not Available | 1571 | Open in IMG/M |
| 3300020161|Ga0211726_11026812 | Not Available | 799 | Open in IMG/M |
| 3300020172|Ga0211729_10171675 | All Organisms → Viruses → Predicted Viral | 3443 | Open in IMG/M |
| 3300020172|Ga0211729_10475859 | Not Available | 830 | Open in IMG/M |
| 3300020205|Ga0211731_10161698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2044 | Open in IMG/M |
| 3300020205|Ga0211731_10650205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 948 | Open in IMG/M |
| 3300020205|Ga0211731_10949408 | Not Available | 893 | Open in IMG/M |
| 3300021963|Ga0222712_10769346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
| 3300022190|Ga0181354_1209926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
| 3300022190|Ga0181354_1227922 | Not Available | 542 | Open in IMG/M |
| 3300022407|Ga0181351_1247628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300023174|Ga0214921_10194755 | All Organisms → Viruses → Predicted Viral | 1278 | Open in IMG/M |
| 3300023174|Ga0214921_10273917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 966 | Open in IMG/M |
| 3300023179|Ga0214923_10000959 | Not Available | 42222 | Open in IMG/M |
| 3300023179|Ga0214923_10594403 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum | 525 | Open in IMG/M |
| 3300023184|Ga0214919_10028530 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5905 | Open in IMG/M |
| 3300027586|Ga0208966_1122133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
| 3300027608|Ga0208974_1018692 | All Organisms → Viruses → Predicted Viral | 2172 | Open in IMG/M |
| 3300027659|Ga0208975_1034875 | All Organisms → cellular organisms → Bacteria | 1591 | Open in IMG/M |
| 3300027659|Ga0208975_1057930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1177 | Open in IMG/M |
| 3300027659|Ga0208975_1109656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
| 3300027712|Ga0209499_1094861 | Not Available | 1141 | Open in IMG/M |
| 3300027732|Ga0209442_1177886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
| 3300027733|Ga0209297_1186580 | Not Available | 831 | Open in IMG/M |
| 3300027733|Ga0209297_1351822 | Not Available | 533 | Open in IMG/M |
| 3300027734|Ga0209087_1046120 | All Organisms → Viruses → Predicted Viral | 2011 | Open in IMG/M |
| 3300027736|Ga0209190_1006375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7447 | Open in IMG/M |
| 3300027736|Ga0209190_1199187 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 827 | Open in IMG/M |
| 3300027741|Ga0209085_1001349 | Not Available | 15285 | Open in IMG/M |
| 3300027741|Ga0209085_1300666 | Not Available | 611 | Open in IMG/M |
| 3300027744|Ga0209355_1080555 | All Organisms → Viruses → Predicted Viral | 1508 | Open in IMG/M |
| 3300027744|Ga0209355_1280810 | Not Available | 640 | Open in IMG/M |
| 3300027747|Ga0209189_1114762 | Not Available | 1188 | Open in IMG/M |
| 3300027747|Ga0209189_1159271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 959 | Open in IMG/M |
| 3300027759|Ga0209296_1004295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9414 | Open in IMG/M |
| 3300027759|Ga0209296_1223094 | Not Available | 792 | Open in IMG/M |
| 3300027759|Ga0209296_1314049 | Not Available | 618 | Open in IMG/M |
| 3300027759|Ga0209296_1325909 | Not Available | 600 | Open in IMG/M |
| 3300027770|Ga0209086_10397571 | Not Available | 554 | Open in IMG/M |
| 3300027770|Ga0209086_10443558 | Not Available | 509 | Open in IMG/M |
| 3300027772|Ga0209768_10339154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
| 3300027777|Ga0209829_10030938 | All Organisms → Viruses → Predicted Viral | 3018 | Open in IMG/M |
| 3300027777|Ga0209829_10232605 | Not Available | 785 | Open in IMG/M |
| 3300027777|Ga0209829_10429785 | Not Available | 505 | Open in IMG/M |
| 3300027782|Ga0209500_10014145 | All Organisms → Viruses → Predicted Viral | 4814 | Open in IMG/M |
| 3300027836|Ga0209230_10187484 | All Organisms → Viruses → Predicted Viral | 1187 | Open in IMG/M |
| 3300027892|Ga0209550_10157618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1608 | Open in IMG/M |
| 3300027892|Ga0209550_10501590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
| 3300027963|Ga0209400_1068183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1760 | Open in IMG/M |
| 3300027963|Ga0209400_1135392 | All Organisms → Viruses → Predicted Viral | 1093 | Open in IMG/M |
| 3300027963|Ga0209400_1200673 | Not Available | 826 | Open in IMG/M |
| 3300027963|Ga0209400_1221648 | Not Available | 769 | Open in IMG/M |
| 3300027971|Ga0209401_1010018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5308 | Open in IMG/M |
| 3300027971|Ga0209401_1144470 | Not Available | 934 | Open in IMG/M |
| 3300027971|Ga0209401_1298218 | Not Available | 560 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1021434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4641 | Open in IMG/M |
| 3300028392|Ga0304729_1000429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31510 | Open in IMG/M |
| (restricted) 3300028581|Ga0247840_10187814 | Not Available | 1182 | Open in IMG/M |
| 3300031758|Ga0315907_10116159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2286 | Open in IMG/M |
| 3300031787|Ga0315900_10140118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2260 | Open in IMG/M |
| 3300031857|Ga0315909_10257802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1334 | Open in IMG/M |
| 3300031857|Ga0315909_10316261 | Not Available | 1159 | Open in IMG/M |
| 3300031857|Ga0315909_10756157 | Not Available | 622 | Open in IMG/M |
| 3300032050|Ga0315906_11353505 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300032092|Ga0315905_10253808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1706 | Open in IMG/M |
| 3300032092|Ga0315905_11224713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
| 3300032116|Ga0315903_10352471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1219 | Open in IMG/M |
| 3300034062|Ga0334995_0086609 | All Organisms → Viruses → Predicted Viral | 2418 | Open in IMG/M |
| 3300034092|Ga0335010_0173199 | All Organisms → Viruses → Predicted Viral | 1345 | Open in IMG/M |
| 3300034102|Ga0335029_0175686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1444 | Open in IMG/M |
| 3300034105|Ga0335035_0605531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300034118|Ga0335053_0410922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
| 3300034283|Ga0335007_0515925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 39.18% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 14.43% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.34% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 10.31% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.25% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.64% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.58% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.55% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.55% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.03% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.03% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.03% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.52% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.52% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.52% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.52% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007625 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GOS2236_10857803 | 3300001968 | Marine | VNQAELIEDFIKQYGHLLPDPQHCPKEFEYYVILYKYFKGLL* |
| GOS2236_10912712 | 3300001968 | Marine | MTVEEQIKEFLKMYGDRLPNPEHCPKEFEYYVRLYKYCKGLL* |
| B570J40625_1010743313 | 3300002835 | Freshwater | MTVEEQIEEFLKMYGDRLPNPEHCPREFEYYVKLYKYYKGLL* |
| B570J40625_1013576351 | 3300002835 | Freshwater | MTVEEQIEEFLKMYGDRLPNPEHCPKEFEYYVKLYKYYKGLL*NE |
| JGI25908J49247_100449224 | 3300003277 | Freshwater Lake | MNEQIEEFLEMYGDRLPNPEHCPREFEYYVKLYKYIKGLE* |
| JGI25908J49247_100698722 | 3300003277 | Freshwater Lake | MTVEEQIEEFLKMYGDRLPNPEHCPIEFEYYVKLYNYCKGLL* |
| JGI25911J50253_101798652 | 3300003411 | Freshwater Lake | MNEQIEEFLEMYGDRLPNPEHCPKEFEYYVKLYKYIKGL* |
| Ga0049083_100629322 | 3300005580 | Freshwater Lentic | MNEQIEEFLKMYGDRLPNPEHCPREFEYYVKLYKYIKGLE* |
| Ga0049083_102224264 | 3300005580 | Freshwater Lentic | MTVEEQIEEFLKMYGDRLPNPEHCPIEFAYYVKLYNYCKGLL* |
| Ga0049081_100733155 | 3300005581 | Freshwater Lentic | MSVEEQIEEFIKMYGDRLPNPEHCPKEFEYYVRLYKYCKGLL* |
| Ga0049081_100966171 | 3300005581 | Freshwater Lentic | MTADDHVKEFLRMYGDRLPNPENCPREFEYYVRLYKYYRGLL* |
| Ga0049081_101024263 | 3300005581 | Freshwater Lentic | MTVDEQIEEFLKMYGDRLPNPEHCPKEFEYYVKLYKYVKGLE* |
| Ga0049081_101125471 | 3300005581 | Freshwater Lentic | MTVEEQIEEFLKMYGDRLPNPEHCPKEFEYYVKLYKYFKGLE* |
| Ga0049081_102734822 | 3300005581 | Freshwater Lentic | MNEQMKEFLEMYGDRLPNPEHCPKEFEYYVRLYKYIKGL* |
| Ga0049081_102823951 | 3300005581 | Freshwater Lentic | MTVDEQIEEFLKMYGDRLPNPENCPKEFEYYVRLYKYVKGL* |
| Ga0049081_102845712 | 3300005581 | Freshwater Lentic | VEEQIEEFLKMYGDRLPNPEHCPIEFEYYVRLYKYVKGLE* |
| Ga0049081_103441932 | 3300005581 | Freshwater Lentic | MTVEEQIEEFLEMYGDRLPNPDHCPKEFAYYVLLYKYSKGLL* |
| Ga0049080_100567012 | 3300005582 | Freshwater Lentic | MTADDHVKEFLRMYGDRLPNPENCPREFEYYVKLYKYYRGLL* |
| Ga0049080_102009541 | 3300005582 | Freshwater Lentic | MSVEEQIEEFLKMYGDRLPNPEHCPKEFEYYVRLYKYCK |
| Ga0049080_102299402 | 3300005582 | Freshwater Lentic | MNEQIEEFLEMYGDRLPNPEHCPKEFEYYVKLYKYIKRLE* |
| Ga0049080_102337882 | 3300005582 | Freshwater Lentic | MTVDEQIEEFLKMYGDRLPNPEHCPREFEYYVRLYKYVKGLE* |
| Ga0049082_100797923 | 3300005584 | Freshwater Lentic | QIEEFLKMYGDRLPNPEHCPIEFAYYVKLYNYCKGLL* |
| Ga0079957_10222534 | 3300005805 | Lake | MSVEEQIEEFLKMYGDRLPNPEHCPKEFEYYVRLYKYCKGLL* |
| Ga0079957_10710252 | 3300005805 | Lake | VTVEEQIEEFLKMYGDRLPNPEHCPKEFEYFVKLYKYCKGLL* |
| Ga0079957_13553342 | 3300005805 | Lake | VTIDEQIKEFLKMYGDRLPNPEHCPKEFEYYVTLYKFVKGLL* |
| Ga0070744_101891022 | 3300006484 | Estuarine | MTADDHVKEFLRMYGDRLPNPENCPREFEYYVKLYKYYKGLL* |
| Ga0102877_11286562 | 3300007548 | Estuarine | MNEQIEEFLKMYGDRLPNPEHCPKEFEYYVKLYKYIKGLG* |
| Ga0102870_11991142 | 3300007625 | Estuarine | MNEQIKEFLEMYGDRLPNPEHCPKEYEYYVKLYKYIKGLE* |
| Ga0102865_10154394 | 3300007639 | Estuarine | MTVEEQIEEFLKMYGDRLPNPEHCPKEFEYYVRLYKYCKDLL* |
| Ga0105745_12377322 | 3300007972 | Estuary Water | MTVEEQIEEFLKMYGDRLPNPEHCPKEFEYYVRLYKYCKGLL* |
| Ga0114340_10241176 | 3300008107 | Freshwater, Plankton | MTVDEQIEEFLEMYGDRLPNPEHCPKEFAYYVMLYKYSKGLL* |
| Ga0114343_10398459 | 3300008110 | Freshwater, Plankton | MTVDEQIEEFLEMYGDRLPNPEHCPKEFAYFVMLYKYSKGLL* |
| Ga0114346_12419472 | 3300008113 | Freshwater, Plankton | MNEQMKEFLEMYGDRLPNPEHCPKEFEYYVKLYKYIKGLE* |
| Ga0114841_11900884 | 3300008259 | Freshwater, Plankton | TVDEQIEEFLEMYGDRLPNPEHCPKEFAYYVMLYKYSKGLL* |
| Ga0114364_10684913 | 3300008267 | Freshwater, Plankton | MNEQIEEFLKMYGDRLPNPEHCPKEFEYYVKLYKYIKGLE* |
| Ga0114876_10193266 | 3300008448 | Freshwater Lake | MNEQIEEFLEMYGDRLPNPEHCPKEFEYYVKLYKYIKGLE* |
| Ga0114973_100401124 | 3300009068 | Freshwater Lake | MNEQIEEFLKMYGDRLPNPEHCPKEFEYYIRLYKYIKGLE* |
| Ga0114973_100723068 | 3300009068 | Freshwater Lake | MTVDEQIKEFLEMYGDRLPNPEHCPKEFEYYVRLYKYIKGLE* |
| Ga0114973_102171802 | 3300009068 | Freshwater Lake | MTVEEQIEEFMAMYGDRLPDPEHCPREVEYYVRLYKYYKRLE* |
| Ga0114973_102206601 | 3300009068 | Freshwater Lake | MTVEEQMKEFLEMYGDRLPNPEHCPKEFEYYVKLYKYIKGLE* |
| Ga0114973_103357862 | 3300009068 | Freshwater Lake | MNEQMKEFLEMYGDRLPNPEHCPKEFEYYVRLYKYIKGLE* |
| Ga0114973_104030923 | 3300009068 | Freshwater Lake | MTVEEQMKEFLEMYGDRLPNPEHCPKEFEYYVRLYKYIKGL* |
| Ga0114962_100786263 | 3300009151 | Freshwater Lake | MTVEEQIKEFLEMYGDRLPNPEHCPREFEYYVRLYKYIKGL* |
| Ga0114962_102064593 | 3300009151 | Freshwater Lake | MTVEEQIKEFLEMYGDRLPNPEHCPKEFEYYVKLYKYIKELDVKN* |
| Ga0114962_102805663 | 3300009151 | Freshwater Lake | MTIDEQIKEFLEMYGDRLPNPEHCPKEFEYYVKLYKYIKGL* |
| Ga0114962_102892611 | 3300009151 | Freshwater Lake | MTVDEHVEEFLEMYGDRLPNPEHCPKEFEYYVKLYKYIKGLE* |
| Ga0114962_106194081 | 3300009151 | Freshwater Lake | MTVDEQIKEFLEMYGDRLPNPEHCPKEFEYYVKLYKYIKGL* |
| Ga0114963_101683986 | 3300009154 | Freshwater Lake | MTVEEQIEEFLEMYGDRLPNPEHCPREFVYYVKLYKYCKGLL* |
| Ga0114963_101769754 | 3300009154 | Freshwater Lake | MTVEEQMKEFLEMYGDRLPNPEHCPKEFEYYVRLYKYIKGLE* |
| Ga0114968_101186963 | 3300009155 | Freshwater Lake | MTVDEHVEEFLRMYGDRLPNPEHCPKEFEYYVRLYKYCKGLL* |
| Ga0114968_102653551 | 3300009155 | Freshwater Lake | MTVDEQMKEFLEMYGDRLPNPEHCPKEYEYYVKLYKYIKG |
| Ga0114968_103561172 | 3300009155 | Freshwater Lake | MSEDVIKEFLEMYGDRLPNPEHCPKEFEYYVKLYKYIKGLE* |
| Ga0114968_104662732 | 3300009155 | Freshwater Lake | MTVDEQIKEFLEMYGDRLPNPEHCPREFEYYVKLYKYIKGLE* |
| Ga0114977_101178302 | 3300009158 | Freshwater Lake | MNEQIEEFLKMYGDRLPNPEHCPREFEYYVRLYKYVKGL* |
| Ga0114977_103198633 | 3300009158 | Freshwater Lake | MTVEEQIEEFLEMYGDRLPNLDHCPKEFAYYVLLYKYSKGLL* |
| Ga0114978_1001238810 | 3300009159 | Freshwater Lake | MNEQIEEFLRMYGDRLPNPEHCPKEFEYYVKLYKYIKGLE* |
| Ga0114966_103983922 | 3300009161 | Freshwater Lake | MTVDEQMKEFLEMYGDRLPNPEHCPKEFEYYVKLYKYIKGLE* |
| Ga0114966_105097402 | 3300009161 | Freshwater Lake | MNEDNIKEFLEMYGNILPDPEHCPREFEYYVKLYKYIKGNKDENNL* |
| Ga0114966_107527653 | 3300009161 | Freshwater Lake | MTVEEQIEEFLEMYGDRLPNPEHCPKEFEYYVKLYKYIKGLE* |
| Ga0114975_104264702 | 3300009164 | Freshwater Lake | MTVDEQVKEFLKMYGDRLPNPEHCPKEFEYYVKLYKYIKGLE* |
| Ga0114979_104903582 | 3300009180 | Freshwater Lake | MTEEEQIKEFLEMYGDRLPNPEHCPKEYEYYVKLYKYIKGLE* |
| Ga0114979_106342802 | 3300009180 | Freshwater Lake | MTVEEQIEEFLKMYGDRLPNPEHCPREFEYYVKLYKYCKGLL* |
| Ga0114979_106526202 | 3300009180 | Freshwater Lake | MKTETVEEQIEEFLKMYGDRLPNPEHCPKEFEYYVRLYKYCKGLL* |
| Ga0114969_103271923 | 3300009181 | Freshwater Lake | MTVDEQIKEFLEMYGDRLPNPEHCPKEFEYYVKLYKYIKGLE* |
| Ga0114969_103721103 | 3300009181 | Freshwater Lake | VGEKMTVEEQIEEFMAMYGDRLPDPEHCPREVEYYVRLYKYYKRLE* |
| Ga0114969_103911322 | 3300009181 | Freshwater Lake | MNEQIKEFLKMYGDRLPNPEHCPKEFEYYIRLYKYIKGLE* |
| Ga0114959_105060961 | 3300009182 | Freshwater Lake | MTVEEQIKEFLEMYGDRLPNPKHCPREFEYYVKLYKYIKGL |
| Ga0114974_1005849411 | 3300009183 | Freshwater Lake | MTVEEQIEEFLEMYGDRLPNPEHCPKEFEYYVRLYKYCKGLL* |
| Ga0114974_102859923 | 3300009183 | Freshwater Lake | VEEQIEEFLEMYGDRLPNPEHCPKEFEYYVRLYKYIKGLE* |
| Ga0114974_104039413 | 3300009183 | Freshwater Lake | MTVDEQVKEFLEMYGDRLPNPEHCPKEFEYYVRLYKYIKGL* |
| Ga0114976_101270253 | 3300009184 | Freshwater Lake | MTVEEQIKEFLEMYVDRLPNPEHCPKEFEYYVRLYKYCKGLL* |
| Ga0114972_105161991 | 3300009187 | Freshwater Lake | EQIEEFIKMYGDRLPNPEHCPKEFEYYVRLYKYCKGLL* |
| Ga0114958_100631431 | 3300009684 | Freshwater Lake | MTVEEQIEEFLEMYGDRLPNPEHCPREFVYYVKLYKYC |
| Ga0114958_101426773 | 3300009684 | Freshwater Lake | MTVEEQIKEFLKMYGDRLPNPEHCPREFEYYVKLYKYIKGLE* |
| Ga0114964_1000140341 | 3300010157 | Freshwater Lake | MSVEEQIKEFLKMYGDRLPNPEHCPKEFEYYVRLYKYCKGLL* |
| Ga0114964_100531571 | 3300010157 | Freshwater Lake | LWCRWIMTVDEHVEEFLEMYGDRLPNPEHCPKEFEYYVRLYKYIKGLE* |
| Ga0114964_102947044 | 3300010157 | Freshwater Lake | MTVEEQIKEFLEMYGDRLPNPEYCPREFEYYVRLYKYIKGL* |
| Ga0114960_102497044 | 3300010158 | Freshwater Lake | MTIEEQMKEFLEMYGDRLPNPEHCPKEFEYYVRLYKYIKGLE* |
| Ga0136644_100147591 | 3300010334 | Freshwater Lake | MTVDEQIKEFLEMYGDRLPNPEHCPKEFEYYVRLYKYIKG |
| Ga0136644_102311014 | 3300010334 | Freshwater Lake | MTVEEQIEEFLEMYGDRLPNPEHCPKEFEYYVKLYKYCKGLL* |
| Ga0136644_103927592 | 3300010334 | Freshwater Lake | MTVEEQMKEFLEIYGDRLPNPEHCPKEFEYYVRLYKYIKGL* |
| Ga0136644_105006402 | 3300010334 | Freshwater Lake | MTVDEQIKEFLKMYGDRLPNPEHCPKEFEYYVKLYKYIKGLE* |
| Ga0133913_107813137 | 3300010885 | Freshwater Lake | MTIEEQIEEFLEMYGDKLPNPEHCPKEFEYYVRLYKYYKDNI* |
| Ga0133913_113074025 | 3300010885 | Freshwater Lake | MTVEEQIKEFLEMYGDRLPNPEHCPKEFEYYVKLYKYVKGLL* |
| Ga0139557_10723881 | 3300011010 | Freshwater | VMTADDHVKEFLRMYGDRLPNPENCPREFEYYVKLYKYYRGLL* |
| Ga0153799_10015978 | 3300012012 | Freshwater | MNEQMKEFLKMYGDRLPNPEHCPKEFEYYVKLYKYIKGLE* |
| Ga0157203_10049182 | 3300012663 | Freshwater | MNEQIEEFLRMYGDRLPNPEHCPREFEYYVKLYKYIKGLE* |
| Ga0157210_10095123 | 3300012665 | Freshwater | MTVDEHVEEFLRMYGDRLPNPEHCPREFEYYVKLYKYYKGLL* |
| Ga0164293_101564652 | 3300013004 | Freshwater | MSVEEQIEEFLKMYGDRLPNPEHCPKEFEYYVKLYKYCKGLL* |
| Ga0164293_101926624 | 3300013004 | Freshwater | MTVEEQIEEFLEMYGDRLPNPEHCPKEFEYFVRLYKYVKGLE* |
| Ga0164295_101424174 | 3300013014 | Freshwater | MNEQIEEFLKMYGDRLPNPEHCPREFEYYVKLYKYIKGLG* |
| Ga0136641_11232141 | 3300013286 | Freshwater | MINEQIEEFLEMYGDRLPDPEHCPKEVEYYVKLYKFIKSQEETVNEQ* |
| Ga0177922_100303403 | 3300013372 | Freshwater | MNEQIEEFLEMYGDRLPNPEHCPREFEYYVRLYKYIKGL* |
| Ga0177922_102080602 | 3300013372 | Freshwater | MTTEEQIEEFLRMYGDRLPNPEHCPREFEYYVKLYKYVKGLE* |
| Ga0177922_105587223 | 3300013372 | Freshwater | VTVEEQIEEFLKMYGDRLPNPEHCPREFEYYVKLYKYIKGLG* |
| Ga0177922_106513242 | 3300013372 | Freshwater | MNEQMKEFLKMYGDRLPNPEHCPKEFEYYVKLYKYIKGLG* |
| Ga0181364_10194382 | 3300017701 | Freshwater Lake | MNEQIEEFLEMYGDRLPNPEHCPKEFEYYVKLYNYIKGLG |
| Ga0181347_10808432 | 3300017722 | Freshwater Lake | MNEQIEEFLEMYGDRLPNPEHCPKEFEYYVKLYKYIKGL |
| Ga0181362_11063662 | 3300017723 | Freshwater Lake | VACLWCRWIMTVDEHVEEFLRMYGDRLPNPENCPREFEYYVRLYKYYRGLL |
| Ga0181365_100399412 | 3300017736 | Freshwater Lake | MTVEEQIEEFLKMYGDRLPNPEHCPIEFEYYVKLYNYCKGLL |
| Ga0181356_11428182 | 3300017761 | Freshwater Lake | MNEQMKEFLKMYGDRLPNPEHCPREFEYYVKLYKYIKGLG |
| Ga0181356_12112781 | 3300017761 | Freshwater Lake | QIEEFLKMYGDRLPNPEHCPIEFEYYVKLYNYCKGLL |
| Ga0181343_10973522 | 3300017766 | Freshwater Lake | MTVDEQIEEFLKMYGDRLPNPEHCPKEFEYYVKLYKYVKGLE |
| Ga0181357_11004232 | 3300017777 | Freshwater Lake | MTVDEHVEEFLRMYGDRLPNPENCPREFEYYVRLYKYYRGLL |
| Ga0181357_11031754 | 3300017777 | Freshwater Lake | MTTEEQIEEFLKMYGDRLPNPEHCPREFEYYVKLYKYVKG |
| Ga0181357_11778761 | 3300017777 | Freshwater Lake | EEFLKMYGDRLPNPEHCPREFEYYVKLYKYVKGLE |
| Ga0181349_12172452 | 3300017778 | Freshwater Lake | VEEQIEEFLKMYGDRLPNPEHCPIEFEYYVKLYNYCKGLL |
| Ga0181359_10333269 | 3300019784 | Freshwater Lake | MTVEEQIEEFLEMYGDRLPNPDHCPKEFAYYVMLYKYSKGLL |
| Ga0181359_10639292 | 3300019784 | Freshwater Lake | VTVEEQTEEFLKMYGDRLPNPEHCPREFEYYVKLYKHIKGLG |
| Ga0181359_10878042 | 3300019784 | Freshwater Lake | MTTEEQIEEFLKMYGDRLPNPEHCPREFEYYVKLYKYVKGLE |
| Ga0181359_10990161 | 3300019784 | Freshwater Lake | EKEFLEMYGDRLPNPEHCPKEFEYYVKLYKYIKGLG |
| Ga0181359_12059562 | 3300019784 | Freshwater Lake | MNEQIEEFLEMYGDRLPNPEHCPREFEYYVKLYKYIKGLE |
| Ga0211736_106870611 | 3300020151 | Freshwater | MTVDEHIEEFLRMYGDRLPNPEHCPREFEYYVKLYKYCKGLE |
| Ga0211736_109809256 | 3300020151 | Freshwater | MNEDAIKEFLEMYGDILPDPEHCPREFEYYVKLYKFIKGLC |
| Ga0211734_1004504712 | 3300020159 | Freshwater | MNEDAIKEFLEMYGDRLPDPEHCPREFEYYVRLYKFIKGLC |
| Ga0211734_108089683 | 3300020159 | Freshwater | MTVDEQVKEFLEMYGDRLPNPEHCPREFEYYVRLYKYVKGL |
| Ga0211733_101610935 | 3300020160 | Freshwater | MNEDAIKEFLEMYGDRLPDPEHCPREFEYYIKLYKFIKGLC |
| Ga0211726_100284232 | 3300020161 | Freshwater | VTVEEQIEEFLKMYGDRLPNPEHCPKEFEYYVKLYKYVKELE |
| Ga0211726_105165431 | 3300020161 | Freshwater | EDVIKEFLEMYGDILPDPEHCPREFEYYVKLYKFIKGLC |
| Ga0211726_105971824 | 3300020161 | Freshwater | MTVEEQVKEFLEMYGDKLPNPEHCPKEFEYYVRLYKYVKGL |
| Ga0211726_106580112 | 3300020161 | Freshwater | MTVEEQIEEFLRMYGDRLPNPEHCPREFEYYVKLYKYCKGLE |
| Ga0211726_107752071 | 3300020161 | Freshwater | MNEDAIKEFLEMYGDILPDPEHCPREFEYYVRLYK |
| Ga0211726_110268121 | 3300020161 | Freshwater | NKVKYCIIDMTVDEQIEEFLKMYGDRLPNPEHCPKEFEYYVKLYKYCKGLL |
| Ga0211729_1017167511 | 3300020172 | Freshwater | MNEDAIKEFLEMYGDRLPDPEHCPREFEYYVKLYKFIKGLC |
| Ga0211729_104758592 | 3300020172 | Freshwater | MTVEEQIEEFLRMYGDRLPNPENCPREFEYYVKLYKYYKGLL |
| Ga0211731_101616985 | 3300020205 | Freshwater | MTVDDQVKEFLEMYGDRLPNPEHCPREFEYYVRLYKYIKGL |
| Ga0211731_106502053 | 3300020205 | Freshwater | VTVEEQIEEFLEMYGDRLPNPEHCPKEFEYYVKLYK |
| Ga0211731_109494084 | 3300020205 | Freshwater | MTVEEQIEEFLKMYGDRLPNPEHCPKEFEYYVKLYKYCKGLL |
| Ga0222712_107693461 | 3300021963 | Estuarine Water | MNEQIEEFLEMYGDRLPNPEHCPKEFEYYVKLYKYIKGLE |
| Ga0181354_12099262 | 3300022190 | Freshwater Lake | VTVEEQIEEFLKMYGDRLPNPEHCPREFEYYVKLYKYIKGLG |
| Ga0181354_12279223 | 3300022190 | Freshwater Lake | ANRMTTEEQIEEFLKMYGDRLPNPEHCPREFEYYVKLYKYVKGLE |
| Ga0181351_12476282 | 3300022407 | Freshwater Lake | VTVEEQIEEFLKMYGDRLPNPEHCPREFEYYVKLYKHIKGLG |
| Ga0214921_101947553 | 3300023174 | Freshwater | MTVEEQIKEFLEMYGDRLPNPEHCPKEFEYYVRLYKYIKGLE |
| Ga0214921_102739175 | 3300023174 | Freshwater | MTVEEQIEEFLQMYGDRLPNPEHCPKEFAYYVMLYKHVKGLL |
| Ga0214923_1000095919 | 3300023179 | Freshwater | MSEDVIKEFLEMYGDRLPNPEHCPKEFEYYVKLYKYIKGLE |
| Ga0214923_105944031 | 3300023179 | Freshwater | MTNEEQMKEFLEMYGDRLPNPEHCPREFEYYVKLYKYIKGLE |
| Ga0214919_1002853012 | 3300023184 | Freshwater | VTVEEQIEEFLKMYGDRLPNPEHCPKEFEYFVKLYKYCKSLL |
| Ga0208966_11221331 | 3300027586 | Freshwater Lentic | MNEQIEEFLEMYGDRLPNPEHCPKEFEYYVKLYKYIKGLG |
| Ga0208974_10186926 | 3300027608 | Freshwater Lentic | EQIEEFLKMYGDRLPNPEHCPKEFEYYVKLYKYIKGLE |
| Ga0208975_10348752 | 3300027659 | Freshwater Lentic | MSVEEQIEEFLKMYGDRLPNPEHCPKEFEYYVRLYKYCKGLL |
| Ga0208975_10579302 | 3300027659 | Freshwater Lentic | MTVEEQIEEFLKMYGDRLPNPEHCPIEFEYYVRLYKYVKGLE |
| Ga0208975_11096562 | 3300027659 | Freshwater Lentic | MTVEEQIEEFLKMYGDRLPNPEHCPKEFEYYVKLYKYFKGLE |
| Ga0209499_10948611 | 3300027712 | Freshwater Lake | MTVEEQIKEFLEMYGDRLPNPEHCPKEFEYYVRLYKYCKGLL |
| Ga0209442_11778861 | 3300027732 | Freshwater Lake | MNEQMKEFLEMYGDRLPNPEHCPKEFEYYVKLYKYIKGLG |
| Ga0209297_11865802 | 3300027733 | Freshwater Lake | MSVEEQIEEFLKMYGDRLPNPEHCPKEFEYYVRLYKYVKGL |
| Ga0209297_13518222 | 3300027733 | Freshwater Lake | MTVEEQIKEFLEMYGDRLPNPEHCPKEFEYYVKLYKYVKGLL |
| Ga0209087_10461204 | 3300027734 | Freshwater Lake | MTVDEQVKEFLKMYGDRLPNPEHCPKEFEYYVKLYKYIKGLE |
| Ga0209190_10063753 | 3300027736 | Freshwater Lake | MNEQMKEFLEMYGDRLPNPEHCPKEFEYYVRLYKYIKGLE |
| Ga0209190_11991872 | 3300027736 | Freshwater Lake | MTVEEQIEEFMAMYGDRLPDPEHCPREVEYYVRLYKYYKRLE |
| Ga0209085_100134925 | 3300027741 | Freshwater Lake | MTVDEQIKEFLKMYGDRLPNPEHCPKEFEYYVKLYKYIKGLE |
| Ga0209085_13006661 | 3300027741 | Freshwater Lake | MTVDEQIKEFLEMYGDRLPNPEHCPKEFEYYVRLYKYIKGLE |
| Ga0209355_10805553 | 3300027744 | Freshwater Lake | VTVEEQTEEFLKMYGDRLPNPEHCPREFEYYVKLYKYIKGLG |
| Ga0209355_12808103 | 3300027744 | Freshwater Lake | MTVEEQIEEFLKMYGDRLPNPEHCPKEFEYYVKLYKYIIGLG |
| Ga0209189_11147625 | 3300027747 | Freshwater Lake | MTVEEQIKEFLEMYGDRLPNPEHCPREFEYYVRLYKYIKGL |
| Ga0209189_11592713 | 3300027747 | Freshwater Lake | MTVEEQIEEFLEMYGDRLPNPEHCPKEFEYYVKLYKYCKGLL |
| Ga0209296_100429528 | 3300027759 | Freshwater Lake | MTVEEQIEEFLEIYGDRLPNPDHCPKEFAYYVLLYKYSKGLL |
| Ga0209296_12230942 | 3300027759 | Freshwater Lake | MTVDEQVKEFLEMYGDRLPNPEHCPKEFEYYVRLYKYIKGL |
| Ga0209296_13140491 | 3300027759 | Freshwater Lake | MSVEEQIEEFIKMYGDRLPNPEHCPKEFEYYVRLYKY |
| Ga0209296_13259093 | 3300027759 | Freshwater Lake | MTVDEQIKEFLEMYGDRLPNPEHCPKEFEYYVKLYKYIKGL |
| Ga0209086_103975712 | 3300027770 | Freshwater Lake | MNEDNIKEFLEMYGNILPDPEHCPREFEYYVKLYKYIKGNKDENNL |
| Ga0209086_104435582 | 3300027770 | Freshwater Lake | VTVEEQIEEFMAMYGDRLPDPEHCPREVEYYVRLYKYYKRLE |
| Ga0209768_103391541 | 3300027772 | Freshwater Lake | VTVEEQIEEFLKMYGDRLPNPEHCPREFEYYVKLYKYIK |
| Ga0209829_100309386 | 3300027777 | Freshwater Lake | MSVEEQIKEFLKMYGDRLPNPEHCPKEFEYYVRLYKYCKGLL |
| Ga0209829_102326053 | 3300027777 | Freshwater Lake | MTVEEQMKEFLEMYGDRLPNPEHCPKEFEYYVRLYKYIKGLE |
| Ga0209829_104297852 | 3300027777 | Freshwater Lake | MTVEEQIEEFIKMYGDRLPNPEHCPKEFEYYVRLYKYCKGLL |
| Ga0209500_100141453 | 3300027782 | Freshwater Lake | MNEQIEEFLRMYGDRLPNPEHCPKEFEYYVKLYKYIKGLE |
| Ga0209230_101874841 | 3300027836 | Freshwater And Sediment | MTVDEHVEEFLRMYGDRLPNPEHCPREFEYYVKLYKYYKGLL |
| Ga0209550_101576181 | 3300027892 | Freshwater Lake | MTVEEQIEEFLKMYGDRLPNPEHCPIEFAYYVKLYNY |
| Ga0209550_105015901 | 3300027892 | Freshwater Lake | VTVEEQTEEFLKMYGDRLPNPEHCPREFEYYIKLYKHI |
| Ga0209400_10681832 | 3300027963 | Freshwater Lake | MNEQIEEFLRMYGDRLPNPEHCPKEFEYYVKLYKYIKGLEXE |
| Ga0209400_11353923 | 3300027963 | Freshwater Lake | MTVDEHVEEFLRMYGDRLPNPEHCPKEFEYYVRLYKYCKGLL |
| Ga0209400_12006732 | 3300027963 | Freshwater Lake | MTVDEQIKEFLEMYGDRLPNPEHCPREFEYYVKLYKYIKGLE |
| Ga0209400_12216483 | 3300027963 | Freshwater Lake | MSEDVIKEFLEMYGDRLPNPEHCPKEFEYYVKLYKYIKGLEXK |
| Ga0209401_101001811 | 3300027971 | Freshwater Lake | MNEQIEEFLKMYGDRLPNPEHCPKEFEYYIRLYKYIKGLE |
| Ga0209401_11444701 | 3300027971 | Freshwater Lake | MTVEEQMKEFLEMYGDRLPNPEHCPKEFEYYVRLYKYIKGL |
| Ga0209401_12982183 | 3300027971 | Freshwater Lake | MTVEEQMKEFLEMYGDRLPNPEHCPKEFEYYVKLYKYIKGLE |
| (restricted) Ga0247834_10214345 | 3300027977 | Freshwater | MTVEEQIKEFLEMYGDRLPNPEHCPIEFAYYVKLYNYCKGLL |
| Ga0304729_100042939 | 3300028392 | Freshwater Lake | MTVEEQIKEFLEMYGDRLPNPEHCPKEFEYYVKLYKYIKELDVKN |
| (restricted) Ga0247840_101878141 | 3300028581 | Freshwater | IKEFLEMYGDRLPNPEHCPIEFAYYVKLYNYCKGLL |
| Ga0315907_101161595 | 3300031758 | Freshwater | MTVDEQIEEFLEMYGDRLPNPEHCPKEFAYFVMLYKYSKGLL |
| Ga0315900_101401189 | 3300031787 | Freshwater | MTVDEQIEEFLEMYGDRLPNPEHCPKEFAYYVMLYKYSKGLL |
| Ga0315909_102578023 | 3300031857 | Freshwater | MTVEEQIEEFLKMYGDRLPNPEHCPKEFEYYVRLYKYVKELE |
| Ga0315909_103162612 | 3300031857 | Freshwater | MTVEEQIEEFLEIYGDRLPNPDHCPKEFAYYVLLYKYSKSLL |
| Ga0315909_107561572 | 3300031857 | Freshwater | MTVDEHVEEFLRIYGDRLPNPEHCPKEFEYYVKLYKYYKGLL |
| Ga0315906_113535051 | 3300032050 | Freshwater | MNEQIEEFLKMYGDRLPNPEHCPKEFEYYVRLYKYIKGL |
| Ga0315905_102538082 | 3300032092 | Freshwater | MTVEEQIEEFLKMYGDRLPNPEHCPIEFAYYVKLYNYCKGLL |
| Ga0315905_112247132 | 3300032092 | Freshwater | MNEQIEEFLKMYGDRLPNPEHCPREFEYYVKLYKYIKGLE |
| Ga0315903_103524712 | 3300032116 | Freshwater | MNEQMKEFLEMYGDRLPNPEHCPREFEYYVKLYKYIKGLG |
| Ga0334995_0086609_270_398 | 3300034062 | Freshwater | MTVEEQIEEFLKMYGDRLPNPEHCPKEFEYYVKLYKYYKGLL |
| Ga0335010_0173199_125_253 | 3300034092 | Freshwater | MTADEHVEEFLRMYGDRLPNPEHCPREFEYYVKLYKYYKGLL |
| Ga0335029_0175686_935_1063 | 3300034102 | Freshwater | MTVEEQIEEFLRMYGDRLPNPEHCPREFEYYVKLYKYYKGLL |
| Ga0335035_0605531_353_481 | 3300034105 | Freshwater | MSVEEQIEDFLKMYGDRLPNPEHCPKEFEYYVRLYKYCKGLL |
| Ga0335053_0410922_690_818 | 3300034118 | Freshwater | MTVEEQIEEFLKMYGDRLPNPEHCPKEFEYFVRLYKYVKGLE |
| Ga0335007_0515925_200_328 | 3300034283 | Freshwater | MTVEEQIEEFLEMYGDRLPNPEHCPKEFEYYVRLYKYVKGLE |
| ⦗Top⦘ |