| Basic Information | |
|---|---|
| Family ID | F027477 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 194 |
| Average Sequence Length | 47 residues |
| Representative Sequence | WAPLADLKVGPDAAPIPDDIATRLREIERTAAWATPKLELATP |
| Number of Associated Samples | 155 |
| Number of Associated Scaffolds | 194 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.48 % |
| % of genes from short scaffolds (< 2000 bps) | 91.75 % |
| Associated GOLD sequencing projects | 142 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.485 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil (19.072 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.876 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.155 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.17% β-sheet: 0.00% Coil/Unstructured: 71.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 194 Family Scaffolds |
|---|---|---|
| PF02511 | Thy1 | 86.60 |
| PF07478 | Dala_Dala_lig_C | 10.31 |
| PF13535 | ATP-grasp_4 | 1.03 |
| PF01106 | NifU | 0.52 |
| PF04055 | Radical_SAM | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 194 Family Scaffolds |
|---|---|---|---|
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 86.60 |
| COG0694 | Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.48 % |
| Unclassified | root | N/A | 0.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002908|JGI25382J43887_10136766 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300002912|JGI25386J43895_10099939 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300002914|JGI25617J43924_10215216 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300002914|JGI25617J43924_10256522 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005175|Ga0066673_10500784 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300005180|Ga0066685_10068499 | All Organisms → cellular organisms → Bacteria | 2320 | Open in IMG/M |
| 3300005181|Ga0066678_10042858 | All Organisms → cellular organisms → Bacteria | 2540 | Open in IMG/M |
| 3300005406|Ga0070703_10246468 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300005434|Ga0070709_10473784 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300005440|Ga0070705_100106798 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
| 3300005450|Ga0066682_10127992 | All Organisms → cellular organisms → Bacteria | 1609 | Open in IMG/M |
| 3300005451|Ga0066681_10126529 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
| 3300005451|Ga0066681_10471129 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300005467|Ga0070706_101191340 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300005540|Ga0066697_10086742 | All Organisms → cellular organisms → Bacteria | 1811 | Open in IMG/M |
| 3300005549|Ga0070704_100015864 | All Organisms → cellular organisms → Bacteria | 4744 | Open in IMG/M |
| 3300005554|Ga0066661_10852097 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005556|Ga0066707_10044793 | All Organisms → cellular organisms → Bacteria | 2536 | Open in IMG/M |
| 3300005556|Ga0066707_10277273 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300005557|Ga0066704_10858089 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300005558|Ga0066698_11030866 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005560|Ga0066670_10331914 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300005569|Ga0066705_10572411 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300005586|Ga0066691_10517638 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300005598|Ga0066706_10127462 | All Organisms → cellular organisms → Bacteria | 1887 | Open in IMG/M |
| 3300005598|Ga0066706_10820641 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300005883|Ga0075299_1042013 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 523 | Open in IMG/M |
| 3300006031|Ga0066651_10437118 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300006031|Ga0066651_10489226 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300006034|Ga0066656_10064155 | All Organisms → cellular organisms → Bacteria | 2153 | Open in IMG/M |
| 3300006755|Ga0079222_10356404 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300006797|Ga0066659_10028803 | All Organisms → cellular organisms → Bacteria | 3293 | Open in IMG/M |
| 3300006797|Ga0066659_11674243 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300006806|Ga0079220_10097638 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
| 3300006844|Ga0075428_101331868 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300006845|Ga0075421_100541504 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
| 3300006846|Ga0075430_100846655 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300006847|Ga0075431_100795969 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300006903|Ga0075426_10848798 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300006914|Ga0075436_100291602 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300007004|Ga0079218_10370385 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
| 3300007258|Ga0099793_10672417 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300007265|Ga0099794_10068756 | All Organisms → cellular organisms → Bacteria | 1732 | Open in IMG/M |
| 3300009038|Ga0099829_10162256 | All Organisms → cellular organisms → Bacteria | 1791 | Open in IMG/M |
| 3300009088|Ga0099830_10059737 | All Organisms → cellular organisms → Bacteria | 2724 | Open in IMG/M |
| 3300009100|Ga0075418_10684499 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300009137|Ga0066709_100720054 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300009147|Ga0114129_11693897 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300010140|Ga0127456_1004924 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300010142|Ga0127483_1094870 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300010301|Ga0134070_10020075 | All Organisms → cellular organisms → Bacteria | 2169 | Open in IMG/M |
| 3300010304|Ga0134088_10069464 | All Organisms → cellular organisms → Bacteria | 1636 | Open in IMG/M |
| 3300010304|Ga0134088_10700410 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300010322|Ga0134084_10002668 | All Organisms → cellular organisms → Bacteria | 3938 | Open in IMG/M |
| 3300010322|Ga0134084_10018164 | All Organisms → cellular organisms → Bacteria | 1859 | Open in IMG/M |
| 3300010322|Ga0134084_10129346 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300010322|Ga0134084_10409914 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 531 | Open in IMG/M |
| 3300010323|Ga0134086_10036976 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
| 3300010323|Ga0134086_10177507 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300010323|Ga0134086_10203537 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300010323|Ga0134086_10285746 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300010325|Ga0134064_10046079 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300010326|Ga0134065_10189511 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300010336|Ga0134071_10105859 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300010337|Ga0134062_10194134 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300010359|Ga0126376_10038330 | All Organisms → cellular organisms → Bacteria | 3308 | Open in IMG/M |
| 3300010360|Ga0126372_11264022 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300010399|Ga0134127_11444047 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300010399|Ga0134127_11728269 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300010400|Ga0134122_12236930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300010403|Ga0134123_12251574 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300011270|Ga0137391_10290191 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
| 3300011429|Ga0137455_1074757 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300012198|Ga0137364_10955541 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300012200|Ga0137382_10163274 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
| 3300012207|Ga0137381_10329353 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300012208|Ga0137376_10625542 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300012285|Ga0137370_10362568 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300012349|Ga0137387_10921812 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300012351|Ga0137386_10602828 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300012353|Ga0137367_10122658 | All Organisms → cellular organisms → Bacteria | 1907 | Open in IMG/M |
| 3300012353|Ga0137367_11033598 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300012354|Ga0137366_10125324 | All Organisms → cellular organisms → Bacteria | 1939 | Open in IMG/M |
| 3300012354|Ga0137366_11065250 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300012356|Ga0137371_10317056 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300012356|Ga0137371_11171621 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300012362|Ga0137361_10106691 | All Organisms → cellular organisms → Bacteria | 2446 | Open in IMG/M |
| 3300012392|Ga0134043_1034253 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300012398|Ga0134051_1180814 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300012400|Ga0134048_1194022 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300012409|Ga0134045_1389580 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300012683|Ga0137398_10116440 | All Organisms → cellular organisms → Bacteria | 1701 | Open in IMG/M |
| 3300012918|Ga0137396_10494965 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300012923|Ga0137359_11778726 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300012924|Ga0137413_11186026 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300012924|Ga0137413_11494716 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300012925|Ga0137419_11867478 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300012929|Ga0137404_11891627 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300012931|Ga0153915_10363379 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
| 3300012944|Ga0137410_10047888 | All Organisms → cellular organisms → Bacteria | 3038 | Open in IMG/M |
| 3300012944|Ga0137410_11085918 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300012972|Ga0134077_10374332 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300012976|Ga0134076_10047080 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300012976|Ga0134076_10414763 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300013297|Ga0157378_11101993 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300014154|Ga0134075_10331568 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300014166|Ga0134079_10122143 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300015053|Ga0137405_1345460 | Not Available | 2632 | Open in IMG/M |
| 3300015264|Ga0137403_11276333 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300015357|Ga0134072_10439873 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300015358|Ga0134089_10231708 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300015358|Ga0134089_10237139 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300015359|Ga0134085_10020678 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2507 | Open in IMG/M |
| 3300015359|Ga0134085_10196702 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300015359|Ga0134085_10200628 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300015359|Ga0134085_10230492 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300017654|Ga0134069_1028025 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
| 3300017654|Ga0134069_1071199 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300017654|Ga0134069_1165786 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300017656|Ga0134112_10520448 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300017966|Ga0187776_10130117 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
| 3300017966|Ga0187776_11153424 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300018058|Ga0187766_10839033 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300018063|Ga0184637_10221364 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300018077|Ga0184633_10389182 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300018431|Ga0066655_11025358 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300018433|Ga0066667_10587296 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300018433|Ga0066667_12353712 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300018482|Ga0066669_10149876 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
| 3300019879|Ga0193723_1133677 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300021081|Ga0210379_10072229 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300021086|Ga0179596_10684620 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300022195|Ga0222625_1360587 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300022694|Ga0222623_10037930 | All Organisms → cellular organisms → Bacteria | 1845 | Open in IMG/M |
| 3300024330|Ga0137417_1457240 | All Organisms → cellular organisms → Bacteria | 1722 | Open in IMG/M |
| 3300025318|Ga0209519_10794357 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300025885|Ga0207653_10218314 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300025906|Ga0207699_10436851 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300025910|Ga0207684_10967016 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300026005|Ga0208285_1023720 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300026285|Ga0209438_1002783 | All Organisms → cellular organisms → Bacteria | 5860 | Open in IMG/M |
| 3300026296|Ga0209235_1059764 | All Organisms → cellular organisms → Bacteria | 1786 | Open in IMG/M |
| 3300026298|Ga0209236_1091408 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
| 3300026300|Ga0209027_1066903 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300026301|Ga0209238_1050906 | All Organisms → cellular organisms → Bacteria | 1489 | Open in IMG/M |
| 3300026301|Ga0209238_1210321 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300026307|Ga0209469_1037932 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
| 3300026314|Ga0209268_1075446 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300026320|Ga0209131_1322616 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300026323|Ga0209472_1226679 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300026323|Ga0209472_1285931 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300026324|Ga0209470_1014455 | All Organisms → cellular organisms → Bacteria | 4515 | Open in IMG/M |
| 3300026331|Ga0209267_1290712 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300026523|Ga0209808_1118566 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300026529|Ga0209806_1154003 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300026536|Ga0209058_1184854 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300026537|Ga0209157_1084769 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
| 3300026537|Ga0209157_1191969 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300026540|Ga0209376_1256731 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300026548|Ga0209161_10540357 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300026552|Ga0209577_10365192 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300026700|Ga0208474_100136 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
| 3300027273|Ga0209886_1069561 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300027324|Ga0209845_1076912 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300027775|Ga0209177_10506688 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300027787|Ga0209074_10369929 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| (restricted) 3300027799|Ga0233416_10267828 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300027846|Ga0209180_10087814 | All Organisms → cellular organisms → Bacteria | 1762 | Open in IMG/M |
| 3300027846|Ga0209180_10674651 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300027862|Ga0209701_10084406 | All Organisms → cellular organisms → Bacteria | 1998 | Open in IMG/M |
| 3300028536|Ga0137415_10191463 | All Organisms → cellular organisms → Bacteria | 1867 | Open in IMG/M |
| 3300028793|Ga0307299_10199208 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300028803|Ga0307281_10179764 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300030620|Ga0302046_10462340 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300030998|Ga0073996_11204280 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300031152|Ga0307501_10260453 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 520 | Open in IMG/M |
| 3300031200|Ga0307496_10086331 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300031421|Ga0308194_10089958 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300031421|Ga0308194_10152087 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300031720|Ga0307469_10163715 | All Organisms → cellular organisms → Bacteria | 1686 | Open in IMG/M |
| 3300031720|Ga0307469_10204487 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
| 3300031720|Ga0307469_10555575 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300031720|Ga0307469_11439719 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300031720|Ga0307469_12013592 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300031720|Ga0307469_12160253 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300031740|Ga0307468_101235260 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300031949|Ga0214473_12063972 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300032180|Ga0307471_103479499 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300032180|Ga0307471_103914665 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300032782|Ga0335082_11098031 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300033407|Ga0214472_10833648 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300033813|Ga0364928_0124242 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300034177|Ga0364932_0148316 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300034178|Ga0364934_0223588 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 19.07% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 18.04% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.25% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.12% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.12% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.12% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.58% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.06% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.55% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.55% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.03% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.03% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.03% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.03% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.03% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.52% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.52% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.52% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005883 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_302 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010140 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012392 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026005 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026700 | Grasslands soil microbial communities from Chapel Hill, North Carolina, USA that are Nitrogen fertilized -NN350 (SPAdes) | Environmental | Open in IMG/M |
| 3300027273 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300030998 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031200 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_S | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25382J43887_101367663 | 3300002908 | Grasslands Soil | KVGAGAAPIPDDIASRLRELERTAGWATPKASLAESPGP* |
| JGI25386J43895_100999391 | 3300002912 | Grasslands Soil | GVIIPSADWAPLADLKVGPEAAPIPDDIAARLREVERTAGWATPKLDLATPSPQAPNP* |
| JGI25617J43924_102152162 | 3300002914 | Grasslands Soil | GPDAAAIPDDIAAGLRAIERSAGWAAAKLELVREPAAPDR* |
| JGI25617J43924_102565222 | 3300002914 | Grasslands Soil | FRELKRAYDARSILNPDVILPAVDWAPLADLKVGPDAASIPDDIATQLRAIERSAGWAVPKLELAREPAAPDS* |
| Ga0066673_105007842 | 3300005175 | Soil | LNPGVILPAAGWEGAPLADLKVGADAAGIPDDIARRLREIERTAAWATPKTSLADT* |
| Ga0066685_100684991 | 3300005180 | Soil | KRAYDPLSIFNPGVIIPANDWSPVAALKMGAEAAVIPDDIATRLREVERSAAWATPKLELTR* |
| Ga0066678_100428581 | 3300005181 | Soil | NPGVIIPSADWAPLVDLKVGPEAAPIPDDIARRLRELEQTAGWATPKLDLTTPSS* |
| Ga0070703_102464681 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | AYDAAAIFNPGVIIPSADWAPLADLKVGPTAAPIPDDIAARLRDVERTAGWAIPKLDLAVPTP* |
| Ga0070709_104737841 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | SADWAPLADLKVGPTAAPIPDDIAARLRDVERTAGWAISKLDLVNP* |
| Ga0070705_1001067981 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | APLAALKVGDGAAAIPDDIASRLRDVERNAAWATPKLELTHPTPST* |
| Ga0066682_101279921 | 3300005450 | Soil | GVIIPSADWAPLAELKVGPDRAPMPDDIATRLREIERTAGWATPKLELARPSGHPTPDT* |
| Ga0066681_101265291 | 3300005451 | Soil | AYDPLSIFNPGVIIPANDWSPVAALKVGAEAAAIPDDIATRLREVERSAAWATPKLELTR |
| Ga0066681_104711292 | 3300005451 | Soil | SPLDALKVGDGAAAIPDDIATRLRDVERSAAWATPKPELARQTPET* |
| Ga0070706_1011913402 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GVIIPATDWSPVGALKVGDQAAAIPDDIATRLREVERSAAWATPKLELAH* |
| Ga0066697_100867421 | 3300005540 | Soil | NPGVIIPTADWAPLADLKVGPAAAPIPDDIAARLREIERTAGWATPKLELARFPEPRAPSS* |
| Ga0070704_1000158646 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | WSPVAALKVGVDAAAIPDDIATRLREVERSAAWDTPKLDLTR* |
| Ga0066661_108520971 | 3300005554 | Soil | AALKVGAGAAAIPEDIATRLREVERSAAWATPKLELAH* |
| Ga0066707_100447934 | 3300005556 | Soil | VIIPTADWSPLAALKVGDETAIIPEDIATRLREVERSAAWATPKLELAL* |
| Ga0066707_102772731 | 3300005556 | Soil | LKVGPDAAPIPDDIAARLREIERTAGWSVPKLDLAREPLTPGT* |
| Ga0066704_108580892 | 3300005557 | Soil | PGVILPAADWAPLAELKVGPDAAPIPDDIAARLRELERAAAWGTPKLELARAAPSP* |
| Ga0066698_110308662 | 3300005558 | Soil | GVILPAADWTPLADLKVGPAAAPIPDDIAARLRDLERQGGWATPKPELAR* |
| Ga0066670_103319141 | 3300005560 | Soil | ADWAPFAGLKVGADAAPIPDDIAARLRDIERTAGWATPKLDLALAP* |
| Ga0066705_105724112 | 3300005569 | Soil | GADAAGIPDDIARRLREIERTAAWATPKTSLADT* |
| Ga0066691_105176381 | 3300005586 | Soil | DWSPLDALKVGDGAAAIPDDIATRLRDVERSAAWATPKPELARQTPET* |
| Ga0066706_101274623 | 3300005598 | Soil | AYDPLSIFNPGVIIPANDWSPVAALKMGAEAAVIPDDIATRLREVERSAAWATPKLELTR |
| Ga0066706_108206411 | 3300005598 | Soil | KVGPDAAPIPGDIAARLREIERTAGWATPKLELARSSSP* |
| Ga0075299_10420132 | 3300005883 | Rice Paddy Soil | FADVKRAYDPLSIFNPGVIIPASDWSPIAALKVGDDAAAIPEDIATRLREVERNAAWATTKLQLAR* |
| Ga0066651_104371182 | 3300006031 | Soil | WSPVAALKVGADAAAIPDDIATRLREVERRAAWDTPKLELTR* |
| Ga0066651_104892261 | 3300006031 | Soil | GVILPAADWAPLADLKVGPDAAPIPDDIAARLREIERTAGWATPKLELARSSSP* |
| Ga0066656_100641554 | 3300006034 | Soil | NPGVIIPATDWSPVAALKVGAGAAVIPDDIATRLRDVERNAAWATPKLELTR* |
| Ga0079222_103564041 | 3300006755 | Agricultural Soil | GVIIPATDWSPVAALKVGAGAAAIPDDIATRLRDVERSAAWATPKAELAQ* |
| Ga0066659_100288035 | 3300006797 | Soil | GPDRAPMPDDIATRLREIERTAGWATPKLELARPSGHPTPDT* |
| Ga0066659_116742431 | 3300006797 | Soil | IPSADWAPLADLKVGPTAAPIPDDIAARLREIERTAAWATPKLELARSSSPEPRAPNP* |
| Ga0079220_100976383 | 3300006806 | Agricultural Soil | DWTALADLKVGPAAAQLPDDIAVRLRDVERTAGWAIPKSELARPRHPTPDT* |
| Ga0075428_1013318682 | 3300006844 | Populus Rhizosphere | ADWAPLADLKVGPEAAPIPDDIAARLREIERRAAWATPKLDLAR* |
| Ga0075421_1005415043 | 3300006845 | Populus Rhizosphere | GVIIPATGWSPLAALKIGDEAAAIPDDIATRLRDVERNAAWATSKLQLAR* |
| Ga0075430_1008466552 | 3300006846 | Populus Rhizosphere | KVGPEAAPIPDDIAGRLREVERAGAWSTPKLDLAR* |
| Ga0075431_1007959692 | 3300006847 | Populus Rhizosphere | ATDWLPLAALKVGAGAAAIPDDIATRLREVERSAAWGTPKLELTRQTPNP* |
| Ga0075426_108487982 | 3300006903 | Populus Rhizosphere | LADLKVGPAAAQLPDDIAVRLRDVERTAGWATPKSELARPRHPTPDT* |
| Ga0075436_1002916021 | 3300006914 | Populus Rhizosphere | HPQPGCYNPLGQWAPLADLKVGPDAAPIPDDIAARLREVERAAGWAVPKVELARESPTTDP* |
| Ga0079218_103703853 | 3300007004 | Agricultural Soil | LTIFNPGVIIPAPGWSPLAALKVGDEAAVIPDDIATRLRDVERSAAWGIPKLELTQPTPVT* |
| Ga0099793_106724172 | 3300007258 | Vadose Zone Soil | PLADLKVGPEAAPIPADIAARLRDVERNAGWATPKLDLATRAPKP* |
| Ga0099794_100687563 | 3300007265 | Vadose Zone Soil | PAADWAPLTELKVGPDAAAIPDDIAARLRDTERNAAWGVLKLDLARADTPNPAPDT* |
| Ga0099829_101622563 | 3300009038 | Vadose Zone Soil | GVILPAADWAPLAELKVGPDVAPIPDDIAARLRELERTAAWGTPKLELARATP* |
| Ga0099830_100597374 | 3300009088 | Vadose Zone Soil | WAPLADLKVGPDAAPIPDDIATRLREIERTAAWATPKLELATP* |
| Ga0075418_106844992 | 3300009100 | Populus Rhizosphere | IPATGWSPLAALKIGAEAAAIPDDIATRLRDVERNAAWAIPKLELARPSP* |
| Ga0066709_1007200541 | 3300009137 | Grasslands Soil | LKVGAGAAAIPEDIATRLREVERSAAWATPKLELAH* |
| Ga0114129_116938971 | 3300009147 | Populus Rhizosphere | ADWAPLASLKVGEDAAAIPDDIAARLRETERNAAWATPKLELAR* |
| Ga0127456_10049242 | 3300010140 | Grasslands Soil | VGADAAGIPDDIARRLREIERTAAWATPKTSLADT* |
| Ga0127483_10948701 | 3300010142 | Grasslands Soil | VGAGAAAIPDDIAMRLREVERSAAWATPKLELTRQTP* |
| Ga0134070_100200751 | 3300010301 | Grasslands Soil | ALKVGAEAAAIPDDIATRLREVERSAAWATPKLELTR* |
| Ga0134088_100694644 | 3300010304 | Grasslands Soil | DWSPVAALKMGAEAAVIPDDIATRLREVERSAAWATPKLELTR* |
| Ga0134088_107004101 | 3300010304 | Grasslands Soil | NVKRAYDPLTIFNPGVIIPATDWSPLDALKVGDGAAAIPDDIATRLRDVERSAAWATPKPELARQTPET* |
| Ga0134084_100026686 | 3300010322 | Grasslands Soil | VILPAADWAPLADLKVGPDAAPIPDDIAARLREIERTAGWATPKLELARSSSPESQAPSP |
| Ga0134084_100181641 | 3300010322 | Grasslands Soil | SIFNPGVIIPSADWAPLADLKVGPAAAAIPDDIAARLREVERTAGWAIPKLDLVKP* |
| Ga0134084_101293462 | 3300010322 | Grasslands Soil | SPVAALKVGADAAAIPDDIATRLRELERSAAWDTAKLELTR* |
| Ga0134084_104099142 | 3300010322 | Grasslands Soil | LKVGADAAPIPDDIGDRLRDIERTAGWATPKLDLVRRSLTPDT* |
| Ga0134086_100369761 | 3300010323 | Grasslands Soil | ADWAPLADVKVGAGAAPIPDDIAGRLRELERTAAWSTPKTTLAGT* |
| Ga0134086_101775072 | 3300010323 | Grasslands Soil | VIIPASDWSPVTALKVGAGAAAIPEDIATRLREVERSAAWATPKLELAY* |
| Ga0134086_102035371 | 3300010323 | Grasslands Soil | VAALKVGAGAAVIPDDIATRLRDVERNAAWATPKLELTR* |
| Ga0134086_102857461 | 3300010323 | Grasslands Soil | LKVGPEAAPIPDDIAARLREVERTAGWATPKLDLATPGP* |
| Ga0134064_100460793 | 3300010325 | Grasslands Soil | DWAPLADLKVGPAAAPIPDDIAARLREIERTAGWATPKLELDRSPEPRAPSP* |
| Ga0134065_101895111 | 3300010326 | Grasslands Soil | PVAALKMGAEAAVIPDDIATRLREVERSAAWATPKLELTR* |
| Ga0134071_101058593 | 3300010336 | Grasslands Soil | LKVGAGAADIPEDIATRLREVERSAAWATPKLELAH* |
| Ga0134062_101941342 | 3300010337 | Grasslands Soil | VIIPATDWSPLATLKVGADAAAIPDDIAGKLRDMERSAAWATPKLELIR* |
| Ga0126376_100383303 | 3300010359 | Tropical Forest Soil | VGDGAAPIPDDIAQRLREIERNAGWAIPKTDVSRTP* |
| Ga0126372_112640222 | 3300010360 | Tropical Forest Soil | WSPLGDLKVGDGAALIPDDIAHRLRDIERNAGWATPKSELARLP* |
| Ga0134127_114440471 | 3300010399 | Terrestrial Soil | PLAALKVGDGAAAIPDDIASRLRDVERNAAWATPKLELTHPTPST* |
| Ga0134127_117282691 | 3300010399 | Terrestrial Soil | IPATDWSPLAALKVGEDAAAIPDDIATQLRDVERSAAWATPKRQLAR* |
| Ga0134122_122369302 | 3300010400 | Terrestrial Soil | GVIIPAPDWNPLVDLKVGTDAAPIPDDIAARLRDVERSAGWGISKRELTRRL* |
| Ga0134123_122515742 | 3300010403 | Terrestrial Soil | EWAPLADLKVGPEATPIPDDIAARLREMERTAGWATPKLDLATPSP* |
| Ga0137391_102901913 | 3300011270 | Vadose Zone Soil | LKVGPEAASIPDDIAARLREVERTAGWATPKLDLATPNP* |
| Ga0137455_10747571 | 3300011429 | Soil | KVGEDAAAIPDDIAARLRDMERNAGWATPKPELAR* |
| Ga0137364_109555412 | 3300012198 | Vadose Zone Soil | DLKVGPDAAPIPDDIAARLREIEQTAGWATPKLELARSSSP* |
| Ga0137382_101632741 | 3300012200 | Vadose Zone Soil | IPASDWSPVTALKVGAGAAAIPEDIATRLREVERSAAWATPKLELAH* |
| Ga0137381_103293533 | 3300012207 | Vadose Zone Soil | IIPSAEWAPLADLKVGPGAAPLPNDIAAGLREIERTAGWATPKLDLARASDT* |
| Ga0137376_106255422 | 3300012208 | Vadose Zone Soil | TALKVGAGAAAIPEDIATRLREVERSAAWATPKLELAH* |
| Ga0137370_103625681 | 3300012285 | Vadose Zone Soil | ILPSPEWAPLADLKVGADAAAIPGDIAARLREVERAAAWAVPKVELARESPTPDP* |
| Ga0137387_109218122 | 3300012349 | Vadose Zone Soil | LADLKVGAGAAPIPDDIAARLRELERTATWSTPKTTLAGT* |
| Ga0137386_106028281 | 3300012351 | Vadose Zone Soil | PPPDWTPLADLKVGREVMQIPEDIAHRLREVERTAGWATPKLELASPNP* |
| Ga0137367_101226583 | 3300012353 | Vadose Zone Soil | GVIIPATDWSPVAALKVGEGAAVIPEDIATRLREVERSAAWATPKLELAH* |
| Ga0137367_110335982 | 3300012353 | Vadose Zone Soil | AALKIGAGAAVIPEDIATRLREVERSAAWATPKRELAR* |
| Ga0137366_101253241 | 3300012354 | Vadose Zone Soil | PLAALKVGEGAAPIPDDIAARLREVERTASWATPKLDLVRSLTPDP* |
| Ga0137366_110652501 | 3300012354 | Vadose Zone Soil | LPAADWAPLADVKVGAGAAPIPDDIAGRLRELERTAAWSTPKTTLAGT* |
| Ga0137371_103170563 | 3300012356 | Vadose Zone Soil | WAPLADLKVGPEAAPIPDDIAARLREVERTAGWATPKLDLATPSPQAPNP* |
| Ga0137371_111716212 | 3300012356 | Vadose Zone Soil | ADWAPLADLKVGPEAAPIPDDIAARLREVERTAGWATPKLDLATSSPQAPNP* |
| Ga0137361_101066911 | 3300012362 | Vadose Zone Soil | LKVGPEAAPIPHDIAARLREVERTAGWAIPKLDLATPSP* |
| Ga0134043_10342531 | 3300012392 | Grasslands Soil | FNPGVIIPATDWSPVAALKVGAGAAAIPDDIAMRLREVERSAAWATPKLELTRQTP* |
| Ga0134051_11808141 | 3300012398 | Grasslands Soil | SPVTALKVGAGAAAIPEDIATRLREVERSAAWATPKLELAH* |
| Ga0134048_11940222 | 3300012400 | Grasslands Soil | LKVGAGAAAIPEDIATRLREVERSAAWATPKPELAH* |
| Ga0134045_13895802 | 3300012409 | Grasslands Soil | LKVGAEAAVIPDDIATRLREVERSAAWATPKLELTR* |
| Ga0137398_101164403 | 3300012683 | Vadose Zone Soil | ILPAADWQPLAELKVGAAAASIPDDIALRLRDVERSGGWAVPKPELAR* |
| Ga0137396_104949651 | 3300012918 | Vadose Zone Soil | WSPLATLKVGDGAPAIPEDIATRLREVERSAAWATPKFELAH* |
| Ga0137359_117787261 | 3300012923 | Vadose Zone Soil | GVIIPSADWAPLADLKVGPAAAPIADDIAARLRDVERTAGWATPKLDLATPSP* |
| Ga0137413_111860262 | 3300012924 | Vadose Zone Soil | DLKVGPEAMPIPDDIARRLRELERNAGWATPKLELATPSP* |
| Ga0137413_114947161 | 3300012924 | Vadose Zone Soil | GVIIPASDWSPVTALKVGAGAAAIPEDIATRLREVERSAAWATPKLELAH* |
| Ga0137419_118674781 | 3300012925 | Vadose Zone Soil | AADWAPLAALKVGEDAAVIPDDIAARLRELERAAGWATPKLELAR* |
| Ga0137404_118916271 | 3300012929 | Vadose Zone Soil | PLADLKVGPEATPIPDDIARRLRELERTAGWATPKLDLARAADT* |
| Ga0153915_103633791 | 3300012931 | Freshwater Wetlands | KVGPDAAPIPDDIAARLRDIERTGGWATPKQDLARLP* |
| Ga0137410_100478884 | 3300012944 | Vadose Zone Soil | VAALKVGAGAAAIPEDIATRLREVERSAAWATPKLELAH* |
| Ga0137410_110859181 | 3300012944 | Vadose Zone Soil | AADWQPLAELKVGAAAASIPDDIALRLRDVERSGGWAVPKPELAR* |
| Ga0134077_103743321 | 3300012972 | Grasslands Soil | ALKVGDGAAAIPDDIATRLRDVERSAAWATPKPELARQTPET* |
| Ga0134076_100470803 | 3300012976 | Grasslands Soil | GVIIPATDWSPLDALKVGDGAAAIPDDIATRLRDVERSAAWATPKPELARQTPET* |
| Ga0134076_104147631 | 3300012976 | Grasslands Soil | LPSPEWAPLVDLKVGADVAPIPDDIAARLREIERTAGWPAPKLELARSSNPEPPAPSP* |
| Ga0157378_111019932 | 3300013297 | Miscanthus Rhizosphere | VILPAADWAPLRDLKVGPDAAPIPDDIAGRLRDTERNATWSVPKLELAAPRHRTPDT* |
| Ga0134075_103315682 | 3300014154 | Grasslands Soil | SIFNPGVIIPATDWSPVAALKVGAGAADIPEDIATRLREVERSAAWATPKLELAH* |
| Ga0134079_101221432 | 3300014166 | Grasslands Soil | FNPGVIIPAADWSPVAALKVGAGAAAIPEDIATRLREVERSAAWATPKLELAR* |
| Ga0137405_13454601 | 3300015053 | Vadose Zone Soil | NPLADWAPLADLRSGPRRRRSHDDIAARLREVERTAGWATPKLDFATPSP* |
| Ga0137403_112763331 | 3300015264 | Vadose Zone Soil | VGPEATPIPDDIAARLRQVEQSANWAIPKLELATRAANP* |
| Ga0134072_104398732 | 3300015357 | Grasslands Soil | DWSPVAALKVGAGAAAIPEDIAMRLREVERSAAWAIPKLELAH* |
| Ga0134089_102317081 | 3300015358 | Grasslands Soil | PPPDWTPLADLKVGREVMQIPENIAHRLREVERTAGWATPKLELASPNP* |
| Ga0134089_102371392 | 3300015358 | Grasslands Soil | APLADLKVGPDAAPIPDDIAARLREIERTAGWSVPKLDLAREPLTPGT* |
| Ga0134085_100206784 | 3300015359 | Grasslands Soil | VIIPATDWSPVAALKVGAGAAVIPEDIATRLREVERSAAWATPKLELAH* |
| Ga0134085_101967022 | 3300015359 | Grasslands Soil | PGVIIPAPDWTPLADLKVGPATAAIPDDIAARLREVERTAGWATPKYELARPDT* |
| Ga0134085_102006281 | 3300015359 | Grasslands Soil | PLADLKVGPEAAPIPDDIAARLREVERTAGWATPKLDLATPGPQAPNP* |
| Ga0134085_102304921 | 3300015359 | Grasslands Soil | DLQVGPDAAPSPSATAARLRDVERTAAWASPKVELARESPTPDP* |
| Ga0134069_10280253 | 3300017654 | Grasslands Soil | LPAADWAPLADVKVGAGAAPIPDDIAGRLRELERTAAWSTPKTTLAGT |
| Ga0134069_10711992 | 3300017654 | Grasslands Soil | WAPLADLKVGPEAAPIPDDIAARLREVERTAGWATPKLDLATSSPQAPNP |
| Ga0134069_11657862 | 3300017654 | Grasslands Soil | DWAPLAELKVGPDRVPMPDDIATRLREIERTAGWATPKLELARPSGHPTPDT |
| Ga0134112_105204481 | 3300017656 | Grasslands Soil | VAALKVGDRAADIPEDIATRLRDVERNAAWATPKLALTQ |
| Ga0187776_101301171 | 3300017966 | Tropical Peatland | ADLKVGPDAARIPDDIAARLRDVERNAAWSVPKLELATLTPET |
| Ga0187776_111534242 | 3300017966 | Tropical Peatland | LTHLKVGDGAVPIPDDIALRLRETERTAGWATPKTDLARAP |
| Ga0187766_108390331 | 3300018058 | Tropical Peatland | AADWSPLADLKVGPDAAPIPADIAARLRDTERNAAWGAPKLDLATLTPHT |
| Ga0184637_102213641 | 3300018063 | Groundwater Sediment | LKVGERAAAIPDDIAARLREVERSAAWATPKVALATPEPLAPSP |
| Ga0184633_103891822 | 3300018077 | Groundwater Sediment | AAAADWAPLAALKVGERAAAIPDDIAARLREVERSAAWATPKVALATPEPLAPSP |
| Ga0066655_110253582 | 3300018431 | Grasslands Soil | DLKVGADAAGIPDDIARRLREIERTAAWATPKTSLADT |
| Ga0066667_105872962 | 3300018433 | Grasslands Soil | LADLKVGADAAPIPGDIAARLREVERAATWAVPKVELARESPTPDP |
| Ga0066667_123537121 | 3300018433 | Grasslands Soil | AGSMFNPGVIIPSADWAPLADLKVGPGAAPIPDDIAARLREVERTAGWAIPKLDLVKP |
| Ga0066669_101498763 | 3300018482 | Grasslands Soil | GPEATPIPDDIAARLREVERTAGWATPKLDLTTPSS |
| Ga0193723_11336771 | 3300019879 | Soil | VILPAADWGPLHDLKVGPDAAPIPDDIAARLRDTERNASWNVPKLDLTQPVVPDT |
| Ga0210379_100722291 | 3300021081 | Groundwater Sediment | ADLKVGPSAAPIPEDIAARLRAVEREGGWATPKTELAR |
| Ga0179596_106846201 | 3300021086 | Vadose Zone Soil | LSIFNPGVIIPATDWSPVAALKIGAGAAVIPEDIATRLREVERSAAWATPKRELAR |
| Ga0222625_13605871 | 3300022195 | Groundwater Sediment | PVAALKIGAGAAVIPEDIATRLREVERSAAWATPKLELAH |
| Ga0222623_100379303 | 3300022694 | Groundwater Sediment | LKVGEDAAAIPDDIAARLRDVERTAGWATPKLELAR |
| Ga0137417_14572403 | 3300024330 | Vadose Zone Soil | VGPEAMPIPDDIARRLRELERNAGWATPKLELATPSP |
| Ga0209519_107943571 | 3300025318 | Soil | VIIPAADWAPLAALKVGEDAAPIPDDIAARLRELERAAGWATPKPELAR |
| Ga0207653_102183141 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | AYDAAAIFNPGVIIPSADWAPLADLKVGPTAAPIPDDIAARLRDVERTAGWAIPKLDLAVPTP |
| Ga0207699_104368511 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | DLKVGPTAAPIPDDIAARLRDVERTAGWAISKLDLVNP |
| Ga0207684_109670161 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | ATDWSPVGALKVGDQAAAIPDDIATRLREVERSAAWATPKLELAH |
| Ga0208285_10237202 | 3300026005 | Rice Paddy Soil | ADLKVGDGAAAIPDDIAGRLRGLERNAAWSTPKLDLTRQP |
| Ga0209438_10027837 | 3300026285 | Grasslands Soil | VAADWAPLAELKVGEHAAAIPDDIAARLREMERTAGWATPKLELAR |
| Ga0209235_10597641 | 3300026296 | Grasslands Soil | PSAEWAPLADLKVGPDAAPIPDDIAQRLRDIERTAGWATPKLELARSPSPEPLAPSP |
| Ga0209236_10914083 | 3300026298 | Grasslands Soil | APLADLKVGPEAAPIPHDIAARLREVERTAGWAIPKLDLATPSP |
| Ga0209027_10669033 | 3300026300 | Grasslands Soil | DAGSMFNPGVIIPSADWAPLADLKVGPGAAPIPDDIAARLREVERTAGWAIPKLDLVKP |
| Ga0209238_10509061 | 3300026301 | Grasslands Soil | ILPSPEWAPLADLKVGPDAAPIPGDIATRLREIEQTAGWATPKLELARSSSP |
| Ga0209238_12103212 | 3300026301 | Grasslands Soil | LADLKVGPGAAPIPDDIAARLREIERTAGWAISKLDLVKP |
| Ga0209469_10379321 | 3300026307 | Soil | ATDWAPLANLKVGPDATPIPDDIAHRLRALEQGAGWATPKTELAN |
| Ga0209268_10754461 | 3300026314 | Soil | IIPSADWAPLAELKVGPDRAPMPDDIATRLREIERTAGWATPKLELARPSGHPTPDT |
| Ga0209131_13226161 | 3300026320 | Grasslands Soil | PAADWQPLADLKVGAAAAPIPDDIALRLRDVERSGGWAVPKPELAR |
| Ga0209472_12266792 | 3300026323 | Soil | VGPATAAIPDDIAARLREVERTAGWATPKYELARPDT |
| Ga0209472_12859311 | 3300026323 | Soil | PVAALKVGDRAADIPEDIATRLRDVERNAAWATPKLALTQ |
| Ga0209470_10144551 | 3300026324 | Soil | AAPIPGDIAARLRDVERTAAWAVPKVELARESPTPDP |
| Ga0209267_12907122 | 3300026331 | Soil | VIIPATDWSPVAALKVGDDAAAIPEDIATRLREVERSAAWATPKLELAH |
| Ga0209808_11185663 | 3300026523 | Soil | PGVIIPATDWSPVAALKVGDDAVAIPEDIATRLREVERSAAWATPKLELAH |
| Ga0209806_11540031 | 3300026529 | Soil | DWAPLADLKVGPDAAPIPDDIAARLREIERTAGWSVPKLDLAREPLTPGT |
| Ga0209058_11848541 | 3300026536 | Soil | KVGPEATPIPDDIAARLREVERTAGWATPKLDLAAASL |
| Ga0209157_10847693 | 3300026537 | Soil | PDAAPIPEDVAVRLREIERTAGWATPKLDLVRNTLTPDT |
| Ga0209157_11919691 | 3300026537 | Soil | PSADWAPLADLKVGPEAAPIPDDIARRLRDTERNAAWGVPKFELATPSP |
| Ga0209376_12567312 | 3300026540 | Soil | PSADWAPLADLKVGPEAAPIPHDIAARLREVERTAGWAIPKLDLATPSP |
| Ga0209161_105403571 | 3300026548 | Soil | PGVIIPSAEWAPLADLKVGPDAAPIPGDIAARLRDVERTAAWAVPKVELARESPTPDP |
| Ga0209577_103651921 | 3300026552 | Soil | ADLKVGPEATPIPDDIAARLREVERTAGWATPKLDLTTPSS |
| Ga0208474_1001361 | 3300026700 | Soil | DAAAIFNPGVIIPSADWAPLADLKVGATAAPIPDDIAARLRDVERTAGWAIPKLDLVNP |
| Ga0209886_10695612 | 3300027273 | Groundwater Sand | DWAPLADLKVGPSAAPIPDDIAARLRAVEREGGWATPKTELAR |
| Ga0209845_10769121 | 3300027324 | Groundwater Sand | PFADLKVGPSAAPIPDDIAARLRAVEREGGWATPKTELAR |
| Ga0209177_105066881 | 3300027775 | Agricultural Soil | QPLADLKVGDAAAPIPDDIALRLRDVERSGGWAVPKPELAR |
| Ga0209074_103699291 | 3300027787 | Agricultural Soil | KVGPAAAQLPDDIAVRLRDVERTAGWATPKSELASPRHPTPDT |
| (restricted) Ga0233416_102678282 | 3300027799 | Sediment | PLAALKVGPAAAAIPDDIAARLRHLERAAAWHTPKTELAR |
| Ga0209180_100878141 | 3300027846 | Vadose Zone Soil | PGVIIPSADWAPLADLKVGPEAAPIPADIAARLRDVERNAGWATPKLDLATRAPKP |
| Ga0209180_106746511 | 3300027846 | Vadose Zone Soil | IIPSAEWAPLADLKVGPEATPIPDDIAARLREVERTAGWATPKLDLATPSP |
| Ga0209701_100844061 | 3300027862 | Vadose Zone Soil | WAPLADLKVGPDAAPIPDDIATRLREIERTAAWATPKLELATP |
| Ga0137415_101914631 | 3300028536 | Vadose Zone Soil | PAADWAPLVDLKVGAAATPIPDDIAARLRELERTASWATPKTSLADSPGT |
| Ga0307299_101992082 | 3300028793 | Soil | KVGEDAAAIPDDIAARLRDVERAAGWATPKLELAR |
| Ga0307281_101797642 | 3300028803 | Soil | LKVGEGAAPIPDDIAVRLRAVERGAEWAILKTGLAD |
| Ga0302046_104623402 | 3300030620 | Soil | TDWAPLVDLKVGDRVAPIPDDIASRLREIERAAAWATPKTELAGPPARSGG |
| Ga0073996_112042801 | 3300030998 | Soil | ALKVGDEAAAIPEDIATRLREVERSAAWATPKLELAH |
| Ga0307501_102604531 | 3300031152 | Soil | PGVIIPAADWAPLAALKVGEDAAAIPDDIAARLRELERSAGWATPKLELAR |
| Ga0307496_100863311 | 3300031200 | Soil | KVGDGAAPIPEDIATRLREVEHTAGWSTPKLDLARAPTPDT |
| Ga0308194_100899582 | 3300031421 | Soil | ALKVGAGAAAIPEDIATRLREVERNAAWATPKLALAH |
| Ga0308194_101520872 | 3300031421 | Soil | SPVTALKVGAGAAAIPDDIATRLREVERSAAWATPKRELAR |
| Ga0307469_101637153 | 3300031720 | Hardwood Forest Soil | DWSPLDALKVGDGAAAIPDDIATRLRDVERNAAWATPKPELARRTPET |
| Ga0307469_102044871 | 3300031720 | Hardwood Forest Soil | AALKVGEDAAAIPDDIATQLRDVERSAAWATPKRQLAR |
| Ga0307469_105555751 | 3300031720 | Hardwood Forest Soil | PAADWAPLADVKAGADAAAIPDDIARRLREIERTAAWATPKTSLADT |
| Ga0307469_114397192 | 3300031720 | Hardwood Forest Soil | PLAALKVGEDAAAIPDDIAARLRELERAAGWATPKLELAR |
| Ga0307469_120135922 | 3300031720 | Hardwood Forest Soil | AADWAPLLDLKVGPDAAPIPDDIAGRLRDTERNAAWSIPKLDLI |
| Ga0307469_121602531 | 3300031720 | Hardwood Forest Soil | SIFNPGVIIPATDWSPVAALKVGAGAADIPEDIATRLREVERSAAWATQKLELAR |
| Ga0307468_1012352601 | 3300031740 | Hardwood Forest Soil | IIPATDWSPVAALKVGADAAAIPDDIATRLREMERSAAWDTPKLDLTR |
| Ga0214473_120639722 | 3300031949 | Soil | WAPLADLKVGEAAAPIPDDIAARLRAVERTAEWAVPKTGLAD |
| Ga0307471_1034794992 | 3300032180 | Hardwood Forest Soil | PRCSFNPGVIIPTANWAPLADLKVGPEATPIPDDIAGRLRELERTAGWATPKLDLARAPD |
| Ga0307471_1039146651 | 3300032180 | Hardwood Forest Soil | DWAPLADLKVGPTAAPIPDDIAARLRDVERTAGWAIPKLDLAVPSP |
| Ga0335082_110980312 | 3300032782 | Soil | KVGPEAAPIPDDIARRLREIERSGGWAVPKLDLARSSDP |
| Ga0214472_108336482 | 3300033407 | Soil | SPLAELKVGNGAAAIPEDIATRLREVERSAAWATPKLEMARPNP |
| Ga0364928_0124242_455_619 | 3300033813 | Sediment | VFNPGVIVPAAAWAPLADLKVGEAAAPIPDDIAARLRAVERGAEWAVPKTGLAD |
| Ga0364932_0148316_3_116 | 3300034177 | Sediment | DLKVGPSAAPIPDDIAARLRAVEREGGWATPKTELAR |
| Ga0364934_0223588_1_120 | 3300034178 | Sediment | LADLKVGPEAAPIPDDIAARLRDVERRAAWATPKLELAR |
| ⦗Top⦘ |