| Basic Information | |
|---|---|
| Family ID | F027465 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 194 |
| Average Sequence Length | 45 residues |
| Representative Sequence | ELVDLVRPWRVIRFFDHDDLREMESGLTDESIARGEVICLAEI |
| Number of Associated Samples | 150 |
| Number of Associated Scaffolds | 194 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.52 % |
| % of genes near scaffold ends (potentially truncated) | 97.94 % |
| % of genes from short scaffolds (< 2000 bps) | 90.21 % |
| Associated GOLD sequencing projects | 144 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (21.649 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.598 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.093 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.86% β-sheet: 18.31% Coil/Unstructured: 71.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 194 Family Scaffolds |
|---|---|---|
| PF01565 | FAD_binding_4 | 85.05 |
| PF04030 | ALO | 6.19 |
| PF16491 | Peptidase_M48_N | 2.58 |
| PF01266 | DAO | 1.55 |
| PF01435 | Peptidase_M48 | 1.55 |
| PF04072 | LCM | 1.03 |
| PF01904 | DUF72 | 0.52 |
| PF11838 | ERAP1_C | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 194 Family Scaffolds |
|---|---|---|---|
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 6.19 |
| COG3315 | O-Methyltransferase involved in polyketide biosynthesis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.03 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17265029 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
| 2170459010|GIO7OMY02F2WGU | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 503 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10160648 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300000709|KanNP_Total_F14TBDRAFT_1025557 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 503 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10128182 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 529 | Open in IMG/M |
| 3300000955|JGI1027J12803_107538235 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300000955|JGI1027J12803_108566424 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 684 | Open in IMG/M |
| 3300002908|JGI25382J43887_10330369 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 653 | Open in IMG/M |
| 3300004463|Ga0063356_101267356 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300004480|Ga0062592_100234643 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300005179|Ga0066684_10203443 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300005179|Ga0066684_10890578 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 582 | Open in IMG/M |
| 3300005186|Ga0066676_10040039 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2608 | Open in IMG/M |
| 3300005290|Ga0065712_10461121 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 678 | Open in IMG/M |
| 3300005295|Ga0065707_10006540 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2772 | Open in IMG/M |
| 3300005332|Ga0066388_102665032 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300005445|Ga0070708_101608241 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300005446|Ga0066686_10315169 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300005447|Ga0066689_10952415 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300005451|Ga0066681_10220685 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300005456|Ga0070678_102264006 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005466|Ga0070685_11568064 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005535|Ga0070684_100271527 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
| 3300005548|Ga0070665_101615968 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300005552|Ga0066701_10065499 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2043 | Open in IMG/M |
| 3300005555|Ga0066692_10110193 | All Organisms → cellular organisms → Bacteria | 1645 | Open in IMG/M |
| 3300005555|Ga0066692_10218247 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300005555|Ga0066692_10411551 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300005558|Ga0066698_10728339 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 650 | Open in IMG/M |
| 3300005559|Ga0066700_10420247 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300005560|Ga0066670_10588213 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 678 | Open in IMG/M |
| 3300005568|Ga0066703_10026432 | All Organisms → cellular organisms → Bacteria | 3067 | Open in IMG/M |
| 3300005568|Ga0066703_10088619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1801 | Open in IMG/M |
| 3300005568|Ga0066703_10098726 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
| 3300005575|Ga0066702_10034444 | All Organisms → cellular organisms → Bacteria | 2620 | Open in IMG/M |
| 3300005614|Ga0068856_100572594 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300005615|Ga0070702_101228468 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 605 | Open in IMG/M |
| 3300005713|Ga0066905_102048688 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005713|Ga0066905_102341255 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 500 | Open in IMG/M |
| 3300006028|Ga0070717_11279773 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 667 | Open in IMG/M |
| 3300006031|Ga0066651_10834210 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 502 | Open in IMG/M |
| 3300006791|Ga0066653_10312970 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300006796|Ga0066665_10859504 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300006796|Ga0066665_11102223 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 605 | Open in IMG/M |
| 3300006796|Ga0066665_11602531 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 512 | Open in IMG/M |
| 3300007076|Ga0075435_101647167 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 563 | Open in IMG/M |
| 3300007258|Ga0099793_10015030 | All Organisms → cellular organisms → Bacteria | 3084 | Open in IMG/M |
| 3300007258|Ga0099793_10337168 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300009012|Ga0066710_103029407 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 653 | Open in IMG/M |
| 3300009012|Ga0066710_104067656 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300009012|Ga0066710_104108595 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 544 | Open in IMG/M |
| 3300009100|Ga0075418_11398466 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300009137|Ga0066709_100909888 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300009137|Ga0066709_101655659 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300009147|Ga0114129_10478244 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
| 3300009553|Ga0105249_11247755 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300010038|Ga0126315_10240570 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300010041|Ga0126312_10319730 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300010042|Ga0126314_10186645 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
| 3300010301|Ga0134070_10264409 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 647 | Open in IMG/M |
| 3300010301|Ga0134070_10294362 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 617 | Open in IMG/M |
| 3300010321|Ga0134067_10045791 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
| 3300010322|Ga0134084_10220374 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 672 | Open in IMG/M |
| 3300010323|Ga0134086_10223261 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300010325|Ga0134064_10136791 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300010325|Ga0134064_10177787 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 751 | Open in IMG/M |
| 3300010326|Ga0134065_10007484 | All Organisms → cellular organisms → Bacteria | 2834 | Open in IMG/M |
| 3300010336|Ga0134071_10494313 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 631 | Open in IMG/M |
| 3300010361|Ga0126378_12488311 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 591 | Open in IMG/M |
| 3300010362|Ga0126377_12035853 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 650 | Open in IMG/M |
| 3300010366|Ga0126379_12286823 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 641 | Open in IMG/M |
| 3300010373|Ga0134128_11461425 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300010398|Ga0126383_10040923 | All Organisms → cellular organisms → Bacteria | 3781 | Open in IMG/M |
| 3300010398|Ga0126383_12686509 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 581 | Open in IMG/M |
| 3300011269|Ga0137392_10202997 | All Organisms → cellular organisms → Bacteria | 1622 | Open in IMG/M |
| 3300011271|Ga0137393_11323618 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 609 | Open in IMG/M |
| 3300012200|Ga0137382_10454129 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300012201|Ga0137365_10263749 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300012201|Ga0137365_10965624 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300012202|Ga0137363_10108045 | All Organisms → cellular organisms → Bacteria | 2127 | Open in IMG/M |
| 3300012203|Ga0137399_10443478 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300012205|Ga0137362_10290334 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
| 3300012205|Ga0137362_10468361 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300012205|Ga0137362_10610811 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300012206|Ga0137380_10624670 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300012206|Ga0137380_11198790 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300012207|Ga0137381_10115329 | All Organisms → cellular organisms → Bacteria | 2289 | Open in IMG/M |
| 3300012209|Ga0137379_11397413 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300012210|Ga0137378_10356801 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300012210|Ga0137378_10419176 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300012211|Ga0137377_11945544 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 504 | Open in IMG/M |
| 3300012285|Ga0137370_10193281 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300012285|Ga0137370_10718517 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 620 | Open in IMG/M |
| 3300012356|Ga0137371_10365551 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300012356|Ga0137371_11005020 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300012358|Ga0137368_10220386 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| 3300012360|Ga0137375_10041644 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 5097 | Open in IMG/M |
| 3300012582|Ga0137358_10214728 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300012903|Ga0157289_10439854 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 500 | Open in IMG/M |
| 3300012915|Ga0157302_10035378 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300012922|Ga0137394_11125303 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 649 | Open in IMG/M |
| 3300012929|Ga0137404_10195609 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
| 3300012929|Ga0137404_11280598 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 675 | Open in IMG/M |
| 3300012930|Ga0137407_10367143 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300012930|Ga0137407_11105909 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300012930|Ga0137407_12388151 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 505 | Open in IMG/M |
| 3300012944|Ga0137410_11661980 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 561 | Open in IMG/M |
| 3300012957|Ga0164303_10061988 | All Organisms → cellular organisms → Bacteria | 1708 | Open in IMG/M |
| 3300012971|Ga0126369_13506200 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 514 | Open in IMG/M |
| 3300012977|Ga0134087_10227933 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300012977|Ga0134087_10439461 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 644 | Open in IMG/M |
| 3300012977|Ga0134087_10599048 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 570 | Open in IMG/M |
| 3300012985|Ga0164308_10150844 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
| 3300014150|Ga0134081_10096601 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300014154|Ga0134075_10425398 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 588 | Open in IMG/M |
| 3300014157|Ga0134078_10046685 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
| 3300014157|Ga0134078_10196939 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300014325|Ga0163163_11518040 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300014325|Ga0163163_12258599 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 603 | Open in IMG/M |
| 3300015356|Ga0134073_10252738 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 609 | Open in IMG/M |
| 3300015374|Ga0132255_101555781 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300016422|Ga0182039_12136993 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 516 | Open in IMG/M |
| 3300017654|Ga0134069_1311692 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 560 | Open in IMG/M |
| 3300017656|Ga0134112_10187721 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300018027|Ga0184605_10000646 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 10548 | Open in IMG/M |
| 3300018027|Ga0184605_10011687 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 3370 | Open in IMG/M |
| 3300018051|Ga0184620_10325618 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300018051|Ga0184620_10331632 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 515 | Open in IMG/M |
| 3300018071|Ga0184618_10348471 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 631 | Open in IMG/M |
| 3300018076|Ga0184609_10272397 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300018433|Ga0066667_10718261 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300018433|Ga0066667_11930078 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 540 | Open in IMG/M |
| 3300018482|Ga0066669_10056343 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2518 | Open in IMG/M |
| 3300019868|Ga0193720_1000556 | All Organisms → cellular organisms → Bacteria | 4606 | Open in IMG/M |
| 3300019881|Ga0193707_1016630 | All Organisms → cellular organisms → Bacteria | 2455 | Open in IMG/M |
| 3300019886|Ga0193727_1057574 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300019888|Ga0193751_1238098 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 573 | Open in IMG/M |
| 3300019996|Ga0193693_1008212 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2176 | Open in IMG/M |
| 3300020004|Ga0193755_1048692 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300020004|Ga0193755_1218269 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 532 | Open in IMG/M |
| 3300020010|Ga0193749_1031603 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300020018|Ga0193721_1161562 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300021078|Ga0210381_10374123 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300021560|Ga0126371_11825286 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300022694|Ga0222623_10343730 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 570 | Open in IMG/M |
| 3300024186|Ga0247688_1101699 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 500 | Open in IMG/M |
| 3300024232|Ga0247664_1120820 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300025910|Ga0207684_10248972 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
| 3300025930|Ga0207701_11580791 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300025931|Ga0207644_10158485 | All Organisms → cellular organisms → Bacteria | 1757 | Open in IMG/M |
| 3300025939|Ga0207665_11256282 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 591 | Open in IMG/M |
| 3300025945|Ga0207679_10574770 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300026078|Ga0207702_10998293 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300026323|Ga0209472_1209083 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300026323|Ga0209472_1275956 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 536 | Open in IMG/M |
| 3300026325|Ga0209152_10300125 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 601 | Open in IMG/M |
| 3300026327|Ga0209266_1192033 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300026328|Ga0209802_1071993 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
| 3300026342|Ga0209057_1117791 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300026343|Ga0209159_1214547 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 600 | Open in IMG/M |
| 3300026446|Ga0257178_1051136 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 540 | Open in IMG/M |
| 3300026523|Ga0209808_1030514 | All Organisms → cellular organisms → Bacteria | 2598 | Open in IMG/M |
| 3300026529|Ga0209806_1193355 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 718 | Open in IMG/M |
| 3300026529|Ga0209806_1338828 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 504 | Open in IMG/M |
| 3300026530|Ga0209807_1007402 | All Organisms → cellular organisms → Bacteria | 5435 | Open in IMG/M |
| 3300026537|Ga0209157_1339351 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300026538|Ga0209056_10294997 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300026538|Ga0209056_10326965 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300026538|Ga0209056_10492627 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300026538|Ga0209056_10722625 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 505 | Open in IMG/M |
| 3300026547|Ga0209156_10074988 | All Organisms → cellular organisms → Bacteria | 1726 | Open in IMG/M |
| 3300027364|Ga0209967_1005351 | All Organisms → cellular organisms → Bacteria | 1721 | Open in IMG/M |
| 3300027512|Ga0209179_1153454 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300027655|Ga0209388_1043862 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300027846|Ga0209180_10606293 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 604 | Open in IMG/M |
| 3300028707|Ga0307291_1030629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1257 | Open in IMG/M |
| 3300028796|Ga0307287_10195306 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 768 | Open in IMG/M |
| 3300028819|Ga0307296_10089050 | All Organisms → cellular organisms → Bacteria | 1649 | Open in IMG/M |
| 3300028819|Ga0307296_10490791 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 672 | Open in IMG/M |
| 3300030917|Ga0075382_11559209 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300031231|Ga0170824_101119204 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300031231|Ga0170824_114032363 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 554 | Open in IMG/M |
| 3300031740|Ga0307468_102175091 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300031820|Ga0307473_11396427 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 527 | Open in IMG/M |
| 3300031820|Ga0307473_11450741 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300031942|Ga0310916_10374633 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300031945|Ga0310913_10432973 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300031996|Ga0308176_11940236 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 629 | Open in IMG/M |
| 3300032174|Ga0307470_11805452 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300032180|Ga0307471_101485724 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300032205|Ga0307472_101404063 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 677 | Open in IMG/M |
| 3300032205|Ga0307472_101570925 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 645 | Open in IMG/M |
| 3300032261|Ga0306920_100635343 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
| 3300032261|Ga0306920_102234140 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 21.65% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 9.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.64% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.61% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.09% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.06% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.55% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.03% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.03% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.03% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.03% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.52% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.52% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.52% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.52% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.52% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000709 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA F1.4 TB amended with BrdU and acetate no abondance | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019868 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300019996 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300030917 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_02064490 | 2088090014 | Soil | VDFVRPWRVIRFFDHDDLREMESRLAGQPIARGEVICLAEI |
| F62_03436280 | 2170459010 | Grass Soil | TRSELAEFVRPWRVIRFFDHNDLREIESELADEVIARGEVICLAEI |
| AF_2010_repII_A1DRAFT_101606481 | 3300000597 | Forest Soil | KRGEPFLWGSTRGELVDVVRPWQVIRFFDDDDLRKERADESIAKGEVICLAEI* |
| KanNP_Total_F14TBDRAFT_10255571 | 3300000709 | Soil | EPFLWARTRDELADLVGPWHIVRFFDYDDLRQMEPGLTNEPIAKGEVICLAEA* |
| AF_2010_repII_A001DRAFT_101281821 | 3300000793 | Forest Soil | EPFLWGSTQSELGKIIRPWRVNRFFDHNDLREMASDLSDEVIAKGEVICLAAI* |
| JGI1027J12803_1075382352 | 3300000955 | Soil | RGEPFLWGTTRSELVDLVSPWRVIRFFDHDDLRELRSGLADEPLAKGEVICL |
| JGI1027J12803_1085664242 | 3300000955 | Soil | LWGTTRSELAEFIRPWRVIRFFDHNDLQKIGSETLKEVIANGEVICLAEI* |
| JGI25382J43887_103303692 | 3300002908 | Grasslands Soil | TRGELVDLMRPWRVIRFFDHDNLRELGPGLADEPIAKGEVICLAEI* |
| Ga0063356_1012673562 | 3300004463 | Arabidopsis Thaliana Rhizosphere | IGDFIQPWRVIRFFDHNDLREFDSELPDEVIAKGEVICLAAI* |
| Ga0062592_1002346431 | 3300004480 | Soil | SELADLVRPWHIVRFFDHDDFRQTQTGLADQPIAKGEVICLAEV* |
| Ga0066684_102034431 | 3300005179 | Soil | SELAEIVRPWRVIRFFDHNDPGKIGSEALEEGIAKGELICLAEI* |
| Ga0066684_108905782 | 3300005179 | Soil | TRSELVEVVRPWRILRFFDHNDLREMESELTDESIARGEVICLAEI* |
| Ga0066676_100400391 | 3300005186 | Soil | GEPFLWGATRSELVDLVRPWHVARFFDHDDLRNLGSGLANERIAKGEVICLAES* |
| Ga0065712_104611211 | 3300005290 | Miscanthus Rhizosphere | VDFVRPWRVTRFFDHNDLRKIAYGLADQHIAKGEVICLAEIGPA* |
| Ga0065707_100065401 | 3300005295 | Switchgrass Rhizosphere | EPFLWGTTRSELVDLVRPWRVARFFDHDDLRALASGLTAEPIAKGEVICLAEA* |
| Ga0066388_1026650321 | 3300005332 | Tropical Forest Soil | LWGTTRNDLVEFIRPWRLIRFFDHNDLQALEPDLSDEIIAKGEVICLAAI* |
| Ga0070708_1016082411 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | DELVDLVRPWQIIRFFDHDDLRKEFALADEPIAKGEVICLAEI* |
| Ga0066686_103151691 | 3300005446 | Soil | FLWGTTRDELVQLVRPWHVIRVFDHNDLRQIESGLGDERIAKGELICLAEI* |
| Ga0066689_109524152 | 3300005447 | Soil | GEPFVWGSTRDELVDLVRPWQIIRFFDHDDLRKEFALADEPIAKGEVICLAEI* |
| Ga0066681_102206852 | 3300005451 | Soil | RSELAEFIRPWRVIRFFDHDDLRDMESDLSGEIIAKGEVICLAAI* |
| Ga0070678_1022640061 | 3300005456 | Miscanthus Rhizosphere | FIQPWRVIRFVDHNDLRKTESELTDEVIARGEVICLAAI* |
| Ga0070685_115680641 | 3300005466 | Switchgrass Rhizosphere | RDELAEFIRPWRVIRFFDHNDLRDMATDLSDEIIAKGEVICLAAI* |
| Ga0070684_1002715272 | 3300005535 | Corn Rhizosphere | EFIRPWRVIRFFDHNDLRDMATDLSDEIIAKGEVICLAAI* |
| Ga0070665_1016159681 | 3300005548 | Switchgrass Rhizosphere | NVSPWRVIRFFDHNDLRDMQSDLSGEIIAKGEVICLAGI* |
| Ga0066701_100654991 | 3300005552 | Soil | DLMRPWRVIRFFDHDNLRELGPGLADEPIAKGEVICLAEI* |
| Ga0066692_101101931 | 3300005555 | Soil | FLWGTTRSELVDLVRPWRVIRFFDRNDLRKMESGLTDEPIARGEVICLAEI* |
| Ga0066692_102182472 | 3300005555 | Soil | WRIIRFFDHDDLRRLESGLTDEPIARGEVICLAEI* |
| Ga0066692_104115511 | 3300005555 | Soil | FLWGTTRSELVDLVRPWRVIRFFDRNDLRKMESGLTDEPIAKGEVICLAEI* |
| Ga0066698_107283392 | 3300005558 | Soil | LWGTTRSELVDLVRPWRVIRFFDHDDLRKMESGLADKPIAKGEVICLAEI* |
| Ga0066700_104202471 | 3300005559 | Soil | ELAEFIGPWRVIRFFDDNYFRDMQSELADEVIAKGEVICLAEI* |
| Ga0066670_105882132 | 3300005560 | Soil | TTRDELVQLVRPWHVIRVFDHNDLRQIESGLGDERIAKGELICLAEI* |
| Ga0066703_100264323 | 3300005568 | Soil | RSELAEFIRPWRVIRFFDHNDLRDMASDLSDEIIAKGEVICLAVI* |
| Ga0066703_100886191 | 3300005568 | Soil | LWGSTRGELVDLLRPWRVIRFFDHDDLRDMESGLTNESIARGEVICLAEI* |
| Ga0066703_100987262 | 3300005568 | Soil | ELVDLMRPWRVIRFFDHDNLRELGPGLADEPIAKGEVICLAEI* |
| Ga0066702_100344441 | 3300005575 | Soil | RFFDDHDLRKLGSGLADTSIAKGEVICLAESSPD* |
| Ga0068856_1005725942 | 3300005614 | Corn Rhizosphere | FLWGSTRSELAAFVRPWRVIRFFDHTNLRDLHSELADEAIAKGEVICLAEI* |
| Ga0070702_1012284681 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | EPFLWGTTRSELAEFIRPWRVNRFFDHNNLREIESELTDEVIAKGEVICLAEI* |
| Ga0066905_1020486881 | 3300005713 | Tropical Forest Soil | RPWRAIRFFDHNDLRKIQSELANEVIAKGEVICLAEN* |
| Ga0066905_1023412552 | 3300005713 | Tropical Forest Soil | ELDEVIRPWRVIRFFDHKDLRDMEPGLCDETLAKGEVICLAAI* |
| Ga0070717_112797731 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | EPFLWGTTRSELAGSIQPWRVIRFFDHNDLRKIESELADEIIAKGEVICLAAI* |
| Ga0066651_108342102 | 3300006031 | Soil | LVHLVRPWRVARFFDHDDLRNLGSGLTNERIAKGEVICLAQS* |
| Ga0066653_103129702 | 3300006791 | Soil | PWRVARFFDHDDLRNLGSGLANEGIAKGEVICLAES* |
| Ga0066665_108595041 | 3300006796 | Soil | LVESVRPWRILRFFNHDDLREMELELTDKPIARGEVICLAEI* |
| Ga0066665_111022232 | 3300006796 | Soil | KVNLLAIRPWSVIAFFDHDNLRVESGLADEQIAKNEVICLAEI* |
| Ga0066665_116025311 | 3300006796 | Soil | VDFVRPWHVIRFFDHGDLREMESGLADEPIARGEVICLAEI* |
| Ga0075435_1016471671 | 3300007076 | Populus Rhizosphere | PWRVIRFFDHNDLRDMESDLSDEVIAKGEVICLAEI* |
| Ga0099793_100150303 | 3300007258 | Vadose Zone Soil | RPWQIIRFFDHDDLRKEFALADEPIAKGEVICLAEI* |
| Ga0099793_103371681 | 3300007258 | Vadose Zone Soil | EFIRPWRVIRFFDHNGLRDTESDLSGQIIAKGEVICLAAI* |
| Ga0066710_1030294071 | 3300009012 | Grasslands Soil | RRGEPFLWGTTGRELVDHARPWRINRILDHDDLRQMESGLTADQRIAKGEVICLAEI |
| Ga0066710_1040676561 | 3300009012 | Grasslands Soil | TTRSELAEIVRPWRVIRFFDHNDLGKIGSEPLEEGIAKGELIWLAEI |
| Ga0066710_1041085951 | 3300009012 | Grasslands Soil | FLWGTTRSELVDLVRPWRVIRFFDHDDLRKMESGLADKPIAKGEVICLAEI |
| Ga0075418_113984662 | 3300009100 | Populus Rhizosphere | ELAEFIRPWRVIRFFDHNDLRDVESDLSGEIIAKGEVICLAVI* |
| Ga0066709_1009098882 | 3300009137 | Grasslands Soil | FVRPWRVIRFFDQYDLRRMESGLADEAIATGEVICLAEI* |
| Ga0066709_1016556592 | 3300009137 | Grasslands Soil | LWGTTRSDLVDFVRQWRITRFFDHNDLRKIAYGLADQHIAKGEVICLAEVGPA* |
| Ga0114129_104782442 | 3300009147 | Populus Rhizosphere | WGATRSELVNCVRPWHVVRFFDHNGLRELAPGLTAESIAKGEAICLAES* |
| Ga0105249_112477551 | 3300009553 | Switchgrass Rhizosphere | SELVDLVRPWRVARFFDHDDLRNLGSGLANERIAKGEVICLAES* |
| Ga0126315_102405702 | 3300010038 | Serpentine Soil | MRPWHVIRFFDHNDLRKMESAVPDEVLAKGEVICLAAI* |
| Ga0126312_103197302 | 3300010041 | Serpentine Soil | RPWHVVRFFDHNDLRKMESAVTDEVLAKGEVICLAAI* |
| Ga0126314_101866451 | 3300010042 | Serpentine Soil | ADVVRPWHVIRFVDDLREMEPQLAGESVAKGEVICLAEI* |
| Ga0134070_102644092 | 3300010301 | Grasslands Soil | MWETTRHELVEFVRPWRILRFFNHDDLREMELELTDKPIARGEVICLAEI* |
| Ga0134070_102943622 | 3300010301 | Grasslands Soil | TTRDELVDLVRPWTMIRFFDHDNLRELGPGLADEPIAQGEVICLAEI* |
| Ga0134067_100457912 | 3300010321 | Grasslands Soil | EPFLWGTTRSELVDLVRPWRVIRFFDHDDLRKMESELADQPIARGEVICLAEI* |
| Ga0134084_102203742 | 3300010322 | Grasslands Soil | WRVIRFFDHDDLRDVASDLSDEIIAKDEVICLAVI* |
| Ga0134086_102232612 | 3300010323 | Grasslands Soil | PWRVIRFFDHDDLRRLESGLTDEPIARGEVICLAEI* |
| Ga0134064_101367912 | 3300010325 | Grasslands Soil | VGSTRDELVDLVRPWQIIRFFDHDDLRKEFALADESIAKGEVICLAEI* |
| Ga0134064_101777871 | 3300010325 | Grasslands Soil | FVWGTTRSDLVELVRPWRIVRFFDHDDLRQMIAGVADEPLARGEVICLAEI* |
| Ga0134065_100074841 | 3300010326 | Grasslands Soil | TTRSELVDLVRPWQVVRFFDHDDLRELTSGLADEPLAKGEVICLAEA* |
| Ga0134071_104943132 | 3300010336 | Grasslands Soil | FLWGTKRSELAEFIRPWRVIRFFDHDDLQDMESDLSGEIIAKGEVICLAAI* |
| Ga0126378_124883112 | 3300010361 | Tropical Forest Soil | GEPFLWGTTRSELAEFIRPWRVIRFFDHNDQRSIELKLGDEFIAKGEVICLAQI* |
| Ga0126377_120358532 | 3300010362 | Tropical Forest Soil | ELAEFITPWRVIRFFDHNDLRKTESELADEVIARGEVICLAEI* |
| Ga0126379_122868232 | 3300010366 | Tropical Forest Soil | FIRPWRVIRFFDHNDLRNMESKLSEEVVAKGEVICLAQI* |
| Ga0134128_114614252 | 3300010373 | Terrestrial Soil | FIRPWRVIRFFDHNDLRDMATNLSDEIIAKGEVICLAAI* |
| Ga0126383_100409234 | 3300010398 | Tropical Forest Soil | RPWRVIRFFDHDDLRQMHSGRADEVIAKGEVICLAEI* |
| Ga0126383_126865091 | 3300010398 | Tropical Forest Soil | LVCPWRVVRFFDYRDLRELGPDLSDESIAKGEVICLAEI* |
| Ga0137392_102029971 | 3300011269 | Vadose Zone Soil | FVRPWRVIRFFNHDDLREMESRLAGQPIARGEVICLAEI* |
| Ga0137393_113236181 | 3300011271 | Vadose Zone Soil | RGEPFLWGTTRGELVDFVRPWHVIRFFDHDDLREIESGLADEPIARGEVICLAEI* |
| Ga0137382_104541291 | 3300012200 | Vadose Zone Soil | FIRPWRVIRFFDHNDLRDMESDLSDEIIAKGEVICLAAI* |
| Ga0137365_102637493 | 3300012201 | Vadose Zone Soil | TRGELVGFVAPWRVARFFDHSDFRDLASGLTAEPVAQGEVICLAES* |
| Ga0137365_109656241 | 3300012201 | Vadose Zone Soil | SKRGEPFVWGSTRDELVDLVRPWQIIRFFDHDDLGKEFALADEPIAKGEVICLAEI* |
| Ga0137363_101080453 | 3300012202 | Vadose Zone Soil | PWRVIRFFDHNDLRDMASDLSDEIIAKGEVICLAVI* |
| Ga0137399_104434782 | 3300012203 | Vadose Zone Soil | RGELVDLVRPWRVIRFFDHDDLREMESGLTNESIARGEVICLAEI* |
| Ga0137362_102903341 | 3300012205 | Vadose Zone Soil | PFLWGTTRSELAEFIQPWRVIRFFDHDDLRDMASDLSDEIIAKGEVICLAVI* |
| Ga0137362_104683612 | 3300012205 | Vadose Zone Soil | ELVDLVRPWRVIRFFDHDDLREMESGLTDESIATGEVICLAEI* |
| Ga0137362_106108112 | 3300012205 | Vadose Zone Soil | ELVDLVRPWRVARFFDHDDLRELRSGMADEPLAKGEVICLAEA* |
| Ga0137380_106246701 | 3300012206 | Vadose Zone Soil | CVIRFFDHDNLRELGPGLADEPIAKGEVICLAEI* |
| Ga0137380_111987902 | 3300012206 | Vadose Zone Soil | RSELAEFIRPWRVIRFFDHDDLQDMESDLSGEIIAKGEVICLAAI* |
| Ga0137381_101153291 | 3300012207 | Vadose Zone Soil | DLVELVRPWRIVRFFDHDDLREMESGLADEPIARGEVICLAEI* |
| Ga0137379_113974132 | 3300012209 | Vadose Zone Soil | WRVIRFFDHDDLRNMESDLSDEIIAKGEVICLAEI* |
| Ga0137378_103568012 | 3300012210 | Vadose Zone Soil | RHGEPFLWGPTRDELVELVRPWRVVRFFDHSDLREMETGLADQLIARGEVICLAEI* |
| Ga0137378_104191762 | 3300012210 | Vadose Zone Soil | ELVDLVRPWRVVRFFDHDDLRELTSGLADEPLAKGEVICLAEA* |
| Ga0137377_119455442 | 3300012211 | Vadose Zone Soil | FLWGTTRSELAEFIRPWRVIRFFDHNDLRNMESDLSGEIIAKGEVICLAAI* |
| Ga0137370_101932811 | 3300012285 | Vadose Zone Soil | RSELVEFIQPWRVLRFFDHNDLRKIEPELSDEVIAKGEVICLAAI* |
| Ga0137370_107185172 | 3300012285 | Vadose Zone Soil | LHKRGESFVWGTTRSDLVELVRPWRIVRFFDHDDLRQMIAGLADEPIARGEVICLAEI* |
| Ga0137371_103655511 | 3300012356 | Vadose Zone Soil | HVIRFFDHDDLREMESGLADEAIAKGEVICLAEI* |
| Ga0137371_110050201 | 3300012356 | Vadose Zone Soil | PFVWGSTRDELVDLVHPWQIIRFFDHDDLGKEFARADEPIAKGEVICLAEI* |
| Ga0137368_102203861 | 3300012358 | Vadose Zone Soil | PWRILRFFNHDDLREMESELTDKPIARGEVICLAEI* |
| Ga0137375_100416441 | 3300012360 | Vadose Zone Soil | GEPFVWGTTRSELVHLVRPWRVARFFDHDDFRNLGSGLANERIAKGEVICLAES* |
| Ga0137358_102147281 | 3300012582 | Vadose Zone Soil | RSDLVDFVRPWRITRFFDHNDLRKIAYGLADQHIAKGEVICLAEVGPA* |
| Ga0157289_104398542 | 3300012903 | Soil | WPVIRFFDHGDLREMDSGLTDEVIAKGEVICLAEI* |
| Ga0157302_100353781 | 3300012915 | Soil | LAAFVRPWRVIRFFDHRDLRGLDSELADKTIAKGEVICLAEI* |
| Ga0137394_111253032 | 3300012922 | Vadose Zone Soil | WGTTRSDLVDFVRPWRITRFFDHNDLRKIAYGLADQHIAKGEVICLAEIGPA* |
| Ga0137404_101956092 | 3300012929 | Vadose Zone Soil | VDLVRPWRVIRFFDHDDLREMESGLTNESIARGEVICLAEI* |
| Ga0137404_112805982 | 3300012929 | Vadose Zone Soil | WRIVRFFDHDDLRQMKSGLADEPIARGEVICLAEI* |
| Ga0137407_103671432 | 3300012930 | Vadose Zone Soil | DLVRPWRVARFFDHDDLRELISGLADEPLAKGEVICLAEA* |
| Ga0137407_111059092 | 3300012930 | Vadose Zone Soil | ELANIVSPWRVIRIFDHDDLRQMHSGCADEVIAKGEVICLAEI* |
| Ga0137407_123881511 | 3300012930 | Vadose Zone Soil | SELVHLVRPWRVTRFFDHDDPRSLGSGLANERIAKGEVICLAES* |
| Ga0137410_116619801 | 3300012944 | Vadose Zone Soil | EPFLWGSTRGELVDLVRPWRVIRFFDHDDLREMESGLTDESIARGEVICLAEI* |
| Ga0164303_100619882 | 3300012957 | Soil | RSDLVDFVRPWRVIRFFDHNDLRIIASGLADQHIAKGEVICLAETELA* |
| Ga0126369_135062001 | 3300012971 | Tropical Forest Soil | WRVIRFFDHRDLRELGPDLSDESIAKGEVICLAEI* |
| Ga0134087_102279332 | 3300012977 | Grasslands Soil | VEFVRPWRVIRFFDHNDLRKIGSARIDEAIAKGEVICLAAI* |
| Ga0134087_104394611 | 3300012977 | Grasslands Soil | PFLWGTTRSELVDLVRPWQVVRFSDHDDLRELTSGLAGEPLAKGEVICLAEA* |
| Ga0134087_105990481 | 3300012977 | Grasslands Soil | RPWRVIRFFDQYDLRRMESGLADEAIATGEVICLAEI* |
| Ga0164308_101508441 | 3300012985 | Soil | GEPFLWGTTRSELAEFIRPWRVIRFFDHTDLRTMESDLSDEVIAKGEVICLAAI* |
| Ga0134081_100966012 | 3300014150 | Grasslands Soil | VEFVRPWRVIRFFDHADLRRMKSGLADEAIATGEVICLAEI* |
| Ga0134075_104253981 | 3300014154 | Grasslands Soil | MRGESFLWGTTRDELAELIRPWRVVRFFDHDDLRQIKSGLADEPIARGEVICLAEI* |
| Ga0134078_100466852 | 3300014157 | Grasslands Soil | WRVIRFFDRNDLRKMESGLTDEPIARGEVICLAEI* |
| Ga0134078_101969392 | 3300014157 | Grasslands Soil | PPWRVIRFFDHNDLRNMESDLSDEIIAKGEVICLAAI* |
| Ga0163163_115180402 | 3300014325 | Switchgrass Rhizosphere | WRMIRFFDHNDLRGIESELGDEVIAKGEVICLAEI* |
| Ga0163163_122585992 | 3300014325 | Switchgrass Rhizosphere | LAEFIRPWRVILFFGHNDLRDMATDLSDEIIAKGEVICLAAI* |
| Ga0134073_102527381 | 3300015356 | Grasslands Soil | LARPWRVVRFFDHNDLRGLGSVLADEPIAKGEVICLAEI* |
| Ga0132255_1015557812 | 3300015374 | Arabidopsis Rhizosphere | ELADIIRPWRVIRFFDHNDLRDIESELSNEIIAQGEVICLAAI* |
| Ga0182039_121369932 | 3300016422 | Soil | WLNRRGESFVWATTRSDLVELARPWRIVRFFDHDDLRQMTAGLADEPIARGEVICLAEI |
| Ga0134069_13116921 | 3300017654 | Grasslands Soil | GRGEPFLWGTTRGELVDLMRPWCVIRFFDHDNLRELGPGLADEPIAKGEVICLAEI |
| Ga0134112_101877212 | 3300017656 | Grasslands Soil | VDLVRPWRVVRFFDHDDLRELTSGLADEPLAKGEVICLAEA |
| Ga0184605_1000064610 | 3300018027 | Groundwater Sediment | DLVHPWRATRFFDHDDLRKVESGLADEPIAKGEVICLAGI |
| Ga0184605_100116871 | 3300018027 | Groundwater Sediment | RRGEPFLWGSTRGELVDLVRPWRVIRFFDHDDLREMESGLINESIARGEVICLAEI |
| Ga0184620_103256182 | 3300018051 | Groundwater Sediment | IRPWRVIRFFDHNDLRDMESDLSDEIIAKGEVICLAAI |
| Ga0184620_103316321 | 3300018051 | Groundwater Sediment | RPWRVIRFFDHDDLREIESGLTDESIARGEVICLAEI |
| Ga0184618_103484712 | 3300018071 | Groundwater Sediment | LWGSTRGELVDLVRPWRVIRFFDHDDLREMESGLTDESIARGEVICLAEI |
| Ga0184609_102723972 | 3300018076 | Groundwater Sediment | PFLWGTTRSELAEFILPWRVIRFSDHNDLRDMESDLSDEVIAKGEVICLAEI |
| Ga0066667_107182612 | 3300018433 | Grasslands Soil | GEPFLWGTTRSELVDLARPWRVFRFFDHDDLRELTSGLADEPLAKGEVICLAEA |
| Ga0066667_119300781 | 3300018433 | Grasslands Soil | RGEPFLWASTRTALADVVRPWRVIRFVDDLREMEPQLAGEPVAKGEVICLAEI |
| Ga0066669_100563433 | 3300018482 | Grasslands Soil | VRPWQIIRFFDHDDLRKEFVLADEPIAKGEVICLAEI |
| Ga0193720_10005564 | 3300019868 | Soil | WGTTRSDLVELVRPWRIVRFFDHDDLRQVKSGLADELIAKGEVICLSEI |
| Ga0193707_10166301 | 3300019881 | Soil | WRLIRFADHNDLRDMESDLSGEIIAKGEVICLAAI |
| Ga0193727_10575741 | 3300019886 | Soil | PWRVIRFFDHNDLRNMESDLSDEIIAKGEVICLAEI |
| Ga0193751_12380982 | 3300019888 | Soil | RRRGEPFLWGSTRGELVDLVRPWRVIRFFDHDDLREMESGLINESIARGEVICLAEI |
| Ga0193693_10082123 | 3300019996 | Soil | PWRVIRFFDHDDLREMESGLTDESIARGEVICLAEI |
| Ga0193755_10486922 | 3300020004 | Soil | RSDLVELVRPWRVVRFFDHDDLRQMKSGLADEPIARGEVICLAEI |
| Ga0193755_12182692 | 3300020004 | Soil | ELVDLVRPWRVIRFFDHDDLREMESGLTDESIARGEVICLAEI |
| Ga0193749_10316031 | 3300020010 | Soil | PWRVIRFFDHNDLRDMESDLRGEIIAKGEVICLAGI |
| Ga0193721_11615622 | 3300020018 | Soil | EFIRPWRVIRFFDHNDLRDMESDLSDEVIAKGEVICLAEI |
| Ga0210381_103741232 | 3300021078 | Groundwater Sediment | IRPWRVIRFFDHNDLRGMESDLSGEIIAKGEVICLAAI |
| Ga0126371_118252862 | 3300021560 | Tropical Forest Soil | WRVVRFFDHDDLRELADGFTAGPIAKGEVICLAES |
| Ga0222623_103437302 | 3300022694 | Groundwater Sediment | RSELAEFMRPWRVIRFFDHNDLRKIGSAPTDEVIAKGEVICLAEI |
| Ga0247688_11016992 | 3300024186 | Soil | PFLWGSTRNELSEVIQPWRVIRFFDHKDLRGMAPDLSDEIIAKGEVICLAAI |
| Ga0247664_11208201 | 3300024232 | Soil | LWGSTRSELAEIIRPWRVIRFFDHNDLREMASDLSDEIIAKGEVICLAAI |
| Ga0207684_102489722 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LVDLVRPWRVVRFFDHDDLRELASGLTAGPIAKGEVICLAES |
| Ga0207701_115807911 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | GELVDLVRPWRVIRFFDHDDLREMESGLTDESIARGEVICLAEI |
| Ga0207644_101584851 | 3300025931 | Switchgrass Rhizosphere | RPWRVIRFFDHTNLRDLHSELADEAIPKGEVICLAEI |
| Ga0207665_112562821 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | GELAEFIGPWRVIRFFDDNYLRDMQSELADEVIAKGEVICLAEI |
| Ga0207679_105747702 | 3300025945 | Corn Rhizosphere | FLWGAMRSELAAFVRPWRVIRFFDHTNLRDLHSELADEAIAKGEVICLAEI |
| Ga0207702_109982931 | 3300026078 | Corn Rhizosphere | GAMRSELAAFVRPWRVIRFFDHTNLRDLHSELADEAIAKGEVICLAEI |
| Ga0209472_12090831 | 3300026323 | Soil | RPWQIIRFFDHDDLRKEFALADEPIAKGEVICLAEI |
| Ga0209472_12759561 | 3300026323 | Soil | LWGTTRSELAEIVRPWRVIRFFDHNDPGKIGSEALEEGIAKGELICLAEI |
| Ga0209152_103001251 | 3300026325 | Soil | GLIDLMRPWRVIRFFDHDNLRELGPGLADEPIAKGEVICLAEI |
| Ga0209266_11920332 | 3300026327 | Soil | GRGEPFLWGTTRSDLVDLVRPWRVIRFFDHDDLRKMESGLADKPIAKGEVICLAEI |
| Ga0209802_10719932 | 3300026328 | Soil | TTRGELVDVIRLWRIIRFFDHDDLRRLESGLTDEPIARGEVICLAEI |
| Ga0209057_11177912 | 3300026342 | Soil | TRSELADFMPPWRVIRFFDHNDLRNMESDLSDEIIAKGEVICLAAI |
| Ga0209159_12145471 | 3300026343 | Soil | FVRPWRVIRFFDQYDLRRIESGLADEAIATGEVICLAEI |
| Ga0257178_10511362 | 3300026446 | Soil | DFVRPWRVRRFFDHDDLREIDSALADEPLATGEVICLAEI |
| Ga0209808_10305141 | 3300026523 | Soil | LADLVRPWRVLRFFDHNDLSGLGSGLADEPMAQGEVICLAET |
| Ga0209806_11933551 | 3300026529 | Soil | DQLIELVRPWRVIRFFDHDDLRQMESGLADELIAKGEVICLAEI |
| Ga0209806_13388282 | 3300026529 | Soil | ELVDLLRPWRVIRFFDHDDLRDMESGLTNESIARGEVICLAEI |
| Ga0209807_10074026 | 3300026530 | Soil | RPWRVIRFFDHNDPGKIGSEALEEGIAKGELICLAEI |
| Ga0209157_13393512 | 3300026537 | Soil | RPWQIIRFFDHDDLGKEFALADEPIAKGEVICLAEI |
| Ga0209056_102949972 | 3300026538 | Soil | EFVRPWRVIRFFDQYDLRRMESGLADEAIATGEVICLAEI |
| Ga0209056_103269652 | 3300026538 | Soil | WETTRHELVESVRPWRILRFFNHDDLREMELELTDKPIARGEVICLAEI |
| Ga0209056_104926271 | 3300026538 | Soil | AEFIRPWRVIRFFDHDDLRQMHSGSADEVIAKGEVICLAAI |
| Ga0209056_107226251 | 3300026538 | Soil | VRPWRVIRFFDHDDLRKMESELADQPIARGEVICLAEI |
| Ga0209156_100749881 | 3300026547 | Soil | PWRVLRFFDHNDLSGLGSGLADEPMAQGEVICLAET |
| Ga0209967_10053511 | 3300027364 | Arabidopsis Thaliana Rhizosphere | LWGATRSELIDRVRPWRVARFFDHDDLRALASGLTAERIAKGEVICLAEA |
| Ga0209179_11534541 | 3300027512 | Vadose Zone Soil | EPFLWGTTRSELAEFVRPWRVIRFFDHDDLRDMASDLSDEIIAKDEVICLAVI |
| Ga0209388_10438622 | 3300027655 | Vadose Zone Soil | STRDELVDLVRPWQIIRFFDHDDLRKEFALADEPIAKGEVICLAEI |
| Ga0209180_106062931 | 3300027846 | Vadose Zone Soil | GTTRSELAEFIRPWRVIRFFDHDDLRDMESDLSCEIIAKGEVICLAAI |
| Ga0307291_10306293 | 3300028707 | Soil | RNELAEFVRPWRVIRFFDHNDLRDMESDLSGEIIAKGEVICLAEI |
| Ga0307287_101953061 | 3300028796 | Soil | RRGEPFLWAATRTNVVDLVRPWRLSRFFDHNDLSKIAFGLADQPIAKGEVICLAEI |
| Ga0307296_100890502 | 3300028819 | Soil | SDLVELVHPWRIVRFFDHDDLRQMKSGLADEPIARGEVICLAEI |
| Ga0307296_104907912 | 3300028819 | Soil | TTRAELVEFARPWRVARFFDDNDLRELEPTVSNERIATGEVICLAEI |
| Ga0075382_115592092 | 3300030917 | Soil | TTRSELAEFIRPWRVIRFFDHNDLRNMESDLSGEIIAKGEVICLAEI |
| Ga0170824_1011192041 | 3300031231 | Forest Soil | AEFVWPWRVVRFFDHNDLRKMESRYTNENIARGEVICLAGI |
| Ga0170824_1140323632 | 3300031231 | Forest Soil | FLWGTTRSDLVELVRPWRVVRFFDHDDLRQMKSGLADEPIARGEVICLAQI |
| Ga0307468_1021750912 | 3300031740 | Hardwood Forest Soil | GEPFLWGSTRSELIEFIRPWRVIRFFDDKDLRDMESDLSDEIIAKGEVICLAEM |
| Ga0307473_113964271 | 3300031820 | Hardwood Forest Soil | PKYFRPCLEDFRRVMRAHGRGEPFLWGTTRGEVVRLIRPWRVIGFFDHDNFRSMESDLADEPIAKGEVICLAEI |
| Ga0307473_114507412 | 3300031820 | Hardwood Forest Soil | KRREPFVWGSTRDELGDLVRPWQIIRFFDHDDLRKEFALADEPIAKGEVICLAEI |
| Ga0310916_103746332 | 3300031942 | Soil | TTRSDLVELARPWRIVRFFDHDDLRQMTAGLADEPIARGEVICLAEI |
| Ga0310913_104329731 | 3300031945 | Soil | RCGEPFLWGITRSELAQFIRPWRVIRFFDHNDLRDMESDLSYDIIARGEVICLAAI |
| Ga0308176_119402361 | 3300031996 | Soil | ELVEFIQPWRLIRCFDDDDLRKIESELADDVIAKGEVICLAAI |
| Ga0307470_118054521 | 3300032174 | Hardwood Forest Soil | TTRSELAECIRPWRVIRFFDHNDLRDMESDLSGEIIAKGEVICLAVI |
| Ga0307471_1014857241 | 3300032180 | Hardwood Forest Soil | FVWGTTRSDLVELVRPWRIVRFFDHDDLRQMKSGLADEPIAKGEVICLAEI |
| Ga0307472_1014040632 | 3300032205 | Hardwood Forest Soil | DLVELVRPWRIVRFFDHDDLRQMKSGLADEPIAKGEVICLAEI |
| Ga0307472_1015709252 | 3300032205 | Hardwood Forest Soil | LAEFIWPWRVIRFFDHNDLRDMESDLSCEIIAKGEVICLAEI |
| Ga0306920_1006353432 | 3300032261 | Soil | VRPWQIIGFFDHDDLGKEFALADEPIAKGEVICLAEV |
| Ga0306920_1022341402 | 3300032261 | Soil | MTEFIQLWRVIRIFDHDDLCDVESKLADEVIAKGGVICLAAI |
| ⦗Top⦘ |