| Basic Information | |
|---|---|
| Family ID | F027452 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 194 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MQAAMAKRKRHSRVEIATKLAQANDLATQGKLQSEIARTLG |
| Number of Associated Samples | 123 |
| Number of Associated Scaffolds | 194 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 84.02 % |
| % of genes near scaffold ends (potentially truncated) | 95.88 % |
| % of genes from short scaffolds (< 2000 bps) | 92.27 % |
| Associated GOLD sequencing projects | 118 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (73.711 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (36.598 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.093 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.969 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.78% β-sheet: 0.00% Coil/Unstructured: 65.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 194 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 2.06 |
| PF00196 | GerE | 1.55 |
| PF01527 | HTH_Tnp_1 | 1.55 |
| PF00550 | PP-binding | 1.03 |
| PF00293 | NUDIX | 1.03 |
| PF02265 | S1-P1_nuclease | 1.03 |
| PF05014 | Nuc_deoxyrib_tr | 1.03 |
| PF13683 | rve_3 | 1.03 |
| PF01370 | Epimerase | 0.52 |
| PF13340 | DUF4096 | 0.52 |
| PF13384 | HTH_23 | 0.52 |
| PF01695 | IstB_IS21 | 0.52 |
| PF00239 | Resolvase | 0.52 |
| PF06035 | Peptidase_C93 | 0.52 |
| PF00589 | Phage_integrase | 0.52 |
| PF00872 | Transposase_mut | 0.52 |
| PF08308 | PEGA | 0.52 |
| PF03237 | Terminase_6N | 0.52 |
| PF04773 | FecR | 0.52 |
| PF02566 | OsmC | 0.52 |
| PF03737 | RraA-like | 0.52 |
| PF01609 | DDE_Tnp_1 | 0.52 |
| PF00535 | Glycos_transf_2 | 0.52 |
| PF13276 | HTH_21 | 0.52 |
| PF00232 | Glyco_hydro_1 | 0.52 |
| PF03401 | TctC | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 194 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.06 |
| COG3613 | Nucleoside 2-deoxyribosyltransferase | Nucleotide transport and metabolism [F] | 1.03 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.52 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.52 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.52 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.52 |
| COG3672 | Predicted transglutaminase-like protein | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.52 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.52 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.52 |
| COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.52 |
| COG2723 | Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase | Carbohydrate transport and metabolism [G] | 0.52 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.52 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.52 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.52 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.52 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 73.71 % |
| All Organisms | root | All Organisms | 26.29 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 36.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 16.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.49% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.70% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.12% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.58% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.06% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.55% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.03% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.52% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.52% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019996 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_17090911 | 3300000033 | Soil | MAKKRKHAKXEIAGMLAQAXXLAXXGKIQSEIARTLGGKG* |
| INPhiseqgaiiFebDRAFT_1006745103 | 3300000364 | Soil | MAKKRRHSKAEITALLAQADDLARQGKLQSEIART |
| AF_2010_repII_A01DRAFT_10195682 | 3300000580 | Forest Soil | MPKKKRHSRVEIASKLAQANDLATQGKLQSEIARTL |
| AF_2010_repII_A01DRAFT_10402833 | 3300000580 | Forest Soil | MKIEDRRANEVAKKKRHLRVEIATKLAQANGLATQGKLQSDIARTRSV* |
| AF_2010_repII_A01DRAFT_10614792 | 3300000580 | Forest Soil | MATRKKYSEAEIARKLAQANELATQGKLQSEIASTL |
| AF_2010_repII_A1DRAFT_100299014 | 3300000597 | Forest Soil | MGEMQAAIAKRKKHSRVEIATKLAQANDLATQGKLQSEIARTS* |
| AF_2010_repII_A1DRAFT_101346071 | 3300000597 | Forest Soil | MNLGG*KQGAMARQKRHSKVEIATKLAQANDLAGQGKPQSEIARTLG |
| AF_2010_repII_A001DRAFT_101275632 | 3300000793 | Forest Soil | MAKKKRHSRVEIASKLAQANDLAAQGKLQTEIARTLGVS |
| AP72_2010_repI_A001DRAFT_10118143 | 3300000893 | Forest Soil | MQAAMAKKKRHSRVEIASKLAQANELATQGKLQSEIARTLGVTV |
| AP72_2010_repI_A001DRAFT_10671452 | 3300000893 | Forest Soil | MQATMTQKKRHSTVEIATKLAQANDLATQGKLQSEIA |
| JGI11615J12901_131347802 | 3300000953 | Soil | MGRARKQHSRGEIARKLAQANRLARQGKLQSEIARTLGVSVM |
| JGI12627J18819_101724101 | 3300001867 | Forest Soil | MAKKKRHSRAEIASKLTQANDLATQGKLQSEIARTLGV |
| Ga0066398_100590781 | 3300004268 | Tropical Forest Soil | MAQNKRRSRVEIAAKLAQASDLASQGKLQSEIARKLGGAL* |
| Ga0066680_109438261 | 3300005174 | Soil | MGGRTQAAMAKKKRHSRVEIASKLAQANDLATQGKLQSEIAR |
| Ga0066388_1040941361 | 3300005332 | Tropical Forest Soil | MLVAAAGQAAMVRPKRHSRVEVAKKLAQANGLARQGKLQSEIA |
| Ga0008090_101475092 | 3300005363 | Tropical Rainforest Soil | MGRSVVMAKKKHSRVAIAAKLVQANNLARRGKLQSEIART |
| Ga0070710_107024052 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKKRKHPKAEITALLAQADDLARQGKLQSEIARTLGVSVM |
| Ga0070708_1008869842 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKKKRHSKVEIASKLAQAHDLATQQGKLQSDIARTLGVSV |
| Ga0066905_1014221062 | 3300005713 | Tropical Forest Soil | MANKRRHSRAEIATKLAQANELATRGKLQSDIARTL |
| Ga0066903_1005361661 | 3300005764 | Tropical Forest Soil | MTKRKHSRFEIATKLAQANELATRGKLQSEIARTLG |
| Ga0066903_1006130215 | 3300005764 | Tropical Forest Soil | MAKKRRHSRAEIATKLAQANGLATQGKLQSDIARTLGVSV |
| Ga0066903_1008094991 | 3300005764 | Tropical Forest Soil | MEAAMAKKRRHSRAEIATKLAQANGLATQGKLQSDIARTLG |
| Ga0066903_1023359143 | 3300005764 | Tropical Forest Soil | MQAAMAKRKRHSRVEMATKLAQANELATQGKLQSEIAR |
| Ga0066903_1049327772 | 3300005764 | Tropical Forest Soil | MPRKKRHSRVEIATKLMQANDLATQGKLQSEIARTLGV |
| Ga0066903_1050532711 | 3300005764 | Tropical Forest Soil | MGQADIPKRKRHSRVEIATKLAQANDLATQGKLQSEIARTLDVSVM |
| Ga0066903_1067765061 | 3300005764 | Tropical Forest Soil | MAKKKKHSRVEIASKLAQANDLATQGKLQSEIARTLGV |
| Ga0066903_1089765683 | 3300005764 | Tropical Forest Soil | MQAAMVKKRRHSRAEIATKLAQANELATRGKLQSE |
| Ga0070717_101801291 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MNMKGRMQAAMAKKKRHSRVEIASKLAQANDLATQGKLQSEIA |
| Ga0070717_116480171 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MATKKRHSRAEIASKLAQANDLTTRGKLQSEIARAL |
| Ga0066659_115102701 | 3300006797 | Soil | MQAAMAKRKRHSRVEIATKLAQATDLATQGKSQRDIAHTLGVS |
| Ga0075421_1008146192 | 3300006845 | Populus Rhizosphere | MQAAKVKKKRHSRVEIATKLAEANDLAMQGKRRKEIARTLGVSVM |
| Ga0075430_1007506941 | 3300006846 | Populus Rhizosphere | MAKKQRHSKVEIATRLTQANKLARQGKLQSEIARTL |
| Ga0075429_1007674543 | 3300006880 | Populus Rhizosphere | MQAAKVKKKRHSRVEIATKLAEANDLATQGKLQSEIARTLG |
| Ga0075424_1005267491 | 3300006904 | Populus Rhizosphere | MQAAMAKKKRHSRVEVATKLAQATDLATRGKLQSEIARTLGVS |
| Ga0075435_1009158853 | 3300007076 | Populus Rhizosphere | MAKKKNHSTVEIASKLAQANDLATQGKLQSEIART |
| Ga0075418_101327071 | 3300009100 | Populus Rhizosphere | MQAAKVKKKRHSRVEIATKLAEANDLATQGKLQSEIARTLGVS |
| Ga0126380_114369561 | 3300010043 | Tropical Forest Soil | MNMKGRMQAAMAKKKRHSRVEIASKLAQANDLATQGKLQSEIAR |
| Ga0126384_109204412 | 3300010046 | Tropical Forest Soil | MAKKKRHSRVEIASKLAQANDLAAQGKLQTEIARTL |
| Ga0126382_117100881 | 3300010047 | Tropical Forest Soil | MNVGRLNAAAMAKQKRHSRAEIATKLAQANDLARQGKVQSEIA |
| Ga0126370_106767071 | 3300010358 | Tropical Forest Soil | MQAAMDKRKRHSRVEIATKLTQANDLARQGKLQSEIARTLGV |
| Ga0126370_110177201 | 3300010358 | Tropical Forest Soil | MAKKKKHSRAEIASKLAQANDLATQGKLQSEIARTLGVS |
| Ga0126376_111948081 | 3300010359 | Tropical Forest Soil | MAKRKRHSRAEIASKLAQANDLATQGKLQSAIARTLGVSV |
| Ga0126372_106998111 | 3300010360 | Tropical Forest Soil | MAKKKRHSRVEIATKLAQANGLATQGKLQSEIARTL |
| Ga0126378_102072194 | 3300010361 | Tropical Forest Soil | MQAAMAKKKRHSRVEIATKLARANDLATQGKLQSEIAR |
| Ga0126378_127566961 | 3300010361 | Tropical Forest Soil | MQAAKVKKKRHSRVEIATKLAEANDLATQGKLQSEIA |
| Ga0126378_129120791 | 3300010361 | Tropical Forest Soil | MAKKKRHSRAEIASKLAQANDLATQGKQQSEIARAL |
| Ga0126378_133837691 | 3300010361 | Tropical Forest Soil | MNMKGRMQTAMAKKKRHSRVEIASKLAQANDLATQGK |
| Ga0126377_102125091 | 3300010362 | Tropical Forest Soil | MQAAMAKKKRHSRVEIASKLAQANDLATQGKLQSEIARTL |
| Ga0126379_104094881 | 3300010366 | Tropical Forest Soil | MQAAMAKKKRHSRVEIATKLAQANDLATQGKLQSEIAR |
| Ga0126379_106500731 | 3300010366 | Tropical Forest Soil | MAQKKRHSRVEIAAKLAQASDLASQGKLQSEIARKLGGAL* |
| Ga0126379_119934102 | 3300010366 | Tropical Forest Soil | MQAAMAKRKRHTRLEIATKLAQANDLATHGKLQSEIARTLGV |
| Ga0126381_1002718242 | 3300010376 | Tropical Forest Soil | MAQNKRHSRVEIAAKLAQASDLASQGKLQSEIARKLGGAL* |
| Ga0126381_1020127203 | 3300010376 | Tropical Forest Soil | MQAAKVKKKRHSRVEIATNDLATQGKLQSEIARTLGVSVM |
| Ga0126383_107264933 | 3300010398 | Tropical Forest Soil | MSRKEDQMTKKRKHSKAEIAAKLAEADDLVTQGKLQSEIARALGVSVM |
| Ga0126383_109713261 | 3300010398 | Tropical Forest Soil | MAKKKRHSRVEIASKLTRAHDLATQGKLQSEIART |
| Ga0126383_113935932 | 3300010398 | Tropical Forest Soil | MQAAMAQKKRHSRVDIATKLAQANDLATQGKLQSE |
| Ga0126383_116787261 | 3300010398 | Tropical Forest Soil | MARLKRYSRVEVATKLAQANDLARQGKPQSEIART |
| Ga0126383_124753181 | 3300010398 | Tropical Forest Soil | MNVGRLNAAAMAKQKRHSRVEIATKLAQANDLARQGKVQSEIARTL |
| Ga0126383_127033331 | 3300010398 | Tropical Forest Soil | MAKKKRHSRVEIASKLAQANDLATQGKLQTEIARTLG |
| Ga0126383_127167451 | 3300010398 | Tropical Forest Soil | MAKKKRHSRAEIATKLVQANEMATQGKLQSEIARALGVS |
| Ga0126383_128810782 | 3300010398 | Tropical Forest Soil | MQATMTQKKRHSTVEIATKLAQANDLATQGKLQSEIAHTLGVSV |
| Ga0126383_129795841 | 3300010398 | Tropical Forest Soil | MLGSGNKGRRETTRVKRKKHSRAEIASKLTQANELATQGKLQSEIARALGVS |
| Ga0137389_101001243 | 3300012096 | Vadose Zone Soil | MNIGGRTQAAMAKKKRHSKVEIATKLAQANGLATQGKLQSDIARTLGVSVM |
| Ga0137363_106585011 | 3300012202 | Vadose Zone Soil | MNMKGRMQAAMAKKKRHSRVEVASKLAQANDLATQGKLQSEIART |
| Ga0137363_112290331 | 3300012202 | Vadose Zone Soil | MQAAMAKKKRHSRVEIASKLAQANDLATQGKLQSEIA |
| Ga0137374_101970011 | 3300012204 | Vadose Zone Soil | MGKKKRYSRVEIATKLAQANDLAMQGKAQSEIARTLGVS |
| Ga0137362_106471681 | 3300012205 | Vadose Zone Soil | MQAAMAKKKRHSRVEIATKLAQATDLAMQGKSQRE |
| Ga0137361_106934941 | 3300012362 | Vadose Zone Soil | MQAAMAKKKRHSRVEIATKLAQATDLAMQGKSQREIAHTLS |
| Ga0137359_107839361 | 3300012923 | Vadose Zone Soil | MNMKGRMQTAMAKKKRHSRVEIASKLAQANDLATQGKLQSEIARTLGV |
| Ga0162650_1000543781 | 3300012939 | Soil | MRKRKHPKAEIAAKLAQAGDLAAQGKLQSEIARALD |
| Ga0126369_120145941 | 3300012971 | Tropical Forest Soil | MAAGQAAMKRHSRVEVATKLAQANDLARQGKLQSEIARTLGVS |
| Ga0132255_1015329243 | 3300015374 | Arabidopsis Rhizosphere | MAKKAKHSKAEIAAKLAQAGDLATQGKLQSEIARTLGV |
| Ga0182036_106410131 | 3300016270 | Soil | MAAGQAAMKRHSRVEVATKLAQANDLARQGKLQSEIART |
| Ga0182036_111582412 | 3300016270 | Soil | MQASVAKRKRHTRLEIATKLAQANELATQGKLQSEIAR |
| Ga0182041_110444011 | 3300016294 | Soil | MQAAMAQKKRHSRVEIATKLAQANDLATLGKLQSEIAHALGVSV |
| Ga0182035_101860221 | 3300016341 | Soil | MQAKKRRHSRAEIATKLAQANELATRGKLQSDIART |
| Ga0182035_102227174 | 3300016341 | Soil | MQAAMAKRKRHTRLEIATKLAQANELATQGKLQSEIARTLGVS |
| Ga0182035_104308003 | 3300016341 | Soil | MQASVAKRKRHTRLEIATKLAQANELATQGKLQSEIART |
| Ga0182035_117513551 | 3300016341 | Soil | MARRHSRAEIATKLARANELATRGELQSEIARMLGVS |
| Ga0182032_101848091 | 3300016357 | Soil | MQAAMAKKRRHSRAEIATKLAQANELATRGKLQSDIART |
| Ga0182032_118009761 | 3300016357 | Soil | MAKKRHSRVEIATKLAQANGLATQGKLQSDIARTLGV |
| Ga0182032_118135221 | 3300016357 | Soil | MAKKKRHSRVEIASKLAQANDLATQGKLQSEIARTLG |
| Ga0182040_104128533 | 3300016387 | Soil | MQASIAKRKRHTTVEIATKLAQANDLATRGKLQSEI |
| Ga0182040_106584791 | 3300016387 | Soil | MAKKTKHSKAQIAGKLAEANDLAEQGKSQSEIARTLG |
| Ga0182037_100388701 | 3300016404 | Soil | MQAAMAKKKRHSRMEIATKLAQATDLATQGRSQREIAHMLG |
| Ga0182037_102719313 | 3300016404 | Soil | MQAAMAKKRRQSRAEIATKLAQANELATRGKLQSEIAR |
| Ga0182037_115756072 | 3300016404 | Soil | MQASIAKRKRHTRLEIATKLAQANELATQGKLQSDIAR |
| Ga0182037_117868991 | 3300016404 | Soil | MAKKKRHSRAEIATKLAQANGLATQGKLQSDIARTLGV |
| Ga0182039_102951573 | 3300016422 | Soil | MQAAVAKKRRHSRAEIATKLAQANGLARQGKLQSD |
| Ga0182039_111914381 | 3300016422 | Soil | MRAVMAKKKRHSRVEIATKLAQANDLATQGKLQSEIARTLGVS |
| Ga0184620_101123951 | 3300018051 | Groundwater Sediment | MEVDYCAMAKMKRHSKVEIATKLAQANDLMTQGKLQSDIART |
| Ga0184635_101370723 | 3300018072 | Groundwater Sediment | MTTKRKHSRPELAAMLARANEMAAQGKLQSEIANPLGI |
| Ga0066662_121942932 | 3300018468 | Grasslands Soil | MQAAMAKKKRHARVEIASKLAQANDLATQGELQSEIPRTLGVIV |
| Ga0066662_125566241 | 3300018468 | Grasslands Soil | MAKKKRHSRVEIASKLALARDLATQGKLQSEIARALGVSV |
| Ga0193693_10634081 | 3300019996 | Soil | MKKRKHPKAEITTKLAQADDLAAQGKLQSEIARALGKHANL |
| Ga0193696_11159571 | 3300020016 | Soil | MQPAMARKKKHSGMEIATKLAQASDLATQGKLQSEIARTLG |
| Ga0179592_101889514 | 3300020199 | Vadose Zone Soil | MAKKKRHSRVEVATKLAQATDLATRGKLQSEIARRLGV |
| Ga0222621_10690481 | 3300021510 | Groundwater Sediment | MQPAMARKKKHSGMEIATKLAQASDLATQGKLQSE |
| Ga0126371_101126412 | 3300021560 | Tropical Forest Soil | MAQNKRHSRVEIAAKLAQASDLASQGKLQSEIARKLGGAL |
| Ga0126371_104875821 | 3300021560 | Tropical Forest Soil | MARQKRHSKVEIATKLAQANDLAGQGKPQSEIART |
| Ga0126371_123642671 | 3300021560 | Tropical Forest Soil | MAKKRRHSRAEIATKLAQANELATRGKLQSDIARTLGVS |
| Ga0126371_133128582 | 3300021560 | Tropical Forest Soil | MQAAKVKKKRHSRVEIATNDLATQGKLQSEIARTLGVSV |
| Ga0126371_134823461 | 3300021560 | Tropical Forest Soil | MAKKKRHSRVEIATKLAEANDLATQGKLQSEIARTLGVS |
| Ga0209237_12397842 | 3300026297 | Grasslands Soil | MQAAMAKKKKHSRVEIASKLAQANDLATQGKLQSEIART |
| Ga0209388_10804911 | 3300027655 | Vadose Zone Soil | MNMKGRMQAAMAKKKRHSRVEISSKLAQANDLATQGKLQSE |
| Ga0209180_105400121 | 3300027846 | Vadose Zone Soil | MQAAMAKKKRHSRVEIASKLAQANDLATQGKLQSEIAHRL |
| Ga0209465_101020822 | 3300027874 | Tropical Forest Soil | MQAAMAKRKRHSRVEIATKLAQANDLATQGKLQSEIART |
| Ga0209465_106856152 | 3300027874 | Tropical Forest Soil | MAKKKKHSRAEIATKLTQANELVTQGKLQSEIARILGVSV |
| Ga0209488_105696581 | 3300027903 | Vadose Zone Soil | MNMKGRMQAAMAKKKRHSRVEIASKLAQANDLATQGKLQSEI |
| Ga0318541_103617732 | 3300031545 | Soil | MQAAMAKKKRHSRAEIATKLAQANELATRGKLQSEIARMLG |
| Ga0318541_103648312 | 3300031545 | Soil | MANKRRHSRAEIATKLAQANELATRGKLQSDIARTLGVS |
| Ga0318538_100468082 | 3300031546 | Soil | MLVTAAGQAAMAGLKRHSRVEVATKLAQANDLARQGKLESEIART |
| Ga0318538_103046021 | 3300031546 | Soil | MAKKKRHSRVEIATKLAQANGLATQGKLQSDIARTLGVS |
| Ga0318528_100975881 | 3300031561 | Soil | MAKKKRHSRVEIATKLAQANGLATQGKLQSDIARTLGV |
| Ga0318528_107794632 | 3300031561 | Soil | MQAAMTQKKRHSTVEIATKLAQANDLATQGKLQSEIAHTLGVS |
| Ga0318515_100831161 | 3300031572 | Soil | MLVTAAGQAAMAGLKRHSRVEVATKLAQANDLARQGKLESEIARTLGVS |
| Ga0318515_105607441 | 3300031572 | Soil | MAKKTKHSKAQIAGKLAEANDLAEQGKSQSEIARTLGV |
| Ga0318555_101377493 | 3300031640 | Soil | MQAAIAKKKRHSRVEIATKLAQATDLATQGRSQREIAHM |
| Ga0318561_102011951 | 3300031679 | Soil | MQAAMAKRKRHSRVEIATKLAQANDLATQGKLQSEI |
| Ga0318574_102549573 | 3300031680 | Soil | MAKKKRHSRVKIATKLAQANDLTTQGKLQSESARTLGVS |
| Ga0318574_102920082 | 3300031680 | Soil | MQAAMAKRKRHSRVEMATKLAQANDLATQGKLQSEIARTLGVS |
| Ga0318572_103043973 | 3300031681 | Soil | MAKKKRYSRVEIASKLAQANDLATQGKLQSEIARTLGV |
| Ga0318560_102174381 | 3300031682 | Soil | MAKRKRHSRAEIATKLAQANELVTQGKLQSEVARTLGVS |
| Ga0306917_105877563 | 3300031719 | Soil | MQAKKRRHSRAEIATKLAQANELATRGKLQSDIARTL |
| Ga0306917_115698881 | 3300031719 | Soil | MQAAMAKKKRHSRMEIATKLAQATDLATQGRSQREIAHMLGVS |
| Ga0318500_101656352 | 3300031724 | Soil | MNIGGRLQAAMAKKKKHSRVEIASKLAQANDLATQGKLQSEIARTLG |
| Ga0306918_113504621 | 3300031744 | Soil | MAKKRRHSSAEIARKLAHANELATRGKLQSDIART |
| Ga0318502_101114592 | 3300031747 | Soil | MQAAMAKKRRHSRAEIATKLAQANELATRGKLQSDIARTLG |
| Ga0318502_102932541 | 3300031747 | Soil | MAKKKRHSRVEIVSKLAQANDLATQGKLQSEISRTLGVS |
| Ga0318492_104322802 | 3300031748 | Soil | MATKKRHSSVEIATKLAQANKLATQGKLQSEIARTLG |
| Ga0318494_102305091 | 3300031751 | Soil | MAKKKRHSRAEIASKLAQANGLATQGKLQSDIARTLGVS |
| Ga0318554_101060381 | 3300031765 | Soil | MNMKGRMQTAMAKKKRHSRVEIASKLAQANGLATQGKLQSE |
| Ga0318509_107129511 | 3300031768 | Soil | MQAAMAKRKKHSRAEMATKLAQANELATQGKLQSEIA |
| Ga0318546_101171591 | 3300031771 | Soil | MAKKKRHSRVEIASKLAQANDLATQGKLRSEIARTLGVS |
| Ga0318546_109123152 | 3300031771 | Soil | MQAAMPKTKRYARAEIATKLAQANDLAMQGKPQSEIARTLGVS |
| Ga0318543_105802632 | 3300031777 | Soil | MATKKRHSSVEIATKLAQANKLATQGKLQSEIARTLGV |
| Ga0318498_103507301 | 3300031778 | Soil | MAAGQAAMKRHSRVEVATKLAQANDLARQGKLQSEIAR |
| Ga0318547_105503113 | 3300031781 | Soil | MQAAMAKRKRHTRLEIATKLAQANELATQGKLQSEIARTLGVSA |
| Ga0318552_101125334 | 3300031782 | Soil | MAKKKRHSRAEIASKLAQANGLATQGKLQSDIARTL |
| Ga0318552_107323031 | 3300031782 | Soil | MAKKKRHSRAEVATKLAQANELATQGKLQSEIARTLGVS |
| Ga0318529_101042573 | 3300031792 | Soil | MARRHSMVEIATKLAQANDLARQGKLQSEIARTLGVS |
| Ga0318523_102761131 | 3300031798 | Soil | MAKKRRHSRAEIATKLARANELATRGELQSEIARMLGVS |
| Ga0318565_103923291 | 3300031799 | Soil | MQAAMAKRKRHSRVEIATKLAQANDLATQGKLQSEIAR |
| Ga0318497_102250261 | 3300031805 | Soil | MQAAMAKRKKHSRAEMATKLAQANELATQGKLQSEIARRLGVSV |
| Ga0318497_106156961 | 3300031805 | Soil | MQASIAKRKRHTRLEIATKLAQANELATQGKLQSDIARTLGVSV |
| Ga0318567_101857441 | 3300031821 | Soil | MAKKKRHSRVEIASKLAQANDLATQGKLQSEIART |
| Ga0318499_100718501 | 3300031832 | Soil | MAKKKRHSGAEIATKLAQANDLARRGRLQSEIART |
| Ga0310917_100860981 | 3300031833 | Soil | MQAKKRRHSRAEIATKLAQANELATRGKLQSDIAR |
| Ga0318495_102758011 | 3300031860 | Soil | MQAAMAKRKKHSRAEMATKLAQANELATQGKLQSEIARR |
| Ga0318495_104405052 | 3300031860 | Soil | MAKKTRYSRAEIATKLAQANELATQGKLQSEIARTLGVSVM |
| Ga0306919_100353231 | 3300031879 | Soil | MQAAMAKRKRHSRVEIATKLAQANDLATQGKLQSEIARTL |
| Ga0306919_109914801 | 3300031879 | Soil | MPKKKRHSRVEIATKLAQANDLATQGKLQREIARSLGV |
| Ga0306925_102221101 | 3300031890 | Soil | MQAAMPKRKRHSRLEIATKLAQADELATQGKLQSEIAR |
| Ga0306925_108417053 | 3300031890 | Soil | MQAVMAKKKKHSRVEIAAKLAQANDLATQGKLQSEIARTL |
| Ga0306925_115922341 | 3300031890 | Soil | MAKKKRHSRVEIASKLAQANDLAAQGKLQTEIART |
| Ga0318522_100876621 | 3300031894 | Soil | MAKKKRHSRVEIATKLAQANGLATQGKLQSDIARTLG |
| Ga0318522_104311761 | 3300031894 | Soil | MAKKKRHSRVEIASKLAEANDLVTQGKPHSEIARALGVSVMT |
| Ga0318551_104907631 | 3300031896 | Soil | MAKRKKHSRAEIASKVAHANELATQGKLQSEIARALGVS |
| Ga0318520_100519711 | 3300031897 | Soil | MRAVMAKKKRHSRVEIATKLAQANDLATQGKLQSEIARTLG |
| Ga0306921_111468722 | 3300031912 | Soil | MTKKRKHSKAEIAAKLAEADDLVTQGKLQSEIARALGVS |
| Ga0310912_102946572 | 3300031941 | Soil | MKGRMQTTMAKKKRHSRVEIASKLAQANDLATQGKLQSEI |
| Ga0310916_101449611 | 3300031942 | Soil | MAKKRRHSRAEIATKLAQANELATRGKLQSEIARTLG |
| Ga0310913_111779902 | 3300031945 | Soil | MAKKKKHSRVEIASKLAQANDLATQGKLQSEIARTLG |
| Ga0310910_102926273 | 3300031946 | Soil | MKGRMQTTMAKKKRHSRVEIASKLAQANDLATQGKLQSEIARTLGV |
| Ga0306926_102876301 | 3300031954 | Soil | MQAAMTQKKRHSTVEIATKLAQANDLATQGKLQSEIAHT |
| Ga0306926_115629772 | 3300031954 | Soil | MQAKKRRHSRAEIATKLAQANELATRGKLQSDIARTLG |
| Ga0318530_103818821 | 3300031959 | Soil | MAGLKRHSRVEVATKLAQANDLARQGKLQSEIARTLGV |
| Ga0318531_103422971 | 3300031981 | Soil | MQAVMAKQKRHSRVEIATKLAQANDLATQGKVQSEI |
| Ga0318531_105902972 | 3300031981 | Soil | MQAAMAKKKRHSRVEIATKLAQATDLATQGRSQREIAHMLG |
| Ga0306922_104989311 | 3300032001 | Soil | MNMKGRMQTAMAKKKRHSRVEIASKLAQANDLATQGKLQSE |
| Ga0306922_117457421 | 3300032001 | Soil | MQAAMPKRKRHSRLEIATKLAQADELATQGKLQSEIARTLG |
| Ga0306922_120117322 | 3300032001 | Soil | MAKKRGHSRAEIATKLAQANELATRGKLQSEIARTLGV |
| Ga0318563_107951621 | 3300032009 | Soil | MLVTAAGQAAMAGLKRHSRVEVATKLAQANDLAKQGKLESEIARTLGV |
| Ga0318507_103451131 | 3300032025 | Soil | MAKKKRHSRAEIATKLAQANELVTQGKLQSEVARTLG |
| Ga0318559_101102013 | 3300032039 | Soil | MAKKKRHSGAEIATKLAQANDLARRGRLQSEIARTLG |
| Ga0318559_101363813 | 3300032039 | Soil | MQAAMAKRKKHSRAEMATKLAQANELATQGKLQSEV |
| Ga0318549_104267371 | 3300032041 | Soil | MQAAVAKKRRHSRAEIATKLAQANGLARQGKLQSDIARTLGVSVM |
| Ga0318570_102508561 | 3300032054 | Soil | MQAAMAKRKRHSRVEIATKLAQANDLATQGKLQSEIARTLG |
| Ga0318575_102441851 | 3300032055 | Soil | MAKKKRHSRVEIASKLAQANDLATQGKLQSEIARTLGVS |
| Ga0318575_104531872 | 3300032055 | Soil | MQAAMAKRKRHSRVEIATKLAQANDLATQGKLQSEIARTLD |
| Ga0318575_106552251 | 3300032055 | Soil | MQAAMPKRKRHSRLEIATKLAQADELATQGKLQSEIARTLGV |
| Ga0318533_105407581 | 3300032059 | Soil | MQAVMAKQKRHSRVEIATKLAQANDLATQGKVQSEIARRLGVS |
| Ga0318533_112068571 | 3300032059 | Soil | MKMGGAKQAVMAKRKKHSRVEIATKLQQANDLAMQGKL |
| Ga0318505_100381051 | 3300032060 | Soil | MAKKRRHSRAEIATKLAQANELATRGELQSDIARTLGVS |
| Ga0318510_102563192 | 3300032064 | Soil | MAKKKRHSRVEIASKLAQANDLVTQGKSQSEIART |
| Ga0318514_101067143 | 3300032066 | Soil | MQAAMAKRKKHSRAEMATKLAQANELATQGKLQSEIARILG |
| Ga0318524_106388731 | 3300032067 | Soil | MQAAMAKKRRHSRAEIATKLAQANELATRGKLQSD |
| Ga0318518_100976601 | 3300032090 | Soil | MQAAMAKKRRHSRAEIATKLAQANELATRGKLQSDIARTL |
| Ga0318577_105306151 | 3300032091 | Soil | MQAAMAKKRRHSRAEIATKLAQANELATRGKLQSEIARTLG |
| Ga0310914_100539361 | 3300033289 | Soil | MLVTAAGQAAMAGLKRHSRVEVATKLAQANDLAKQGKLESEIARTLGVS |
| Ga0310914_103105641 | 3300033289 | Soil | MQAAMANKRRHSRAEIATKLAQANELATRGKLQSDIARTL |
| Ga0310914_103555921 | 3300033289 | Soil | MTKKRKHSKAEIAFKLAEADDLVTQGKLQSEIARELGV |
| Ga0310914_117127901 | 3300033289 | Soil | MQAAIAKKKRHSRVEIATKLAQATDLATQGRSQREIAH |
| Ga0318519_102316821 | 3300033290 | Soil | MKAAMAKKRRHSRAEIATKLAQANELATRGKLQSD |
| ⦗Top⦘ |