| Basic Information | |
|---|---|
| Family ID | F027426 |
| Family Type | Metagenome |
| Number of Sequences | 194 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MFNRSDLKALIATVIIIGLGYGVMHLLVFLDEYYKLTIY |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 194 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 84.02 % |
| % of genes near scaffold ends (potentially truncated) | 18.56 % |
| % of genes from short scaffolds (< 2000 bps) | 83.51 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (80.412 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (28.351 % of family members) |
| Environment Ontology (ENVO) | Unclassified (79.381 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (77.835 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.24% β-sheet: 0.00% Coil/Unstructured: 47.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 194 Family Scaffolds |
|---|---|---|
| PF06303 | MatP | 7.73 |
| PF08401 | ArdcN | 1.55 |
| PF14207 | DpnD-PcfM | 1.03 |
| PF13730 | HTH_36 | 0.52 |
| PF03237 | Terminase_6N | 0.52 |
| PF12236 | Head-tail_con | 0.52 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.52 |
| PF08299 | Bac_DnaA_C | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 194 Family Scaffolds |
|---|---|---|---|
| COG3120 | Macrodomain Ter protein organizer, MatP/YcbG family | Replication, recombination and repair [L] | 7.73 |
| COG4227 | Antirestriction protein ArdC | Replication, recombination and repair [L] | 1.55 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 80.41 % |
| All Organisms | root | All Organisms | 19.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 28.35% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 21.13% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.73% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.70% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.15% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.64% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.06% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.55% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.55% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.03% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.03% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.03% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.52% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.52% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020524 | Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300027518 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_1091865241 | 3300002408 | Freshwater | MFNRDDYKALITTVIIIVLGYGLIHLLVFLDDYFKLTIY* |
| B570J40625_1000222464 | 3300002835 | Freshwater | MFNREDYKALIVTGLIILLGYSAMHLLVFLDGYFKLSIY* |
| B570J40625_1004945265 | 3300002835 | Freshwater | MFNRDDYKALITTTIIIILSYASIHLLVFLDDYFKLTLY* |
| B570J40625_1007276593 | 3300002835 | Freshwater | MFNRSDLNALLATVIIIGLGYGVMHLLIFLDEYYKLSIY* |
| JGI25908J49247_101085142 | 3300003277 | Freshwater Lake | MFSRDDYKALIATTIIIILGYASIHLLVFLDDYFKLTLY* |
| JGI25909J50240_10315155 | 3300003393 | Freshwater Lake | MFSRDDYKALITTVIIIVLGYGLIHLLVFLDDYFKLTLY* |
| JGI25907J50239_10956932 | 3300003394 | Freshwater Lake | MFNRDDYKALITTVIIIVLGYGLIHLLVFLDDYFKLTLY* |
| JGI25930J51415_10230744 | 3300003499 | Freshwater Lake | MFNRSDLNALLITAAIILLGYISMHVLICLDEYFKLTTY* |
| Ga0007787_104273882 | 3300004240 | Freshwater Lake | MFDRSDLKALIATAIIILLGYASMHLLVYLDEYFKLTIY* |
| Ga0070374_104340534 | 3300005517 | Freshwater Lake | RDDYKALIATTIIIILGYASIHLLVFLDDYFKLTIY* |
| Ga0049083_102966493 | 3300005580 | Freshwater Lentic | MFNRSDLNALLATVIIILLGYGVMHLLLFLHEYFKLTIY* |
| Ga0049081_100462495 | 3300005581 | Freshwater Lentic | MFNRSDLNALLATVIIIGLGYGVMHLLIFLDGYYKLSIY* |
| Ga0049081_101020791 | 3300005581 | Freshwater Lentic | MFNRDDYKALIATTIIIILGYASIHLLVFLDDYFKLTLY* |
| Ga0049081_102278803 | 3300005581 | Freshwater Lentic | MFNRSDLNALLATVIIILLGYGVMHLLIFLDEYYKLSIY* |
| Ga0049081_102876913 | 3300005581 | Freshwater Lentic | YARR*RIGGCLMFNRDDYKALIATAVIIVLGYGLIHLLVFLDDYFKLTLY* |
| Ga0049085_100234864 | 3300005583 | Freshwater Lentic | MFNRSDLKALIATVIIIGLGYVVMHLLVFLDGYYKLTIY* |
| Ga0049082_101934291 | 3300005584 | Freshwater Lentic | GGCLMFNRDDYKALIATAVIIVLGYALIHLFVFLDDYFKLTLY* |
| Ga0049082_102493303 | 3300005584 | Freshwater Lentic | MFNRDDYKALIVTTIIIILGYASIHLLVFLDDYFKLTLY* |
| Ga0079957_11277952 | 3300005805 | Lake | MFERDDLKALIATALIILLGYASIHLLVYLDEYFKLTNY* |
| Ga0079300_101505673 | 3300007162 | Deep Subsurface | MFNKSDLNALLATVIIIGLGYGVMHLLIFLDEYYKLSIY* |
| Ga0104988_1078426 | 3300007735 | Freshwater | MFNREDYTALIVTALIILLGYASMHLLVYLDEYFKLTNY* |
| Ga0105747_11759274 | 3300007974 | Estuary Water | MFNRSDLKALIATVIIIGLGYGVMHLLVFLDGYYKLSIY* |
| Ga0105747_12437573 | 3300007974 | Estuary Water | MFNRDDYKALIATVIIIVLGYGLIHLLVFLDDYFKLTLY* |
| Ga0114340_10740724 | 3300008107 | Freshwater, Plankton | MFERDDLKALIATALIILLGYASMHLLVYLDEYFKLTNY* |
| Ga0114344_11838071 | 3300008111 | Freshwater, Plankton | KKIKGGCIMFERDDLKALIATALIILLGYASMHLLVYLDEYFKLTNY* |
| Ga0114347_10346453 | 3300008114 | Freshwater, Plankton | MFNRSDLKALIATAIIILLGYAAIHLLVYLDEYFKLTNY* |
| Ga0114347_10478674 | 3300008114 | Freshwater, Plankton | MFDRSDLKALIATAVIILLGYASMHLLVFLDEYFKLTIY* |
| Ga0114351_13515721 | 3300008117 | Freshwater, Plankton | MFDRSDLKALIATAIIILLGYASMHLLVFLDEYFKLTIY* |
| Ga0114363_10295156 | 3300008266 | Freshwater, Plankton | MFNRSDLKALIATALIIFLGYASMHLLVYLDEYFKLTNY* |
| Ga0114363_10334494 | 3300008266 | Freshwater, Plankton | MFNRSDLNALLATVIIILLGYGVMHLLIFLDGYYKLSIY* |
| Ga0114363_10356131 | 3300008266 | Freshwater, Plankton | MFNRSDYKALAITTIIIILGYASIHLLVFLDDYFKLTLY* |
| Ga0114363_10439944 | 3300008266 | Freshwater, Plankton | MFDRSDLKALIATAIIILLGYASMHLLVFLDEYFKLTNY* |
| Ga0114363_11386191 | 3300008266 | Freshwater, Plankton | MFNRSDLNALLATVIIILLGYAAMHLFIFLDEYFKLTIY* |
| Ga0114363_11484302 | 3300008266 | Freshwater, Plankton | MFNKDDYKALIATAVIIVLGYALIHLFVFLDDYFKLTLY* |
| Ga0114363_11525874 | 3300008266 | Freshwater, Plankton | MFNRSDLKALIATAIIILLGYASMHLLVFLDEYFKLTIY* |
| Ga0114363_12235432 | 3300008266 | Freshwater, Plankton | MFNRSDLKALIATVIIIGLGYGVMHLLIFLDEYYKLSIY* |
| Ga0114876_10265468 | 3300008448 | Freshwater Lake | MFNRSDLNALLITCLIIVLGYAAMHLLVFLHQYFKLTIY* |
| Ga0114880_11685832 | 3300008450 | Freshwater Lake | MFNRDDYKALIATAVIIVLGYALIHLFVFLDDYFKLTIY* |
| Ga0114880_11921623 | 3300008450 | Freshwater Lake | MFNRSDLNALLATVIIIGLGYAAMHLFIFLDEYFKLTIY* |
| Ga0102829_12163911 | 3300009026 | Estuarine | MFNRSDLNALLATVIIIGLGYGVMHLLIFLDEYYKL |
| Ga0114973_100320655 | 3300009068 | Freshwater Lake | MFNRSDYIALLVTSIIILLGYASIHLLVYLDEYFKLTNY* |
| Ga0114973_100430886 | 3300009068 | Freshwater Lake | MFNRSDLNALLATVIIIGLGYGVMHLLIFLDEYYKLS |
| Ga0114973_103406353 | 3300009068 | Freshwater Lake | MFNRSDLNALLATVIIIGLGYGVMHLLIFLDEYYNLSIY* |
| Ga0114973_103485334 | 3300009068 | Freshwater Lake | MFNRSDLNALLATVIIIGLGYGVMHLLVFLDGYYKLT |
| Ga0105090_104608932 | 3300009075 | Freshwater Sediment | MFNRSDLNALLATVIIIVLGYAAMHLFIFLDEYFKLTNY* |
| Ga0105103_104499272 | 3300009085 | Freshwater Sediment | MFNRSDLRALLATIIIIVLGYAVMHLLVFLDGYYKLSIY* |
| Ga0105103_104771921 | 3300009085 | Freshwater Sediment | MFNREDYKALIVTGLIILLGYSAMHLLVFLDGYFKL |
| Ga0105103_105737252 | 3300009085 | Freshwater Sediment | MFNRSDLNALLATVVIIVLGYAAMHLFIFLDEYFKLTNY* |
| Ga0114968_100901775 | 3300009155 | Freshwater Lake | MFNRDDYKALIATAVIIVSGYALMHLFVFLDDYFKLTLY* |
| Ga0114968_102457574 | 3300009155 | Freshwater Lake | MFNRSDLRALIATVIIIGLGYGVMHLLVFLDGYYKLSIY* |
| Ga0114968_102654034 | 3300009155 | Freshwater Lake | MFNRSDLNALLATVIIIGLGYVVMHLLVFLDGYYKLSIY* |
| Ga0114968_106326421 | 3300009155 | Freshwater Lake | MFNRSDLNALLATVIIIGLGYGVMHLLVFLDGYYKLTMY* |
| Ga0114977_103913703 | 3300009158 | Freshwater Lake | MFNRSDLRALIATVIIIGLGYAVMHLLVFLDDYFKLTLY* |
| Ga0114978_100526277 | 3300009159 | Freshwater Lake | MFNRSDLNALLATVIIIGIGYGVMHLLIFLDGYYKLSIY* |
| Ga0114978_100721904 | 3300009159 | Freshwater Lake | MFNRSDLNALLATVIIIGLGYGVMHLLLFLDGYYKLTIY* |
| Ga0114978_101013623 | 3300009159 | Freshwater Lake | MFNRSDLNALLATVIIIGLGYVVMHLLVFLDGYYKLTAY* |
| Ga0114978_102849091 | 3300009159 | Freshwater Lake | MFSRDDYKALIATTIIIILGYASIHLLVFLDDYFKLTIY* |
| Ga0114978_106936593 | 3300009159 | Freshwater Lake | MFNRSDLNALLATVIIIGLGYGVMHLLVFLDGYYKLSIY* |
| Ga0114966_102193354 | 3300009161 | Freshwater Lake | MFNRSDLNALLATVIIIGLGYVVMHLLVFLDGYYKLTIY* |
| Ga0114966_105900152 | 3300009161 | Freshwater Lake | MFNRSDLSALLATVIIIGLGYGVMHLLIFLDEYYKLSIY* |
| Ga0114966_106909852 | 3300009161 | Freshwater Lake | RSDLNALIATVIIIGLGYGVMHLLIFLDEYYKLSIY* |
| Ga0105102_103413602 | 3300009165 | Freshwater Sediment | MFNRSDLRALLATIIIIVLGYAAMHLFIFLDEYFKLTNY* |
| Ga0105097_102944905 | 3300009169 | Freshwater Sediment | MFNRSDLKALITTAIIILLGYAVMHLLVFLDGYYK |
| Ga0105097_108276502 | 3300009169 | Freshwater Sediment | MFNRSDFRALLATIIIIVLGYGVMHLLVFLDGYYKLSIY* |
| Ga0114969_101140164 | 3300009181 | Freshwater Lake | MFNRDDYKALITTTIIIILGYASIHLLVFLDDYFKLTIY* |
| Ga0114974_100442025 | 3300009183 | Freshwater Lake | MFNRSDLNALLATVIIIGLGYGVMHLLLFLDEYYKLSIY* |
| Ga0114974_103121331 | 3300009183 | Freshwater Lake | MFNRDDYKALIATAVIIVLGYASIHLLVFLDDYFKLTIY* |
| Ga0114972_103228742 | 3300009187 | Freshwater Lake | MFNRSDLNALLVTVIIIGLGYGVMHLLVFLDGYYKLSIY* |
| Ga0114967_100614205 | 3300010160 | Freshwater Lake | MFNRDDYKALITTTIIIILGYASIHLLVFLDDYFKLTLY* |
| Ga0114967_101020925 | 3300010160 | Freshwater Lake | MFNRSDLKALIATVIIIGLGYGVMHLLVFLDGYYKLTIY* |
| Ga0133913_135022382 | 3300010885 | Freshwater Lake | MFNRDDYKALIATAVIIVLGYALIHLFVFLDDYFKLTLY* |
| Ga0139557_10126511 | 3300011010 | Freshwater | CLMFNRSDLNALLATVIIILLGYGVMHLLIFLDGYYKLSIY* |
| Ga0164293_106642031 | 3300013004 | Freshwater | MFNRSDLNALLATVIIIGLGYGVMHLLIFLDEYYKVSIY* |
| Ga0164293_107596643 | 3300013004 | Freshwater | MFNRDDYKALITTVIIIVLGYALIHLFVFLDDYFKLTLY* |
| Ga0164293_109882463 | 3300013004 | Freshwater | MFSRSDLNALLATVIIILLGYGVMHLLIFLDEYYKLSIY* |
| Ga0164292_108932861 | 3300013005 | Freshwater | MFNRSDLRALLATIIIIALGYGVMHLLIFLDEYYKL |
| Ga0177922_107279227 | 3300013372 | Freshwater | MFNRDDYKALIATVVIIVLGYAAMHLLLFLHEYFKLTIY* |
| Ga0181364_10316101 | 3300017701 | Freshwater Lake | MFNRSDLKALLATVVIIVLGYGVMHLLVFLDGYYKLSIY |
| Ga0181363_10392653 | 3300017707 | Freshwater Lake | MFNRDDYKALIATAIIIVLGYTLIHLFVFLDDYFKLTLY |
| Ga0181363_10458523 | 3300017707 | Freshwater Lake | MFNKDDYKALIATAVIIVLGYGLIHLLVFLDDYFKLTLY |
| Ga0181350_11024562 | 3300017716 | Freshwater Lake | MFNRSDLKALIATVIIIGLGYGVMHLLVFLDEYYKLTIY |
| Ga0181350_11428141 | 3300017716 | Freshwater Lake | GGFLMFSRDDYKALIATTIIIILGYASIHLLVFLDDYFKLTLY |
| Ga0181347_10542644 | 3300017722 | Freshwater Lake | MFNRDDYKALIVTTIIIILGYASIHLLVFLDDYFKLTLY |
| Ga0181362_10296705 | 3300017723 | Freshwater Lake | MFNRSDYKALIATTIIIILGYASIHLLVFLDDYFKLTIY |
| Ga0181362_10663941 | 3300017723 | Freshwater Lake | FNGGCLMFNRSDLNALLATVIIILLGYGVMHLLIFLDEYYKLSIY |
| Ga0181362_10916014 | 3300017723 | Freshwater Lake | RSDLKALIATVIIIGLGYGVMHLLVFLDEYYKLSIY |
| Ga0181362_11169573 | 3300017723 | Freshwater Lake | MFNRDDYKALIATTIIIILGYASIHLLVFLDDYFKLT |
| Ga0181365_10206826 | 3300017736 | Freshwater Lake | MFNKDDYKALIATTIIIILGYASIHLLVFLDDYFKLTLY |
| Ga0181352_10393691 | 3300017747 | Freshwater Lake | MFNRSDLKALIATVIIIGLGYGVMHLLVFLDEYYK |
| Ga0181352_10465284 | 3300017747 | Freshwater Lake | MGGSCIMFDRSDLKALIATAVIILLGYAAMHLLVFLDEYFKLTIY |
| Ga0181356_10839795 | 3300017761 | Freshwater Lake | MFNRSDYKALAITTIIIILGYASIHLLVFLDDYFKLSIY |
| Ga0181356_11020003 | 3300017761 | Freshwater Lake | MFNRSDLKALIATVIIIGLGYGVMHLLIFLDEYYKLTIY |
| Ga0181356_12324333 | 3300017761 | Freshwater Lake | MFNRDDFKALIATTIIIILGYASIHLLVFLDDYFKLTLY |
| Ga0181343_10310641 | 3300017766 | Freshwater Lake | MFSRDDYKALIVTTIIIILGYASIHLLVFLDDYFKLTLY |
| Ga0181343_11156472 | 3300017766 | Freshwater Lake | MFNRSDFNALLITAVIILLGYAAMHLLVFLDEYFKLTIH |
| Ga0181358_10548111 | 3300017774 | Freshwater Lake | SRDDYKALIATTIIIILGYASIHLLVFLDDYFKLTLY |
| Ga0181358_10686045 | 3300017774 | Freshwater Lake | MFNRDDYKALIATVVIIVLGYAAMHLLLFLHEYYKLTIY |
| Ga0181358_11019002 | 3300017774 | Freshwater Lake | MFNKDDYKALIATTIIIILGYASIHLLVFLDDYFKLTIY |
| Ga0181349_12464904 | 3300017778 | Freshwater Lake | RDDYKALITTVIIIVLGYGLIHLLVFLDDYFKLTLY |
| Ga0181346_12830933 | 3300017780 | Freshwater Lake | SRDDYKALAITTIIIILGYASIHLLVFLDDYFKLTLY |
| Ga0181348_10547212 | 3300017784 | Freshwater Lake | MFNRSDLKALIATVIIIGLGYGVMHLLVFRDGYYKLTIY |
| Ga0181348_12383281 | 3300017784 | Freshwater Lake | MFNKDDYKALIATAVIIVLGYGLIHLFVFLDDYFKLTLY |
| Ga0181355_10749477 | 3300017785 | Freshwater Lake | MFNRSDLNALLITAVIILLGYAAMHLLVFLDKYFK |
| Ga0181355_11092313 | 3300017785 | Freshwater Lake | MFNRDDYKALIATTIIIILGYASIHLLVFLNDYFKLTIY |
| Ga0181355_11269681 | 3300017785 | Freshwater Lake | SSDLRGLNALLVTAVIILLGYAAMHLLVFLDEYFKLTIH |
| Ga0181355_11780795 | 3300017785 | Freshwater Lake | MFSRSDLKALIATVVIIVLGYAAMNLLLFLHEYFKLTIY |
| Ga0181355_12527684 | 3300017785 | Freshwater Lake | NRDDYKALIVTTIIIILGYASIHLLVFLDDYFKLTLY |
| Ga0181355_12997301 | 3300017785 | Freshwater Lake | KDDYKALIATAVIIVLGYALIHLFVFLDDYFKLTLY |
| Ga0181359_10222635 | 3300019784 | Freshwater Lake | MFNRSDYKALAITTIIIILGYASIHLLVFLDDYFKLTLY |
| Ga0181359_10905122 | 3300019784 | Freshwater Lake | MFNRSDLKALIATVIIIGLGYGVMHLLVFLDGYYKLSIY |
| Ga0181359_10987213 | 3300019784 | Freshwater Lake | MFNRSDLKALLATVIIILLGYGVMHLLIFLDEYYKLTIY |
| Ga0181359_11224694 | 3300019784 | Freshwater Lake | MFNRSDYKALIATVIIIGLGYVVMHLLVFLDGYYKLTIY |
| Ga0181359_11589412 | 3300019784 | Freshwater Lake | MFSRDDYKALIATTIIIILGYASIHLLVFLDDYFKLTIY |
| Ga0181359_12319172 | 3300019784 | Freshwater Lake | MFNRSDLNALLATVIIIGLGYGVMHLLIFLDEYYKLSIY |
| Ga0181359_12348772 | 3300019784 | Freshwater Lake | MFNRSDLNALLATVIIILLGYGVMHLLLFLHEYFKLTIY |
| Ga0211732_11060426 | 3300020141 | Freshwater | MFNRSDLNALIATVIIILLGYAAMHLLIFLDGYYKLSIY |
| Ga0211732_15519196 | 3300020141 | Freshwater | MFNRSDLRALLATIIIIVLGYAIMHLLVFLDGYYKLSIY |
| Ga0211736_106802304 | 3300020151 | Freshwater | MFNRSDLNALLATVIIIGLGYGVMHLLIFLDEYYKLTIY |
| Ga0211734_100360433 | 3300020159 | Freshwater | MFNRSDLKALIATVIIIVLGYGLIHLLVFLDDYFKLTIY |
| Ga0211734_106150864 | 3300020159 | Freshwater | MFNRSDLNALLATVIIILLGYAAMHLFIFLDEYFKLTIY |
| Ga0211734_106357831 | 3300020159 | Freshwater | MFNRSDLNALLATVIIIGLGYGVMHLLIFLDGYYKLSIY |
| Ga0211734_108010724 | 3300020159 | Freshwater | VKDCNMFNRSDLKALITTAIIILLGYAAMHLLVFLDGYYKLSIY |
| Ga0211733_108745271 | 3300020160 | Freshwater | KDDYKALIATVIIIVLGYALIHLFVFLDDYFKLTIY |
| Ga0211733_110077403 | 3300020160 | Freshwater | MFDRSDLKALIATIIIIILGYAVMHLLVFLDGYYKLTIY |
| Ga0211726_100962472 | 3300020161 | Freshwater | MFNKDDYKALIATVIIIILGYALIHLFVFLDDYFKLTLY |
| Ga0211726_106189955 | 3300020161 | Freshwater | MFNRDDYKALITTVIIIVLGYALIHLLVFLDDYFKLTLY |
| Ga0211735_101222106 | 3300020162 | Freshwater | MFNRSDLNALLATVIIILLGYAAMHLLVFLDGYYKLSIY |
| Ga0211729_100024312 | 3300020172 | Freshwater | MFDKSDLKALIATVIIIGLGYGVMHLLVFLDGYYKLSIY |
| Ga0211731_109399852 | 3300020205 | Freshwater | MFDRSDLKALITTVIIIGLGYGVMHLLVFLDGYYKLSIY |
| Ga0211731_112615691 | 3300020205 | Freshwater | MFNRDDYKALITTVIIIVLGYALIHLFVFLDDYFKLTLY |
| Ga0208858_10310773 | 3300020524 | Freshwater | MFNRDDYKALITTVIIIVLGYGLIHLLVFLDDYFKLTIY |
| Ga0208855_10137352 | 3300020553 | Freshwater | MFNRDDYKALITTTIIIILSYASIHLLVFLDDYFKLTLY |
| Ga0222714_105664662 | 3300021961 | Estuarine Water | MFERDDLKALIATALIILLGYVSMHLLVYLDEYFKLTNY |
| Ga0222713_103542755 | 3300021962 | Estuarine Water | MFERDDLKALIATALIILLGYASMHLLVYLDEYFKLT |
| Ga0222712_101302681 | 3300021963 | Estuarine Water | MFDRSDLKALIATALIILLGYASMHLLVYLDEYFKLTNY |
| Ga0181353_10249474 | 3300022179 | Freshwater Lake | MFNRDDYKALIATAVIIVLGYALIHLFVFLDDYFKLTLY |
| Ga0181353_10303374 | 3300022179 | Freshwater Lake | MGGSCLMFNRSDLNALLITAAIILLGYISMHVLICLDEYFKLTTY |
| Ga0181354_10953933 | 3300022190 | Freshwater Lake | MFNRDDYKALIATVVIIVLGYAAMNLLLFLHEYFKLTIY |
| Ga0181351_10796253 | 3300022407 | Freshwater Lake | MFSRDDYKALIATTIIIILGYASIHLLVFLDDYFKLTLY |
| Ga0181351_11986123 | 3300022407 | Freshwater Lake | MFNRDDYKALITTVIIIVLGYGLIHLLVFLDDYFKLTLY |
| Ga0181351_12299824 | 3300022407 | Freshwater Lake | RMFNRSDYKALIATVIIIGLGYVVMHLLVFLDGYYKLTIY |
| Ga0208787_11151823 | 3300027518 | Deep Subsurface | MFNKSDLNALLATVIIIGLGYGVMHLLIFLDEYYKLSIY |
| Ga0208942_10179244 | 3300027627 | Freshwater Lentic | MFNRSDLKALIATVIIIGLGYVVMHLLVFLDGYYKLTIY |
| Ga0208975_10677034 | 3300027659 | Freshwater Lentic | MFNRDDYKALIATAVIIVLGYGLIHLLVFLDDYFKLTLY |
| Ga0209392_10441412 | 3300027683 | Freshwater Sediment | MFNRSDLRALLATIIIIVLGYAVMHLLVFLDGYYKLSIY |
| Ga0209704_12486303 | 3300027693 | Freshwater Sediment | MFNRSDLRALLATIIIIVLGYAAMHLFIFLDEYFKLTNY |
| Ga0209442_12785024 | 3300027732 | Freshwater Lake | DDYKALIATTIIIILGYASIHLLVFLDDYFKLTLY |
| Ga0209297_10313247 | 3300027733 | Freshwater Lake | MFNRSDLNALLATVIIIGLGYGVMHLLLFLDGYYKLTIY |
| Ga0209087_11162762 | 3300027734 | Freshwater Lake | MFNRSDLRALIATVIIIGLGYAVMHLLVFLDDYFKLTLY |
| Ga0209597_10139383 | 3300027746 | Freshwater Lake | VFNRSDLKALIATVIIIGLGYGVMHLLVFLDGYYKLTIY |
| Ga0209296_10237796 | 3300027759 | Freshwater Lake | MFNRSDLNALLATVIIIGLGYGVMHLLLFLDEYYKLSIY |
| Ga0209296_10494144 | 3300027759 | Freshwater Lake | MFNRSDLKALIATVIIIGLCYVVMHLLVFLDGYYKLSIY |
| Ga0209296_11943984 | 3300027759 | Freshwater Lake | MFNRSDLNALLATVIIIALGYGVMHLLIFLDGYYKLSIY |
| Ga0209598_100588233 | 3300027760 | Freshwater Lake | MFNRSDLNALLATVIIIGLGYGVMHLLIFLDEYYNLSIY |
| Ga0209088_1002722410 | 3300027763 | Freshwater Lake | MFNRSDLNALLATVIIILLGYGVMHLLIFLDGYYKLSIY |
| Ga0209088_102379534 | 3300027763 | Freshwater Lake | MFNRSDLNALLATVIIIGIGYGVMHLLIFLDGYYKLSIY |
| Ga0209086_1000812216 | 3300027770 | Freshwater Lake | MFNRSDLNALLATVIIIGLGYGVMHLLVFLDGYYKLSIY |
| Ga0209086_101335653 | 3300027770 | Freshwater Lake | MFNRDDYKALIATTIIIILGYASIHLLVFLDDYFKLTLY |
| Ga0209086_102189372 | 3300027770 | Freshwater Lake | MFNRSDLKALIATVIIIGLGYGVMHLLVFLDGYYKLTIY |
| Ga0209086_103766701 | 3300027770 | Freshwater Lake | MFNRSDLNALLATVIIIGLGYAAMHLLVFLDGYFKLTNY |
| Ga0209353_103733171 | 3300027798 | Freshwater Lake | MFNIDDYKALIATAVIIVLGYGLIHLLVFLDDYFKLTLY |
| Ga0209358_103206135 | 3300027804 | Freshwater Lake | DRSDLKALIATAIIILLGYASMHLLVYLDEYFKLTIY |
| Ga0209354_100200176 | 3300027808 | Freshwater Lake | MFSRDDYKALITTVIIIVLGYGLIHLLVFLDDYFKLTLY |
| Ga0209550_103086364 | 3300027892 | Freshwater Lake | MFNRSDLKALIATVIIIGLGYGVMHLLIFLDEYYKLSIY |
| Ga0209400_10350935 | 3300027963 | Freshwater Lake | MFNRSDLNALLATVIIIGLGYVVMHLLVFLDGYYKLSIY |
| Ga0209400_10371507 | 3300027963 | Freshwater Lake | MFNRDDYKALIATAVIIVSGYALMHLFVFLDDYFKLTLY |
| Ga0209400_13022222 | 3300027963 | Freshwater Lake | MFNRSDLNALLATVIIIGLGYGVMHLLVFLDGYYKLTMY |
| Ga0304730_10981414 | 3300028394 | Freshwater Lake | MFNRDDYKALITTTIIIILGYASIHLLVFLDDYFKLTIY |
| Ga0315291_103279032 | 3300031707 | Sediment | MFNRSDLNALLATVIIILLGYGVMHLLVFLDGYYKLTIY |
| Ga0315291_112302714 | 3300031707 | Sediment | IGGCLMFNRSDLNALLATVIIIGLGYGVMHLLIFLDGYYKLSIY |
| Ga0315907_104250664 | 3300031758 | Freshwater | MFDRSDLKALIATAVIILLGYASMHLLVFLDEYFKLTIY |
| Ga0315909_103970112 | 3300031857 | Freshwater | MFDRSDLKALIATAVIILLGYASIHLLVYLDEYFKLTIY |
| Ga0315285_109643552 | 3300031885 | Sediment | MFNKSDLKALIATVIIIGLGYGVMHLLVFLDGYYKLTIY |
| Ga0315904_102927455 | 3300031951 | Freshwater | MFNRSDLKALIATAIIILLGYASMHLLVFLDEYFKLTIY |
| Ga0315904_109450461 | 3300031951 | Freshwater | MFDRSDLKALIATAIIILLGYASMHLLVFLDEYFKLTNY |
| Ga0315904_110179681 | 3300031951 | Freshwater | GCIMFERDDLKALIATALIILLGYASMHLLVYLDEYFKLTNY |
| Ga0315274_104485836 | 3300031999 | Sediment | MFNRDDYKALITTVIIIVLGYGLIHLLLFLDDYFKLTLY |
| Ga0315274_107407011 | 3300031999 | Sediment | FNRSDLKALIATVIIIGLGYGVMHLLVFLDGYFKLTAY |
| Ga0315274_117019803 | 3300031999 | Sediment | MFNRSDLRALLATIIIIVLGYGVMHLLVFLDGYYKLTIY |
| Ga0315903_103082856 | 3300032116 | Freshwater | MFNRSDLKALIATAIIILLGYASMHLLVYLDEYFKLTIY |
| Ga0315903_104469733 | 3300032116 | Freshwater | MFNKDDYKALIATAVIIVLGYALIHLFVFLDDYFKLTLY |
| Ga0315277_103422595 | 3300032118 | Sediment | MFNRSDLKALIATVIIIVLGYGVMHLLLFLHQYFKLTIY |
| Ga0334979_0422833_383_502 | 3300033996 | Freshwater | MFNRSDLNALLATVIIIGLGYGVMHLLIFLDKYYKLSIY |
| Ga0334987_0055063_1452_1571 | 3300034061 | Freshwater | MFNRSDLNALIATIIIIVLGYAVMHLLVFLDDYFKLTIY |
| Ga0310130_0046091_533_652 | 3300034073 | Fracking Water | MFNREDYTALIVTALIILLGYATMHLLVYLDEYFKLTNY |
| Ga0335012_0219314_225_344 | 3300034093 | Freshwater | MFNRSDLNALVATVIIILLGYGVMHLLIFLDEYYKLSIY |
| Ga0335027_0250198_979_1098 | 3300034101 | Freshwater | MFNRSDLNALIATIIIIVLGYAVMHLLVFLDGYYKLSIY |
| Ga0335027_0366398_79_198 | 3300034101 | Freshwater | MFNRSDLNALVATVIIILLGYGVMHLLIFLDGYYKLSIY |
| Ga0335031_0120102_593_712 | 3300034104 | Freshwater | MFNRDDYKALIATAIIIVLGYALIHLFVFLDDYFKLTIY |
| Ga0335036_0328125_893_1006 | 3300034106 | Freshwater | NRSDLKALIATVIIIGLGYGVMHLLIFLDEYYKLSIY |
| Ga0335068_0018266_3562_3681 | 3300034116 | Freshwater | MFSRDDYKALIVTTIIIILGYASIHLLVFLDDYFKLTIY |
| Ga0335056_0115983_487_606 | 3300034120 | Freshwater | MFNKDDYKALIATAVIIVLGYALIHLFVFLDDYFKLTIY |
| Ga0335007_0106766_1475_1594 | 3300034283 | Freshwater | MFNRSDLNALIATVIIILLGYGVMHLLVFLDGYYKLTIY |
| Ga0335007_0567112_547_663 | 3300034283 | Freshwater | FNRSDLNALLATVIIILLGYGVMHLLIFLDGYYKLSIY |
| ⦗Top⦘ |