| Basic Information | |
|---|---|
| Family ID | F027399 |
| Family Type | Metagenome |
| Number of Sequences | 194 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MNFTFTWILDKFGFQPKVETFDFPVKPVAKKVAKKTVKKATTRKPK |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 194 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 85.57 % |
| % of genes near scaffold ends (potentially truncated) | 13.92 % |
| % of genes from short scaffolds (< 2000 bps) | 61.34 % |
| Associated GOLD sequencing projects | 71 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (62.887 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (53.608 % of family members) |
| Environment Ontology (ENVO) | Unclassified (73.711 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (91.237 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.84% β-sheet: 0.00% Coil/Unstructured: 62.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 194 Family Scaffolds |
|---|---|---|
| PF13884 | Peptidase_S74 | 17.01 |
| PF11351 | GTA_holin_3TM | 5.15 |
| PF09374 | PG_binding_3 | 4.64 |
| PF07484 | Collar | 4.12 |
| PF00182 | Glyco_hydro_19 | 3.61 |
| PF05838 | Glyco_hydro_108 | 3.09 |
| PF04404 | ERF | 3.09 |
| PF09636 | XkdW | 2.58 |
| PF13392 | HNH_3 | 1.55 |
| PF13302 | Acetyltransf_3 | 1.03 |
| PF16786 | RecA_dep_nuc | 1.03 |
| PF16778 | Phage_tail_APC | 1.03 |
| PF14549 | P22_Cro | 0.52 |
| PF01242 | PTPS | 0.52 |
| PF00959 | Phage_lysozyme | 0.52 |
| PF01075 | Glyco_transf_9 | 0.52 |
| PF00239 | Resolvase | 0.52 |
| PF01507 | PAPS_reduct | 0.52 |
| PF09588 | YqaJ | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 194 Family Scaffolds |
|---|---|---|---|
| COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 3.61 |
| COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 3.61 |
| COG3926 | Lysozyme family protein | General function prediction only [R] | 3.09 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.52 |
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.52 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.52 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.38 % |
| Unclassified | root | N/A | 20.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001842|RCM30_1057756 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1222 | Open in IMG/M |
| 3300001849|RCM26_1045451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 733 | Open in IMG/M |
| 3300002091|JGI24028J26656_1001972 | Not Available | 4077 | Open in IMG/M |
| 3300002091|JGI24028J26656_1003345 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2727 | Open in IMG/M |
| 3300002092|JGI24218J26658_1011413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1437 | Open in IMG/M |
| 3300002307|JGI24890J29729_1054854 | Not Available | 710 | Open in IMG/M |
| 3300002930|Water_100308 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10821 | Open in IMG/M |
| 3300003375|JGI26470J50227_1007703 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2831 | Open in IMG/M |
| 3300003785|Ga0007851_100911 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2002 | Open in IMG/M |
| 3300003785|Ga0007851_105090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
| 3300003797|Ga0007846_1002856 | All Organisms → Viruses → Predicted Viral | 2247 | Open in IMG/M |
| 3300003815|Ga0007856_1007574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
| 3300003824|Ga0007874_1003098 | All Organisms → Viruses → Predicted Viral | 1996 | Open in IMG/M |
| 3300003824|Ga0007874_1007525 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1007 | Open in IMG/M |
| 3300004448|Ga0065861_1125665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 879 | Open in IMG/M |
| 3300004461|Ga0066223_1361202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 649 | Open in IMG/M |
| 3300004770|Ga0007804_1013858 | All Organisms → Viruses → Predicted Viral | 2319 | Open in IMG/M |
| 3300004774|Ga0007794_10079679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 977 | Open in IMG/M |
| 3300004774|Ga0007794_10128738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
| 3300004802|Ga0007801_10118727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
| 3300004804|Ga0007796_10047504 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
| 3300004804|Ga0007796_10086226 | Not Available | 984 | Open in IMG/M |
| 3300004804|Ga0007796_10210086 | Not Available | 571 | Open in IMG/M |
| 3300004805|Ga0007792_10166908 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300004805|Ga0007792_10179094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
| 3300004806|Ga0007854_10389554 | Not Available | 568 | Open in IMG/M |
| 3300006104|Ga0007882_10122877 | Not Available | 942 | Open in IMG/M |
| 3300006111|Ga0007848_1035247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 962 | Open in IMG/M |
| 3300009068|Ga0114973_10001461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17669 | Open in IMG/M |
| 3300009068|Ga0114973_10733296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300009151|Ga0114962_10018901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4906 | Open in IMG/M |
| 3300009151|Ga0114962_10647846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300009152|Ga0114980_10000736 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 23328 | Open in IMG/M |
| 3300009152|Ga0114980_10002135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14084 | Open in IMG/M |
| 3300009152|Ga0114980_10002716 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12338 | Open in IMG/M |
| 3300009152|Ga0114980_10012957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5311 | Open in IMG/M |
| 3300009152|Ga0114980_10079263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1971 | Open in IMG/M |
| 3300009152|Ga0114980_10090571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1831 | Open in IMG/M |
| 3300009152|Ga0114980_10110132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1644 | Open in IMG/M |
| 3300009154|Ga0114963_10155088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1356 | Open in IMG/M |
| 3300009154|Ga0114963_10195762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1173 | Open in IMG/M |
| 3300009154|Ga0114963_10313685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 870 | Open in IMG/M |
| 3300009154|Ga0114963_10695348 | Not Available | 527 | Open in IMG/M |
| 3300009158|Ga0114977_10005098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8357 | Open in IMG/M |
| 3300009158|Ga0114977_10007183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7068 | Open in IMG/M |
| 3300009158|Ga0114977_10013095 | Not Available | 5247 | Open in IMG/M |
| 3300009158|Ga0114977_10040462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2905 | Open in IMG/M |
| 3300009158|Ga0114977_10044726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2751 | Open in IMG/M |
| 3300009158|Ga0114977_10111229 | Not Available | 1656 | Open in IMG/M |
| 3300009158|Ga0114977_10131473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1501 | Open in IMG/M |
| 3300009158|Ga0114977_10441537 | Not Available | 719 | Open in IMG/M |
| 3300009158|Ga0114977_10452875 | Not Available | 708 | Open in IMG/M |
| 3300009159|Ga0114978_10032498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3715 | Open in IMG/M |
| 3300009159|Ga0114978_10280615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1026 | Open in IMG/M |
| 3300009159|Ga0114978_10304700 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 974 | Open in IMG/M |
| 3300009159|Ga0114978_10554651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas caviae | 669 | Open in IMG/M |
| 3300009160|Ga0114981_10508426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
| 3300009161|Ga0114966_10684668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300009164|Ga0114975_10012057 | Not Available | 5363 | Open in IMG/M |
| 3300009164|Ga0114975_10012463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5266 | Open in IMG/M |
| 3300009164|Ga0114975_10280168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 927 | Open in IMG/M |
| 3300009164|Ga0114975_10292512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 903 | Open in IMG/M |
| 3300009164|Ga0114975_10367071 | Not Available | 789 | Open in IMG/M |
| 3300009175|Ga0073936_10077930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2839 | Open in IMG/M |
| 3300009175|Ga0073936_10104935 | All Organisms → Viruses → Predicted Viral | 2286 | Open in IMG/M |
| 3300009180|Ga0114979_10205013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1193 | Open in IMG/M |
| 3300009180|Ga0114979_10315475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 926 | Open in IMG/M |
| 3300009180|Ga0114979_10614372 | Not Available | 620 | Open in IMG/M |
| 3300009181|Ga0114969_10085819 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2042 | Open in IMG/M |
| 3300009181|Ga0114969_10097323 | Not Available | 1898 | Open in IMG/M |
| 3300009182|Ga0114959_10071731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1948 | Open in IMG/M |
| 3300009182|Ga0114959_10096626 | All Organisms → Viruses → Predicted Viral | 1626 | Open in IMG/M |
| 3300009182|Ga0114959_10208373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1009 | Open in IMG/M |
| 3300009183|Ga0114974_10000438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34966 | Open in IMG/M |
| 3300009183|Ga0114974_10294973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 956 | Open in IMG/M |
| 3300009183|Ga0114974_10483674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
| 3300009183|Ga0114974_10659766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
| 3300009184|Ga0114976_10000228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34184 | Open in IMG/M |
| 3300009184|Ga0114976_10014105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4911 | Open in IMG/M |
| 3300009184|Ga0114976_10025520 | All Organisms → cellular organisms → Bacteria | 3579 | Open in IMG/M |
| 3300009184|Ga0114976_10084144 | Not Available | 1832 | Open in IMG/M |
| 3300009184|Ga0114976_10714591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300009502|Ga0114951_10196990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1081 | Open in IMG/M |
| 3300010157|Ga0114964_10122649 | Not Available | 1276 | Open in IMG/M |
| 3300010157|Ga0114964_10275884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
| 3300010158|Ga0114960_10361094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
| 3300010885|Ga0133913_10249868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4709 | Open in IMG/M |
| 3300010885|Ga0133913_10366956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3807 | Open in IMG/M |
| 3300010885|Ga0133913_11043589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2110 | Open in IMG/M |
| 3300010885|Ga0133913_11460621 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1735 | Open in IMG/M |
| 3300010885|Ga0133913_11853452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1507 | Open in IMG/M |
| 3300010885|Ga0133913_12050617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1418 | Open in IMG/M |
| 3300010885|Ga0133913_12640285 | Not Available | 1217 | Open in IMG/M |
| 3300010885|Ga0133913_12665266 | Not Available | 1210 | Open in IMG/M |
| 3300010885|Ga0133913_13057322 | Not Available | 1113 | Open in IMG/M |
| 3300011335|Ga0153698_1122 | Not Available | 34431 | Open in IMG/M |
| 3300012665|Ga0157210_1001745 | Not Available | 6288 | Open in IMG/M |
| 3300013285|Ga0136642_1003568 | All Organisms → cellular organisms → Bacteria | 5729 | Open in IMG/M |
| 3300013285|Ga0136642_1052872 | Not Available | 1108 | Open in IMG/M |
| 3300013285|Ga0136642_1064530 | Not Available | 981 | Open in IMG/M |
| 3300013285|Ga0136642_1156811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300013286|Ga0136641_1046615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1269 | Open in IMG/M |
| 3300013286|Ga0136641_1194851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300014502|Ga0182021_11080108 | Not Available | 966 | Open in IMG/M |
| 3300014502|Ga0182021_13195893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300017747|Ga0181352_1080301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 912 | Open in IMG/M |
| 3300017754|Ga0181344_1000780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12292 | Open in IMG/M |
| 3300017754|Ga0181344_1136468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
| 3300017766|Ga0181343_1075006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 974 | Open in IMG/M |
| 3300020158|Ga0194038_1001510 | All Organisms → cellular organisms → Bacteria | 10042 | Open in IMG/M |
| 3300020158|Ga0194038_1003926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5982 | Open in IMG/M |
| 3300020158|Ga0194038_1023406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2049 | Open in IMG/M |
| 3300020158|Ga0194038_1078183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 990 | Open in IMG/M |
| 3300020158|Ga0194038_1142238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
| 3300020164|Ga0194037_1067781 | Not Available | 1304 | Open in IMG/M |
| 3300021131|Ga0214206_1006290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1930 | Open in IMG/M |
| 3300021354|Ga0194047_10000283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34738 | Open in IMG/M |
| 3300021354|Ga0194047_10000344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31538 | Open in IMG/M |
| 3300021354|Ga0194047_10002412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10712 | Open in IMG/M |
| 3300021354|Ga0194047_10003003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9498 | Open in IMG/M |
| 3300021354|Ga0194047_10158595 | Not Available | 919 | Open in IMG/M |
| 3300021354|Ga0194047_10211953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
| 3300021354|Ga0194047_10279688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
| 3300021519|Ga0194048_10000104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 35430 | Open in IMG/M |
| 3300021519|Ga0194048_10002460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9185 | Open in IMG/M |
| 3300021519|Ga0194048_10078911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1286 | Open in IMG/M |
| 3300022555|Ga0212088_10091885 | All Organisms → Viruses → Predicted Viral | 2848 | Open in IMG/M |
| 3300022555|Ga0212088_10093636 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2808 | Open in IMG/M |
| 3300022555|Ga0212088_10285785 | Not Available | 1207 | Open in IMG/M |
| 3300023311|Ga0256681_12183748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300025353|Ga0208255_102934 | All Organisms → Viruses → Predicted Viral | 1809 | Open in IMG/M |
| 3300025372|Ga0207957_1004617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2253 | Open in IMG/M |
| 3300025401|Ga0207955_1019495 | All Organisms → Viruses → Predicted Viral | 1272 | Open in IMG/M |
| 3300025402|Ga0208876_1004724 | All Organisms → Viruses → Predicted Viral | 2735 | Open in IMG/M |
| 3300025429|Ga0208500_1017681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 958 | Open in IMG/M |
| 3300025430|Ga0208622_1010903 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2072 | Open in IMG/M |
| 3300025595|Ga0208248_1070942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
| 3300025606|Ga0207954_1043658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1247 | Open in IMG/M |
| 3300025606|Ga0207954_1049965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1141 | Open in IMG/M |
| 3300025606|Ga0207954_1122325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300025838|Ga0208872_1291340 | Not Available | 509 | Open in IMG/M |
| 3300027708|Ga0209188_1138359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 932 | Open in IMG/M |
| 3300027708|Ga0209188_1294562 | Not Available | 542 | Open in IMG/M |
| 3300027733|Ga0209297_1000261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 35310 | Open in IMG/M |
| 3300027733|Ga0209297_1001156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15355 | Open in IMG/M |
| 3300027733|Ga0209297_1019848 | All Organisms → Viruses → Predicted Viral | 3206 | Open in IMG/M |
| 3300027733|Ga0209297_1040713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2132 | Open in IMG/M |
| 3300027733|Ga0209297_1040988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2123 | Open in IMG/M |
| 3300027733|Ga0209297_1217411 | Not Available | 749 | Open in IMG/M |
| 3300027733|Ga0209297_1218511 | Not Available | 746 | Open in IMG/M |
| 3300027734|Ga0209087_1000269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34188 | Open in IMG/M |
| 3300027734|Ga0209087_1002213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11006 | Open in IMG/M |
| 3300027734|Ga0209087_1004709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7371 | Open in IMG/M |
| 3300027734|Ga0209087_1009974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4879 | Open in IMG/M |
| 3300027734|Ga0209087_1019322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3362 | Open in IMG/M |
| 3300027734|Ga0209087_1058956 | Not Available | 1726 | Open in IMG/M |
| 3300027734|Ga0209087_1111039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1148 | Open in IMG/M |
| 3300027736|Ga0209190_1000965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20556 | Open in IMG/M |
| 3300027741|Ga0209085_1068466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1612 | Open in IMG/M |
| 3300027741|Ga0209085_1279699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
| 3300027746|Ga0209597_1000188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 41258 | Open in IMG/M |
| 3300027749|Ga0209084_1038247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2401 | Open in IMG/M |
| 3300027754|Ga0209596_1149039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1043 | Open in IMG/M |
| 3300027754|Ga0209596_1336075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
| 3300027763|Ga0209088_10000305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 35847 | Open in IMG/M |
| 3300027763|Ga0209088_10002203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12111 | Open in IMG/M |
| 3300027763|Ga0209088_10002514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11217 | Open in IMG/M |
| 3300027763|Ga0209088_10019421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3535 | Open in IMG/M |
| 3300027763|Ga0209088_10096812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1358 | Open in IMG/M |
| 3300027763|Ga0209088_10100268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1328 | Open in IMG/M |
| 3300027763|Ga0209088_10118606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1196 | Open in IMG/M |
| 3300027763|Ga0209088_10172904 | Not Available | 940 | Open in IMG/M |
| 3300027763|Ga0209088_10179330 | Not Available | 918 | Open in IMG/M |
| 3300027777|Ga0209829_10014040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4914 | Open in IMG/M |
| 3300027777|Ga0209829_10114110 | Not Available | 1287 | Open in IMG/M |
| 3300027777|Ga0209829_10317907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
| 3300027782|Ga0209500_10001765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15943 | Open in IMG/M |
| 3300027896|Ga0209777_10510879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 884 | Open in IMG/M |
| 3300027902|Ga0209048_10352497 | Not Available | 1019 | Open in IMG/M |
| 3300027969|Ga0209191_1004858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7725 | Open in IMG/M |
| 3300027973|Ga0209298_10000697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 22435 | Open in IMG/M |
| 3300027973|Ga0209298_10044972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2074 | Open in IMG/M |
| 3300027973|Ga0209298_10189186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 846 | Open in IMG/M |
| 3300028025|Ga0247723_1000655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 22718 | Open in IMG/M |
| 3300028025|Ga0247723_1000683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 22177 | Open in IMG/M |
| 3300028025|Ga0247723_1009357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3928 | Open in IMG/M |
| 3300028025|Ga0247723_1026511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1877 | Open in IMG/M |
| 3300028025|Ga0247723_1096609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
| 3300031746|Ga0315293_10438844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1020 | Open in IMG/M |
| 3300031999|Ga0315274_10430987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1517 | Open in IMG/M |
| 3300032053|Ga0315284_11343718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
| 3300032118|Ga0315277_11035866 | Not Available | 746 | Open in IMG/M |
| 3300032665|Ga0316221_1160535 | Not Available | 773 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 53.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 14.95% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 8.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.12% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 2.58% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.58% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 2.06% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 2.06% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.06% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.03% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.03% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.03% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.03% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.03% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater | 0.52% |
| Estuary Water | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001842 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b | Environmental | Open in IMG/M |
| 3300001849 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b | Environmental | Open in IMG/M |
| 3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
| 3300002930 | Estuary water microbial communities from Pearl Estuary, Zhujiang, China | Environmental | Open in IMG/M |
| 3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
| 3300003785 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH06Jun08 | Environmental | Open in IMG/M |
| 3300003797 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 | Environmental | Open in IMG/M |
| 3300003815 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 | Environmental | Open in IMG/M |
| 3300003824 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22May08 | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
| 3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
| 3300004802 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2M | Environmental | Open in IMG/M |
| 3300004804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M | Environmental | Open in IMG/M |
| 3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
| 3300004806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 | Environmental | Open in IMG/M |
| 3300006104 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 | Environmental | Open in IMG/M |
| 3300006111 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul08 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300020158 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-6m | Environmental | Open in IMG/M |
| 3300020164 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L304-6m | Environmental | Open in IMG/M |
| 3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021600 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11m | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
| 3300025353 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH06Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025372 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025401 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025402 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH03Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025429 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025430 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025595 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M (SPAdes) | Environmental | Open in IMG/M |
| 3300025606 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M (SPAdes) | Environmental | Open in IMG/M |
| 3300025838 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032665 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM30_10577562 | 3300001842 | Marine Plankton | MNFTFTWILDKFGFQPKVEVTPVQKPARKKPAVKKVAVKKASVKKKA* |
| RCM26_10454514 | 3300001849 | Marine Plankton | ILDKFGFQPKVEVTPVQKPARKKPAVKKVAVKKASVKKKA* |
| JGI24028J26656_100197211 | 3300002091 | Lentic | MNFTFTWILDKFGFQAKPTFEMPVAPKPAAKKVARKTVKKATTRKTTKK* |
| JGI24028J26656_10033459 | 3300002091 | Lentic | MNFTFTWILDKFGFQPKVETFDFPFTPTLKKVAKKTVKKATTRKTSTKK* |
| JGI24218J26658_10114131 | 3300002092 | Lentic | MNFTFTWILDKFGFQPKVETFDFSVKPAVKKTVKKSVKIPKATTRKTSTKK* |
| JGI24890J29729_10548543 | 3300002307 | Lentic | MNNMNFTFTWILDKFGLQPKITFTEAPKPAAKKVARKTVKKATTRPKKTK* |
| Water_1003088 | 3300002930 | Estuary Water | MNFTFTWILDKFGFQAKPTFEMPKPVAKKVARKTVKKATTRKTTKK* |
| JGI26470J50227_10077035 | 3300003375 | Freshwater | MNFTFTWILDKFGFTPKIETFDFPVKPAAKKVAKKATKVVAKKTKTTKK* |
| Ga0007851_1009111 | 3300003785 | Freshwater | MNFTFTWILDKFGFTPKAAFDFPVKPAAKKVAKKATKVVAKKTKTTKK*VILWKLTL* |
| Ga0007851_1050902 | 3300003785 | Freshwater | MNFTFTWILDKFGFTPKAAFDFPVKPAAKKVAKKATKVVAKKTKTTKK* |
| Ga0007846_10028565 | 3300003797 | Freshwater | MNFTFTWILDKFGFQTKPAFDFPVKPAAKKVAKKATKVAA |
| Ga0007856_10075743 | 3300003815 | Freshwater | MNFTFTWILDKFGFQPKVETFDFPVKPAIKKTVKKSVKIPKATTRKTSTKK* |
| Ga0007874_10030983 | 3300003824 | Freshwater | MNFTFTWILDKFGFQAKPVFDFPVSPEVKKTVAKKTAKKTVKIAKATTRKPKTK* |
| Ga0007874_10075253 | 3300003824 | Freshwater | MNFTFTWILDKFGFTPKAAFEFPVKPAAKKVAKKATKVAAKKTKTTK |
| Ga0065861_11256651 | 3300004448 | Marine | MNFTFTWILDKFGLQPKITFTEAPKPAAKKAVKKTVKKATTRNTTKK* |
| Ga0066223_13612021 | 3300004461 | Marine | MNFTFTWILDKFGFQAKPIIFDAPKPVAKKATKVAAKKTVKKATTRIKK* |
| Ga0007804_10138585 | 3300004770 | Freshwater | MNFTFTWILDKFGFQPKVETFDFPVKSAVKKTVKKSVKIPKATTRKPSTKK* |
| Ga0007794_100796793 | 3300004774 | Freshwater | MNFTFTWILDKFGFQAKPAFDFPVAKKATKVAAKKTKATTRKTTKK* |
| Ga0007794_101287382 | 3300004774 | Freshwater | MNFTFTWILDKFGFQPKIETFDFPVKKPAVKKVAKKTVKIAKATTRKTTKK*A* |
| Ga0007801_101187273 | 3300004802 | Freshwater | MNFTFTWILDKFGFTPKIETFDFPVKPAAKKVAKKTVKKATTRKPK* |
| Ga0007796_100475041 | 3300004804 | Freshwater | MNFTFTWILDKFGFQAKPAFDFPVSSEVKKAVAKKTTKVAVKKTIKKATTRPKK* |
| Ga0007796_100862261 | 3300004804 | Freshwater | MNFTFTWILDKFGFTPKIETFDFPVSPAVKKTVAKKVAKKAVKIPKATTRKPKTK* |
| Ga0007796_102100862 | 3300004804 | Freshwater | MNFTFTWILDKFGFQAKPAFDFPAKPVTKKATKVAKKTTSVKIPKATTRKPKTK* |
| Ga0007792_101669083 | 3300004805 | Freshwater | MNFTFTWILDKFGFTPKAAFDFPVKPAAKTVAKKATKVAAKKTKTTKK* |
| Ga0007792_101790941 | 3300004805 | Freshwater | MNFTFTWILDKFGFTPKIETFDFPVAKKATKVVAKKTKATTRKTTKK* |
| Ga0007854_103895543 | 3300004806 | Freshwater | MNFTFTWILDKFGFTPKIETFDFPVKPAAKKVTKKTVKKATTRKPK* |
| Ga0007882_101228772 | 3300006104 | Freshwater | MNFTFTWILDKFGFQPKVKTFDFPVKPAIKKTVKKSVKIPKATTRKTSTKK* |
| Ga0007848_10352471 | 3300006111 | Freshwater | GSMNFTFTWILDKFGFQAKPVFDFPVSPEVKKTVAKKTAKKTVKIAKATTRKPKTK* |
| Ga0114973_100014612 | 3300009068 | Freshwater Lake | MNFTFTWILDKFGFQPKIEITPKPVVKKPAAKKPAAKKTVRKKS* |
| Ga0114973_107332963 | 3300009068 | Freshwater Lake | MNFTFTWILDKFGLQPKITFTEAPKPVVKKPAAKKPAPKKTVRKKT* |
| Ga0114962_100189014 | 3300009151 | Freshwater Lake | MNFTLTWIFDKFGFQPKVETFDFPFTPKPVAKKTTKVAAKKTTRKPKSK* |
| Ga0114962_106478463 | 3300009151 | Freshwater Lake | MNFTFTWILDKFGFQAKPAFDFPVVKKATKVVAKKTKATTRKTTKK* |
| Ga0114980_1000073620 | 3300009152 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDLPVKKPAAKKPAAKKTVAKKTVRKKA* |
| Ga0114980_100021359 | 3300009152 | Freshwater Lake | MNFTFTWILDKFGFTPKVETFDFPFTPKPVAKKVAKKTVKKATTRKSKIK* |
| Ga0114980_1000271614 | 3300009152 | Freshwater Lake | MNFTFTWILDKFGFQPKIEIEPIKKPVVKKSAAKKPAAKKTVRKKA* |
| Ga0114980_100129576 | 3300009152 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDFPVPKETKAKKVAAKKTVKKATTRLKK* |
| Ga0114980_100792631 | 3300009152 | Freshwater Lake | MNFTFTWILDKFGLQPKITFNEPPVVKKPAVKKPAAKKTVRKKS* |
| Ga0114980_100905712 | 3300009152 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDFPIKSEPVTKKATTVDKKPAAKKPAAKKTVRKKS* |
| Ga0114980_101101324 | 3300009152 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDLPVKKSAVKKPVAKKPAAKKTVLKKA* |
| Ga0114963_101550884 | 3300009154 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDFPIKSEPAVKKPAAKKPAAKKTVRKKS* |
| Ga0114963_101957622 | 3300009154 | Freshwater Lake | MNFTLTWIFDKFGFQPKVETFNFPFTPKKPVAKKATKVAAKKTTRKPKSK* |
| Ga0114963_103136852 | 3300009154 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDFPIKSEPAVKKSAAKKPAAKKTVRKKS* |
| Ga0114963_106953483 | 3300009154 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDFPIKSEPAVKKPAAKKPAAKKTVRKKA* |
| Ga0114977_100050989 | 3300009158 | Freshwater Lake | MNFTFTWILDKFGFQPKIEITPKPVAKKPAAKKPAVKKTVRKKS* |
| Ga0114977_100071832 | 3300009158 | Freshwater Lake | MNFTFTWILDKFGLQPKVEIFETPKPAVKKPAAKKPAAKKTVRKKT* |
| Ga0114977_100130953 | 3300009158 | Freshwater Lake | MNFTFTWILDKFGLQPKFEINKPVAKPPAAKKPAAKKQATKKTVRKKT* |
| Ga0114977_100404623 | 3300009158 | Freshwater Lake | MNFTFTWILDKFGLQPKIEVFETPKPVVKKPAVKKPAAKKTVRKKA* |
| Ga0114977_100447264 | 3300009158 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDFPVPKEVKARKVAAKKTVKKATTRPKK* |
| Ga0114977_101112294 | 3300009158 | Freshwater Lake | MNFTFTWILDKFGFQPKIEIEPIKKPVAPKPVAKKVAKKTVPKATTRKPKAK* |
| Ga0114977_101314733 | 3300009158 | Freshwater Lake | MNFTFTWILDKFGFQPKVEIAETPVAKTTTTVAKKKPAAKKVVAKKTVRKKA* |
| Ga0114977_104415373 | 3300009158 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDFPIKSEPVVKKATTVAKKTAAKKPAAKKTVRKKS* |
| Ga0114977_104528752 | 3300009158 | Freshwater Lake | MNFTFTWILDKFGLQPKFEINKPVVKPAAKKPAAKKPAAKKTVRKKA* |
| Ga0114978_100324988 | 3300009159 | Freshwater Lake | MNFTFTWILDKFGFQPKIEIAETPKPAVKKPAAKKPAAKKTVRKKA* |
| Ga0114978_102806153 | 3300009159 | Freshwater Lake | MNFTFTWILDKFGFQPKVEVFDLPVKKPVVKKPAAKKP |
| Ga0114978_103047003 | 3300009159 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDFPIKSEPATKKIARKTVKKATTRKTT |
| Ga0114978_105546512 | 3300009159 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDFPVPKEARVKKVAAKKTVKKATTRPKK* |
| Ga0114981_105084262 | 3300009160 | Freshwater Lake | MNFTFTWILDKFGFQPKIEIEPIKKPAAKKVAKKTVQKATTRKPKTK* |
| Ga0114966_106846682 | 3300009161 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDLPVKKPAAKKPAAKKPAAKK |
| Ga0114975_100120572 | 3300009164 | Freshwater Lake | MNFTFTWILDKFGFQPKVDIAETPVAKTTTTVAKKKPAAKKVVAKKTVRKKA* |
| Ga0114975_100124633 | 3300009164 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDLPVKKPVAKKPVAKKPAAKKTVRKKA* |
| Ga0114975_102801683 | 3300009164 | Freshwater Lake | MNFTFTWILDKFGLQPKFEINKPVVKPATKKPAAKKPAAKKTVRKKA* |
| Ga0114975_102925123 | 3300009164 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDLPVKKPAAKKVAKKTVQKATTRKTTTKK* |
| Ga0114975_103670712 | 3300009164 | Freshwater Lake | MNFTFTWILDKFGFQPKIEITPKPAVKKPAAKKPAAKKTVRKKT* |
| Ga0073936_100779304 | 3300009175 | Freshwater Lake Hypolimnion | MNFTFTWILDKFGFQPKVETFDFPVKPAVKKTVKKSVKIPKATTRKTSTKK* |
| Ga0073936_101049354 | 3300009175 | Freshwater Lake Hypolimnion | MNFTFTWILDKFGFQPKIETFDFPVKPVAKKVAKKATKVVAKKTKTTKK* |
| Ga0114979_102050133 | 3300009180 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDFPIKSEPAAKKPVAKKTVKKATTRKTTTKK* |
| Ga0114979_103154753 | 3300009180 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDFPIKSEPVAKKTTTVAKKTAAKKPAAKKTVRKKS* |
| Ga0114979_106143723 | 3300009180 | Freshwater Lake | MNFTFTWILDKFGFTPKIETFDFPIKPAVKKVAKKATKVAAKKTKTTKK* |
| Ga0114969_100858193 | 3300009181 | Freshwater Lake | MNFTFTWILDKFGFTPKIETFDFPFTPKPAAKKVAKKTVKKATTRKPK* |
| Ga0114969_100973232 | 3300009181 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDLPVKKPAAKKPAAKKTVRKKA* |
| Ga0114959_100717313 | 3300009182 | Freshwater Lake | MNFTFTWILDKFGFTPKVETFDFPVAKKATKVAAKKTVKIPKATTRKTTKK* |
| Ga0114959_100966263 | 3300009182 | Freshwater Lake | MNFTFTWILDKFGFTPKIETFDFPVKTAAKTVAKKATKVAAKKTKTTKK* |
| Ga0114959_102083732 | 3300009182 | Freshwater Lake | MNFTFTWILDKFGFQPKAAFDFPVAKKATKVAAKKTVKIPKATTRKPKK* |
| Ga0114974_1000043838 | 3300009183 | Freshwater Lake | MNFTFTWILDKFGFQPKVETFDFPVKPVAKKVAKKTVKKATTRKPK* |
| Ga0114974_102949732 | 3300009183 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDFKPTVKKPVAKKATKVAAKKTVRKPTKK* |
| Ga0114974_104836742 | 3300009183 | Freshwater Lake | MNFTFTWILDKFGFQAKPIFETPKPAAKKVARKTVKKATTRKTLKK* |
| Ga0114974_106597662 | 3300009183 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDLPVKKPTVKKPAAKKPAAKKTVRKKA* |
| Ga0114976_1000022823 | 3300009184 | Freshwater Lake | MNFTFTWILDKFGLQPKITFTEAPKPAAKKVAKKTVKKTTTRNTTKK* |
| Ga0114976_100141055 | 3300009184 | Freshwater Lake | MNFTFTWILDKFGFQPKVEVTETPVAKTTTTVAKKKPATKKVVAKKTVRKKA* |
| Ga0114976_100255206 | 3300009184 | Freshwater Lake | MNFTFTWILDKFGFTPKVETFDFFVEKKPVAKKATKVAAKKTVRKPTKK* |
| Ga0114976_100841443 | 3300009184 | Freshwater Lake | MMNFTFTWILDKFGLQPKIEVFETPKPKKPAAKKPAAKKTVRKKA* |
| Ga0114976_107145911 | 3300009184 | Freshwater Lake | MNFTFTWILDKFGLQPKIEVFETPKPVVKKPAAKKLAAKKTVRKKA* |
| Ga0114951_101969902 | 3300009502 | Freshwater | MNFTFTWILDKFGFQPKVETFDFPVKPAAKKVAKKTIKKATTRKPKIK* |
| Ga0114964_101226491 | 3300010157 | Freshwater Lake | MNFTLTWIFDKFGFQPKVETFDFPFTPKKPAAKKATKVAAKKTTRKPKAK* |
| Ga0114964_102758842 | 3300010157 | Freshwater Lake | MNFTFTWILDKFGFTPKVETFDFPFTPKPAAKKVAKKTVKKATTRKPKAK* |
| Ga0114960_103610942 | 3300010158 | Freshwater Lake | MNFTLTWIFDKFGFQPKVETFDFPFTPKPVAKKTTKVAAKKTTRKPKAK* |
| Ga0133913_102498683 | 3300010885 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDLPVKKPAAKKVARKTVKKATTRNTTKK* |
| Ga0133913_103669566 | 3300010885 | Freshwater Lake | MNFTFTWILDKFGFQPKIEIAETPKPVVKKPVAKKPAA |
| Ga0133913_110435893 | 3300010885 | Freshwater Lake | MAMNFTFTWILDKFGFTPKIETFDLPKAKPVVKKVAKKTVKKATTRNTTKK* |
| Ga0133913_114606213 | 3300010885 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDFPIKKPVAKKVTKVAAKKTVKKATTRKPK* |
| Ga0133913_118534524 | 3300010885 | Freshwater Lake | MNFTFTWILDKFGFQAKPAFEFPIEPEVKKTVAKKATKVAKKTTSVKISKATTRKTPK |
| Ga0133913_120506171 | 3300010885 | Freshwater Lake | MNFTFTWILDKFGFTPKIETFDFSVKKPVAKKATKVAKKTIVPKATTRKKKT* |
| Ga0133913_126402851 | 3300010885 | Freshwater Lake | MNFTFTWILDKFGFQPKVETFDFPVKPVAKKVAKKTVKKAT |
| Ga0133913_126652662 | 3300010885 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDLPVKKPAVKKPAAKKPAAKKTVRKKA* |
| Ga0133913_130573221 | 3300010885 | Freshwater Lake | MNFTFTWILDKFGFQPKAAFDFPVAKKATKVAAKKTVK |
| Ga0153698_112219 | 3300011335 | Freshwater | MNFTFTWILDKFGFQPKVEVTETPVAKTTTTVAKKKPATKKVVAKKTARKKA* |
| Ga0157210_10017458 | 3300012665 | Freshwater | MNFTFTWILDKFGFQPKVEVTETPVAKTTTTVAKKKPAAKKVVAKKTVRKKA* |
| Ga0136642_100356810 | 3300013285 | Freshwater | MNFTFTWILDKFGFQPKVETFDFPVEPKKVAKKATKVAAKKTARKPKAK* |
| Ga0136642_10528724 | 3300013285 | Freshwater | MNFTFTWILDKFGFQPKVETFDFPAKKVAKKATKVAAKKTARKPKAK* |
| Ga0136642_10645304 | 3300013285 | Freshwater | MNFTFTWILDKFGFQPKVETFDFPAKKVVKKATKVAAKKTARK |
| Ga0136642_11568112 | 3300013285 | Freshwater | MNFTFTWILDKFGFQPKIETFDLPVKKPVVKKPAAKKPAAKKTVRKKS* |
| Ga0136641_10466154 | 3300013286 | Freshwater | MNFTFTWILDKFGFQPKIELIKPVAKKTTRVAKKTTKSTVPKATTRTKK* |
| Ga0136641_11948512 | 3300013286 | Freshwater | MNFTFTWILDKFGFQPKIETFDFPVKPAAKKVAKKTVKKATTRPKK* |
| Ga0182021_110801083 | 3300014502 | Fen | MNFTFSWILDKFGFQPKFEIEKPSIVSKPVAKPVAKKVARKTVKKATTRTTTKK* |
| Ga0182021_131958933 | 3300014502 | Fen | MNFTFTWILDKFGLQPKIEVFETPKPVVKKPAAKKPAAKKTVRKKA* |
| Ga0181352_10803011 | 3300017747 | Freshwater Lake | KFGFQPKIETFDLPVKKPAVKKPAAKKPAAKKTVRKKS |
| Ga0181344_10007803 | 3300017754 | Freshwater Lake | MNFTFTWILDKFGFQPKIEIAETPKPVVKKPAAKKPAAKKTVRKKS |
| Ga0181344_11364683 | 3300017754 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDLPVKKPAVKKPAVKKP |
| Ga0181343_10750063 | 3300017766 | Freshwater Lake | MNFTFTWILDKFGFQPKIEIAEKPKSVAKKPVAKKVAAKKTVRKKA |
| Ga0194038_10015107 | 3300020158 | Anoxic Zone Freshwater | MNFTFTWILDKFGFTPKIETFDFPVKPAAKKVAKKATKVVAKKTKTTKK |
| Ga0194038_10039267 | 3300020158 | Anoxic Zone Freshwater | MNFTFTWILDKFGFTPKTFDFPVKPAAKKVAKKATKVVAKKTKTTKK |
| Ga0194038_10234062 | 3300020158 | Anoxic Zone Freshwater | MNFTFTWILDKFGFQAKPAFDFPVKPAAKKVAKKATKVVAKKTKTIKK |
| Ga0194038_10781833 | 3300020158 | Anoxic Zone Freshwater | MNFTFTWILDKFGFTPKIETFDFPVKPAVKKVAKKATKVAAKKTKTTKK |
| Ga0194038_11422383 | 3300020158 | Anoxic Zone Freshwater | MNFTFTWILDKFGFTPKIETFDFPVKPAAKKVAKKTVKKATTRKPK |
| Ga0194037_10677811 | 3300020164 | Anoxic Zone Freshwater | SWQYTCGGSMNFTFTWILDKFGFTPKIETFDFPVKKPVAKTVAKKATKVAAKKTKTTKK |
| Ga0214206_10062904 | 3300021131 | Freshwater | MNFTFTWILDKFGFQAKPAFDFPVKPAAKKVAKKTVKKATTRKPKTK |
| Ga0194047_1000028319 | 3300021354 | Anoxic Zone Freshwater | MNFTFTWILDKFGFQAKPAFDFKPAVKKVAKKATKVVAKKTKTTKK |
| Ga0194047_1000034443 | 3300021354 | Anoxic Zone Freshwater | MNFTFTWILDKFGFQPKIETFDFPVSKAKKVAAKKTVKKATTRLKK |
| Ga0194047_100024125 | 3300021354 | Anoxic Zone Freshwater | MNFTFTWILDKFGFQPKIETFDFPVAKKATKVAAKKTVKKATTRPKK |
| Ga0194047_100030038 | 3300021354 | Anoxic Zone Freshwater | MNFTFTWILDKFGFQAKPAFDFPVKPAVKKVAKKATKVVAKKTKTTKK |
| Ga0194047_101585952 | 3300021354 | Anoxic Zone Freshwater | MNFTFTWILDKFGFTPKAAFDFPVKPAAKKVAKKATKVVAKKTKTTKK |
| Ga0194047_102119533 | 3300021354 | Anoxic Zone Freshwater | MNFTFTWILDKFGFQPKIETFDFPVKPAAKKVAKKATKVVAKKTKTTKK |
| Ga0194047_102796882 | 3300021354 | Anoxic Zone Freshwater | MNFTFTWILDKFGFQPKIEIEPIKPVAKKATRVAKKTTKSTVPKATTRTKK |
| Ga0194048_1000010410 | 3300021519 | Anoxic Zone Freshwater | MNFTFTWILDKFGFQPKVETFDFPFTPTPKKVAKKTVKKATTRKPKAK |
| Ga0194048_100024609 | 3300021519 | Anoxic Zone Freshwater | MNFTFTWILDKFGFTPKIETFEFPVKPAAKKVAKKTVKKATTRKPK |
| Ga0194048_100789113 | 3300021519 | Anoxic Zone Freshwater | MNFTFTWILDKFGFQAKPAFDFPVKPAAKKVAKKATKVVAKKTKTTKK |
| Ga0194059_11578284 | 3300021600 | Anoxic Zone Freshwater | FGFTPKVETFDFPVKPAAKKVAKKTVKKATTRKPK |
| Ga0212088_100918854 | 3300022555 | Freshwater Lake Hypolimnion | MNFTFTWILDKFGFQPKIETFDFPVKPVAKKVAKKATKVVAKKTKTTKK |
| Ga0212088_100936364 | 3300022555 | Freshwater Lake Hypolimnion | MNFTFTWILDKFGFQPKVETFDFPVKPAVKKTVKKSVKIPKATTRKTSTKK |
| Ga0212088_102857852 | 3300022555 | Freshwater Lake Hypolimnion | MNFTFTWILDKFGFQPKVETFDFPVKPAAKKVAKKTIKKATTRKPKIK |
| Ga0256681_121837483 | 3300023311 | Freshwater | FTFTWILDKFGFQPKVETFDFPLKPAVKKTVKKSVKIPKATTRKPSTKK |
| Ga0208255_1029343 | 3300025353 | Freshwater | MNFTFTWILDKFGFQAKPVFDFPVSPEVKKTVAKKTAKKTVKIAKATTRKPKTK |
| Ga0207957_10046174 | 3300025372 | Freshwater | MNFTFTWILDKFGFQPKVETFDFPVKPAIKKTVKKSVKIPKATTRKTSTKK |
| Ga0207955_10194954 | 3300025401 | Freshwater | MNFTFTWILDKFGFQTKPAFDFPVKPAAKKVAKKATKVAAKKTKT |
| Ga0208876_10047244 | 3300025402 | Freshwater | MNFTFTWILDKFGFQPKVETFDFPVKSAVKKTVKKSVKIPKATTRKPSTKK |
| Ga0208500_10176812 | 3300025429 | Freshwater | MNFTFTWILDKFGFQPKVKTFDFPVKPAIKKTVKKSVKIPKATTRKTSTKK |
| Ga0208622_10109036 | 3300025430 | Freshwater | MNFTFTWILDKFGFQPKVETFDFPVKSAVKKTVKKSVK |
| Ga0208248_10709423 | 3300025595 | Freshwater | MNFTFTWILDKFGFQAKPAFDFPVAKKATKVAAKKTKATTRKTTKK |
| Ga0207954_10436583 | 3300025606 | Freshwater | MNFTFTWILDKFGFQAKPAFDFPVEKPVVKKVAKKAVKKATTRKPKTK |
| Ga0207954_10499651 | 3300025606 | Freshwater | NMNFTFTWILDKFGFQAKPAFDFPVSSEVKKAVAKKTTKVAVKKTIKKATTRPKK |
| Ga0207954_11223251 | 3300025606 | Freshwater | MNFTFTWILDKFGFQAKPAFDFPVKPAAKKVAKKAVKIPKATTRKPKTKK |
| Ga0208872_12913401 | 3300025838 | Freshwater | NMNFTFTWILDKFGFTPKIETFDFPVKPAAKKVTKKTVKKATTRKPK |
| Ga0209188_11383592 | 3300027708 | Freshwater Lake | MNFTFTWILDKFGFQPKAAFDFPVAKKATKVAAKKTVKIPKATTRKPKK |
| Ga0209188_12945623 | 3300027708 | Freshwater Lake | MNFTFTWILDKFGFTPKVETFDFPVAKKATKVAAKKTVKIPKATTRKTTKK |
| Ga0209297_100026154 | 3300027733 | Freshwater Lake | MNFTFTWILDKFGFQPKIEIEPIKKPVAPKPVAKKVAKKTVPKATTRKPKAK |
| Ga0209297_100115617 | 3300027733 | Freshwater Lake | MNFTFTWILDKFGFQPKIEITPKPVAKKPAAKKPAVKKTVRKKS |
| Ga0209297_10198485 | 3300027733 | Freshwater Lake | MNFTFTWILDKFGLQPKVEIFETPKPAVKKPAAKKPAAKKTVRKKT |
| Ga0209297_10407133 | 3300027733 | Freshwater Lake | MNFTFTWILDKFGLQPKIEVFETPKPVVKKPAVKKPAAKKTVRKKA |
| Ga0209297_10409885 | 3300027733 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDFPVPKEVKARKVAAKKTVKKATTRPKK |
| Ga0209297_12174113 | 3300027733 | Freshwater Lake | MNFTFTWILDKFGLQPKFEINKPVAKPPAAKKPAAKKQATKKTVRKKT |
| Ga0209297_12185113 | 3300027733 | Freshwater Lake | MNFTFTWILDKFGFQPKVEIAETPVAKTTTTVAKKKPAAKKVVAKKTVRKKA |
| Ga0209087_100026916 | 3300027734 | Freshwater Lake | MNFTFTWILDKFGLQPKITFTEAPKPAAKKVAKKTVKKTTTRNTTKK |
| Ga0209087_100221328 | 3300027734 | Freshwater Lake | MNFTFTWILDKFGFTPKVETFDFFVEKKPVAKKATKVAAKKTVRKPTKK |
| Ga0209087_10047095 | 3300027734 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDFPIKSEPVVKKATTVAKKTAAKKPAAKKTVRKKS |
| Ga0209087_10099748 | 3300027734 | Freshwater Lake | MNFTFTWILDKFGFQPKVEVTETPVAKTTTTVAKKKPATKKVVAKKTVRKKA |
| Ga0209087_10193221 | 3300027734 | Freshwater Lake | MNFTFTWILDKFGLQPKFEINKPVVKPAAKKPAAKKPAAKKTVRKKA |
| Ga0209087_10589562 | 3300027734 | Freshwater Lake | MMNFTFTWILDKFGLQPKIEVFETPKPKKPAAKKPAAKKTVRKKA |
| Ga0209087_11110393 | 3300027734 | Freshwater Lake | MNFTFTWILDKFGFQPKVETFDFPVKPVAKKVAKKTVKKATTRKPK |
| Ga0209190_100096518 | 3300027736 | Freshwater Lake | MNFTFTWILDKFGLQPKITFTETPKPVVKKPAAKKPAPKKTVRKKT |
| Ga0209085_10684662 | 3300027741 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDFPIKSEPAVKKSAAKKPAAKKTVRKKS |
| Ga0209085_12796992 | 3300027741 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDFPIKSEPAVKKPAAKKPAAKKTVRKKS |
| Ga0209597_100018828 | 3300027746 | Freshwater Lake | MNFTFTWILDKFGFQPKIEITPKPVVKKPAAKKPAAKKTVRKKS |
| Ga0209084_10382479 | 3300027749 | Freshwater Lake | IFDKFGFQPKVETFDFPFTPKPVAKKTTKVAAKKTTRKPKSK |
| Ga0209596_11490392 | 3300027754 | Freshwater Lake | MNFTFTWILDKFGFTPKIETFDFPFTPKPAAKKVAKKTVKKATTRKPK |
| Ga0209596_13360753 | 3300027754 | Freshwater Lake | ITSKGSVIMNFTFTWILDKFGFQPKIETFDLPVKKPAAKKPAAKKTVRKKA |
| Ga0209088_1000030510 | 3300027763 | Freshwater Lake | MNFTFTWILDKFGFTPKVETFDFPFTPKPVAKKVAKKTVKKATTRKSKIK |
| Ga0209088_1000220310 | 3300027763 | Freshwater Lake | LLRTKHNKKLIALLVNNMNFTFTWILDKFGFQPKIEIAETPKPAVKKPAAKKPAAKKTVRKKA |
| Ga0209088_1000251429 | 3300027763 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDLPVKKSAVKKPVAKKPAAKKTVLKKA |
| Ga0209088_1001942110 | 3300027763 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDFPVPKETKAKKVAAKKTVKKATTRLKK |
| Ga0209088_100968123 | 3300027763 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDFPIKSEPVTKKATTVDKKPAAKKPAAKKTVRKKS |
| Ga0209088_101002684 | 3300027763 | Freshwater Lake | MNFTFTWILDKFGFQPKIEIEPIKKPVVKKSAAKKPAAKKTVRKKA |
| Ga0209088_101186065 | 3300027763 | Freshwater Lake | MNFTFTWILDKFGFQPKIEIEPIKKPAAKKVAKKTVQKATTRKPKTK |
| Ga0209088_101729043 | 3300027763 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDFPIKSEPAAKKPVAKKTVKKATTRKTTTKK |
| Ga0209088_101793302 | 3300027763 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDFPIKSEPVAKKTTTVAKKTAAKKPAAKKTVRKKS |
| Ga0209829_1001404012 | 3300027777 | Freshwater Lake | MNFTLTWIFDKFGFQPKIETFDFPFTPKKPVAKKATKVAAKKTTRKPKAK |
| Ga0209829_101141105 | 3300027777 | Freshwater Lake | MNFTFTWILDKFGFTPKVETFDFPFTPKPAAKKVAKKTVKKATTRKPKAK |
| Ga0209829_103179071 | 3300027777 | Freshwater Lake | MNFTFTWILDKFGFTPKIETFDFPVKKPVAKKATKVAKKTT |
| Ga0209500_1000176513 | 3300027782 | Freshwater Lake | VNNMNFTFTWILDKFGFQPKIEIAETPKPAVKKPAAKKPAAKKTVRKKA |
| Ga0209777_105108794 | 3300027896 | Freshwater Lake Sediment | MNFTLTWIFDKFGFQPKVETFDFPVKPAAKKVVKKTVKKATTRKPKTK |
| Ga0209048_103524972 | 3300027902 | Freshwater Lake Sediment | MNFTFTWILDKFGFQPKIEIEPIKKPAAKKVARKTVPKATTRKPKAK |
| Ga0209191_10048581 | 3300027969 | Freshwater Lake | MNFTFTWILDKFGFQPKVDIAETPVAKTTTTVAKKKPAAKKVVAKKTVRKKA |
| Ga0209298_1000069717 | 3300027973 | Freshwater Lake | MNFTFTWILDKFGFQPKIETFDLPVKKPAAKKPAAKKTVAKKTVRKKA |
| Ga0209298_100449722 | 3300027973 | Freshwater Lake | MNFTFTWILDKFGLQPKITFNEPPVVKKPAVKKPAAKKTVRKKS |
| Ga0209298_101891861 | 3300027973 | Freshwater Lake | WILDKFGFQPKIEIAETPKPVVKKPVAKKPAAKKTVRKKA |
| Ga0247723_100065536 | 3300028025 | Deep Subsurface Sediment | MNFTFTWILDKFGFQPKVEIAETPVAETTTTVAKKKPAAKKVVAKKTVRKKA |
| Ga0247723_10006836 | 3300028025 | Deep Subsurface Sediment | MNFTFTWILDKFGFQPKIETFDFPVEKPKTVAKKTVKKATTRKTPIKK |
| Ga0247723_10093576 | 3300028025 | Deep Subsurface Sediment | MNFTFTWILDKFGLQPKITITETPKPVVKKPAAKKPAAKKTVRKKA |
| Ga0247723_10265113 | 3300028025 | Deep Subsurface Sediment | MNNMNFTFTWILDKFGLQPKITFTEAPKPVVKKPAVKKPAAKKTVRKKA |
| Ga0247723_10966093 | 3300028025 | Deep Subsurface Sediment | MNFTFTWILDKFGFTPKIETFDLPVKPAAKKVAKKTVKKAITRKPK |
| Ga0315293_104388444 | 3300031746 | Sediment | MNFTFTWILDKFGFQPKIETFEFKKPVAKKATKVAVKKTVRKPTKK |
| Ga0315274_104309875 | 3300031999 | Sediment | MNFTFTWILDKFGFQPKIETFEFKKPAAKKATKVAVKKTVRKPTKK |
| Ga0315284_113437183 | 3300032053 | Sediment | MNFTFTWILDKCGLQPKFAPVAKTIVAKKATKVAAKKTVRKPKAK |
| Ga0315277_110358664 | 3300032118 | Sediment | MNFTFTWILDKFGFQPKIETFDFPVKKPVAKKATKVAAKKTVRKPTKK |
| Ga0316221_11605354 | 3300032665 | Freshwater | SGGSMNFTFTWILDKFGFTPKAAFDFPVKLAAKKVAKKATKVAAKKTKTTKK |
| ⦗Top⦘ |