| Basic Information | |
|---|---|
| Family ID | F027309 |
| Family Type | Metagenome |
| Number of Sequences | 195 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MQESERAAEQGKRPYEAPAIVSEQIFETTALACGKRPAQGGKCNARPKAS |
| Number of Associated Samples | 155 |
| Number of Associated Scaffolds | 195 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 75.38 % |
| % of genes near scaffold ends (potentially truncated) | 25.64 % |
| % of genes from short scaffolds (< 2000 bps) | 84.10 % |
| Associated GOLD sequencing projects | 142 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.16 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.923 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (10.256 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.692 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (34.359 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.26% β-sheet: 0.00% Coil/Unstructured: 89.74% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 195 Family Scaffolds |
|---|---|---|
| PF05402 | PqqD | 41.03 |
| PF04055 | Radical_SAM | 31.79 |
| PF13186 | SPASM | 12.31 |
| PF14907 | NTP_transf_5 | 4.10 |
| PF00717 | Peptidase_S24 | 1.03 |
| PF01011 | PQQ | 0.51 |
| PF04392 | ABC_sub_bind | 0.51 |
| PF13360 | PQQ_2 | 0.51 |
| PF01019 | G_glu_transpept | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 195 Family Scaffolds |
|---|---|---|---|
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.51 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.92 % |
| Unclassified | root | N/A | 3.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c0629778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 893 | Open in IMG/M |
| 3300000955|JGI1027J12803_103608176 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300001199|J055_10220029 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 681 | Open in IMG/M |
| 3300003324|soilH2_10168289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 3040 | Open in IMG/M |
| 3300003993|Ga0055468_10221358 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300004114|Ga0062593_100062780 | All Organisms → cellular organisms → Bacteria | 2403 | Open in IMG/M |
| 3300004114|Ga0062593_102260951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 610 | Open in IMG/M |
| 3300004145|Ga0055489_10074464 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300004268|Ga0066398_10093843 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300004463|Ga0063356_100105321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 3076 | Open in IMG/M |
| 3300004479|Ga0062595_100182827 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300004479|Ga0062595_101692275 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300004480|Ga0062592_100623012 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300004480|Ga0062592_101623925 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300004633|Ga0066395_10346450 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300004643|Ga0062591_100457267 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300005093|Ga0062594_100657328 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300005093|Ga0062594_101042771 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300005175|Ga0066673_10687814 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300005184|Ga0066671_10416822 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300005330|Ga0070690_100265095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 1220 | Open in IMG/M |
| 3300005332|Ga0066388_100672257 | All Organisms → cellular organisms → Bacteria | 1647 | Open in IMG/M |
| 3300005332|Ga0066388_100920033 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300005347|Ga0070668_100304975 | Not Available | 1336 | Open in IMG/M |
| 3300005444|Ga0070694_100131885 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
| 3300005455|Ga0070663_102020732 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005457|Ga0070662_100246825 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
| 3300005457|Ga0070662_101312679 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300005459|Ga0068867_100049472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 3095 | Open in IMG/M |
| 3300005546|Ga0070696_100312823 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300005615|Ga0070702_101788665 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005718|Ga0068866_11275303 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005719|Ga0068861_100634812 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300005764|Ga0066903_100034428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 5819 | Open in IMG/M |
| 3300005764|Ga0066903_102499064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 1000 | Open in IMG/M |
| 3300006049|Ga0075417_10132366 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300006169|Ga0082029_1310387 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300006196|Ga0075422_10111989 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300006755|Ga0079222_10392329 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300006804|Ga0079221_10113507 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300006844|Ga0075428_100002456 | All Organisms → cellular organisms → Bacteria | 20124 | Open in IMG/M |
| 3300006844|Ga0075428_100232509 | All Organisms → cellular organisms → Bacteria | 1989 | Open in IMG/M |
| 3300006845|Ga0075421_101524811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 730 | Open in IMG/M |
| 3300006847|Ga0075431_100080841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 3356 | Open in IMG/M |
| 3300006852|Ga0075433_10104522 | All Organisms → cellular organisms → Bacteria | 2509 | Open in IMG/M |
| 3300006876|Ga0079217_10721752 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300006880|Ga0075429_101031428 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300006894|Ga0079215_10139490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 1139 | Open in IMG/M |
| 3300006894|Ga0079215_11734474 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300006903|Ga0075426_11386900 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300006954|Ga0079219_10224850 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300006969|Ga0075419_10402799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 938 | Open in IMG/M |
| 3300009094|Ga0111539_10213415 | All Organisms → cellular organisms → Bacteria | 2249 | Open in IMG/M |
| 3300009098|Ga0105245_10592590 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300009100|Ga0075418_10353291 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
| 3300009147|Ga0114129_11941568 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300009156|Ga0111538_13463371 | Not Available | 548 | Open in IMG/M |
| 3300009157|Ga0105092_10154256 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300009176|Ga0105242_10074727 | All Organisms → cellular organisms → Bacteria | 2820 | Open in IMG/M |
| 3300009553|Ga0105249_11638350 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300010043|Ga0126380_10321042 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300010359|Ga0126376_12215343 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300010360|Ga0126372_12710212 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300010362|Ga0126377_12532306 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300010362|Ga0126377_13498451 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300010391|Ga0136847_11576650 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
| 3300010403|Ga0134123_10430415 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300010403|Ga0134123_12495103 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300011406|Ga0137454_1050376 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300012355|Ga0137369_10146890 | All Organisms → cellular organisms → Bacteria | 1876 | Open in IMG/M |
| 3300012582|Ga0137358_10367851 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300012685|Ga0137397_10085408 | All Organisms → cellular organisms → Bacteria | 2299 | Open in IMG/M |
| 3300012685|Ga0137397_11116784 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300012922|Ga0137394_10138615 | All Organisms → cellular organisms → Bacteria | 2066 | Open in IMG/M |
| 3300012922|Ga0137394_10519867 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300013100|Ga0157373_10996823 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300013307|Ga0157372_12362265 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300014271|Ga0075326_1061705 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300014272|Ga0075327_1100643 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300014302|Ga0075310_1137707 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300014326|Ga0157380_10134397 | All Organisms → cellular organisms → Bacteria | 2115 | Open in IMG/M |
| 3300014326|Ga0157380_12134425 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300015077|Ga0173483_10726181 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300015264|Ga0137403_10121207 | All Organisms → cellular organisms → Bacteria | 2607 | Open in IMG/M |
| 3300015371|Ga0132258_12653662 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300015371|Ga0132258_13063673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 1157 | Open in IMG/M |
| 3300015372|Ga0132256_103460604 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300015374|Ga0132255_103734631 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300017959|Ga0187779_10936580 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300017966|Ga0187776_10087025 | All Organisms → cellular organisms → Bacteria | 1839 | Open in IMG/M |
| 3300017997|Ga0184610_1077579 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300017997|Ga0184610_1209515 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300018027|Ga0184605_10022528 | All Organisms → cellular organisms → Bacteria | 2543 | Open in IMG/M |
| 3300018028|Ga0184608_10283821 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300018031|Ga0184634_10004781 | All Organisms → cellular organisms → Bacteria | 4493 | Open in IMG/M |
| 3300018052|Ga0184638_1150801 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300018054|Ga0184621_10025239 | All Organisms → cellular organisms → Bacteria | 1861 | Open in IMG/M |
| 3300018059|Ga0184615_10688115 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300018059|Ga0184615_10693758 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300018061|Ga0184619_10526524 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300018063|Ga0184637_10416790 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300018071|Ga0184618_10147812 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300018075|Ga0184632_10152759 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300018076|Ga0184609_10322166 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300018076|Ga0184609_10461938 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300018077|Ga0184633_10026822 | All Organisms → cellular organisms → Bacteria | 2870 | Open in IMG/M |
| 3300018078|Ga0184612_10038385 | All Organisms → cellular organisms → Bacteria | 2488 | Open in IMG/M |
| 3300018422|Ga0190265_11813499 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300018482|Ga0066669_10519339 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300018482|Ga0066669_11008844 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300019360|Ga0187894_10489075 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300019789|Ga0137408_1056226 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300020004|Ga0193755_1030352 | All Organisms → cellular organisms → Bacteria | 1789 | Open in IMG/M |
| 3300021081|Ga0210379_10065421 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
| 3300025318|Ga0209519_10508275 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300025324|Ga0209640_10591536 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300025327|Ga0209751_10114636 | All Organisms → cellular organisms → Bacteria | 2333 | Open in IMG/M |
| 3300025899|Ga0207642_10565460 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300025911|Ga0207654_10220289 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300025912|Ga0207707_10379710 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300025923|Ga0207681_10342093 | Not Available | 1195 | Open in IMG/M |
| 3300025925|Ga0207650_11437920 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300025934|Ga0207686_11460905 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300025935|Ga0207709_10697005 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300025938|Ga0207704_10566972 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300025942|Ga0207689_10240239 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
| 3300025961|Ga0207712_10255815 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
| 3300025961|Ga0207712_10807999 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300026075|Ga0207708_10338648 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300026535|Ga0256867_10173602 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300026944|Ga0207570_1019729 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300027637|Ga0209818_1183210 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300027775|Ga0209177_10317075 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300027787|Ga0209074_10365620 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300027873|Ga0209814_10099785 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300027880|Ga0209481_10536042 | Not Available | 605 | Open in IMG/M |
| 3300027907|Ga0207428_10067432 | All Organisms → cellular organisms → Bacteria | 2817 | Open in IMG/M |
| 3300027907|Ga0207428_10676721 | Not Available | 739 | Open in IMG/M |
| 3300027909|Ga0209382_10339846 | All Organisms → cellular organisms → Bacteria | 1685 | Open in IMG/M |
| 3300027909|Ga0209382_11317475 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300028380|Ga0268265_11238422 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300028381|Ga0268264_10020339 | All Organisms → cellular organisms → Bacteria | 5425 | Open in IMG/M |
| 3300028381|Ga0268264_12244534 | Not Available | 553 | Open in IMG/M |
| 3300028589|Ga0247818_10533376 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300028589|Ga0247818_10557136 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300028590|Ga0247823_11080400 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300028592|Ga0247822_10186128 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
| 3300028596|Ga0247821_11027222 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300028719|Ga0307301_10119531 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300028812|Ga0247825_10030166 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3572 | Open in IMG/M |
| 3300028812|Ga0247825_11206480 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300028814|Ga0307302_10309465 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300028878|Ga0307278_10033859 | All Organisms → cellular organisms → Bacteria | 2331 | Open in IMG/M |
| 3300028889|Ga0247827_10431156 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300030006|Ga0299907_10185599 | All Organisms → cellular organisms → Bacteria | 1718 | Open in IMG/M |
| 3300030006|Ga0299907_10320275 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300030620|Ga0302046_10014906 | All Organisms → cellular organisms → Bacteria | 6538 | Open in IMG/M |
| 3300031184|Ga0307499_10102055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 787 | Open in IMG/M |
| 3300031562|Ga0310886_10092782 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
| 3300031707|Ga0315291_10165081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2298 | Open in IMG/M |
| 3300031716|Ga0310813_10086620 | All Organisms → cellular organisms → Bacteria | 2404 | Open in IMG/M |
| 3300031720|Ga0307469_10071376 | All Organisms → cellular organisms → Bacteria | 2303 | Open in IMG/M |
| 3300031720|Ga0307469_10223931 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
| 3300031720|Ga0307469_10614058 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300031740|Ga0307468_100097731 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
| 3300031740|Ga0307468_100214967 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300031740|Ga0307468_100427452 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300031740|Ga0307468_100755974 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300031740|Ga0307468_100905087 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300031740|Ga0307468_101090764 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300031740|Ga0307468_101763195 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300031740|Ga0307468_101834860 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300031820|Ga0307473_10206936 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300031820|Ga0307473_10905850 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300031854|Ga0310904_10340756 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300031908|Ga0310900_10147053 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 | 1590 | Open in IMG/M |
| 3300031908|Ga0310900_11337199 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300031911|Ga0307412_11915428 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300031944|Ga0310884_10125416 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300031949|Ga0214473_11928962 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300032000|Ga0310903_10061947 | All Organisms → cellular organisms → Bacteria | 1477 | Open in IMG/M |
| 3300032012|Ga0310902_10871184 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300032017|Ga0310899_10270939 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300032122|Ga0310895_10222879 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300032180|Ga0307471_101217938 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300032180|Ga0307471_103218801 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300032205|Ga0307472_101982258 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300032205|Ga0307472_102042330 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300032770|Ga0335085_10099772 | All Organisms → cellular organisms → Bacteria | 3756 | Open in IMG/M |
| 3300032770|Ga0335085_12596975 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300032828|Ga0335080_10149246 | All Organisms → cellular organisms → Bacteria | 2589 | Open in IMG/M |
| 3300033004|Ga0335084_10456266 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300033412|Ga0310810_10067405 | All Organisms → cellular organisms → Bacteria | 4329 | Open in IMG/M |
| 3300033551|Ga0247830_10536419 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300034178|Ga0364934_0000673 | All Organisms → cellular organisms → Bacteria | 10427 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 9.23% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 8.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.13% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.62% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.10% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.05% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.05% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.54% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.54% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.54% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.03% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.03% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.03% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.03% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.03% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.03% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.03% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.51% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.51% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.51% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.51% |
| Lotic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic | 0.51% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.51% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.51% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.51% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.51% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.51% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.51% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.51% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.51% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001199 | Lotic microbial communities from nuclear landfill site in Hanford, Washington, USA - IFRC combined assembly | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004145 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011406 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2 | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014271 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 | Environmental | Open in IMG/M |
| 3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014302 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300026944 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G01K2-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_06297783 | 3300000033 | Soil | MGESERVEPGKRPYEAPAIVSEQIFETTALACGKRPAQGGKCSARPKAS* |
| JGI1027J12803_1036081762 | 3300000955 | Soil | MRETAMDKPEAAREQTRRPYEPPAILSEQIFETTALACSKRPAQGGKCNTRPKSS* |
| J055_102200292 | 3300001199 | Lotic | MSPESRPKKPYEPPAIQTEEIFETTALACAKRPGQSAMCNTRAKNS* |
| soilH2_101682894 | 3300003324 | Sugarcane Root And Bulk Soil | MEKKRPYEPPAITSEQIFETTALACGKKSGQGGKCNSRPKAS* |
| Ga0055468_102213582 | 3300003993 | Natural And Restored Wetlands | MEPTERVATPSKRPYEAPAIVSEQIFETTALACAKQSGMGGICMGRPKAS* |
| Ga0062593_1000627802 | 3300004114 | Soil | MEKSERVAQPGKRPYEAPAIVSEQIFETTALACGKVPAQGGKCNARPKAS* |
| Ga0062593_1022609513 | 3300004114 | Soil | MEKKRPYEPPAVTSEQIFETTALACGKKPAQGGKCSTRPKAS* |
| Ga0055489_100744643 | 3300004145 | Natural And Restored Wetlands | MTQSARGPEQRKRPYEAPAIVSEQIFETTALACGKRPAEGGKCNARPKAS* |
| Ga0066398_100938431 | 3300004268 | Tropical Forest Soil | MEKKRPYEPPAVTSEQIFETTALACGKTAALGGKCNSRPKAS* |
| Ga0063356_1001053213 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MEQSGRAAEPGKRPYEAPAIVSEQIFETTALACGKRSGPGSLCKGRPKAS* |
| Ga0062595_1001828271 | 3300004479 | Soil | MRETAMDKPEAAREQARRPYEPPAILSEQIFETTALACSKRPAQGGKCNSRPKSS* |
| Ga0062595_1016922752 | 3300004479 | Soil | MEKSDPAAAPGKRPYEAPAIVSEQIFETTALACGKRPAQGGKCNARPKAS* |
| Ga0062592_1006230123 | 3300004480 | Soil | MGESERVEPGKRPYEAPAIVSEQIFETTALACGKRPAQGGKCNTRPKAS* |
| Ga0062592_1016239252 | 3300004480 | Soil | MEKKRPYEPPAVTSEQIFETTALACGKKTGQGGKCNTRPKAS* |
| Ga0066395_103464502 | 3300004633 | Tropical Forest Soil | MRENAMDKSEATGEQARRPYEPPAIVSEQMFETTALACGKRTGEGGKCNSRPKSS* |
| Ga0062591_1004572672 | 3300004643 | Soil | MDRSEATGEQARRPYEPPAIVSEQIFETTALACAKRQGQGAKCNVRPKSS* |
| Ga0062594_1006573282 | 3300005093 | Soil | MEKKRPYEPPAVTSEQIFETTALACGKKTAQGGKCNTRPKAS* |
| Ga0062594_1010427713 | 3300005093 | Soil | MEKSDPAAAPGKRPYEAPAIVSEQIFETTALACGKRPAQGGKCNVRPKAS* |
| Ga0066673_106878141 | 3300005175 | Soil | MDKKRPYEPPAVTSEQIFETTALACGKKPAQGGKCNARPKAS* |
| Ga0066671_104168222 | 3300005184 | Soil | MDKSEPRKRPYEPPAVTSEQIFETTALACGKKPAQGGKCNARPQTS* |
| Ga0070690_1002650952 | 3300005330 | Switchgrass Rhizosphere | MDKKRPYEPPAVTSEQIFETTALACGKKTAQGGKCNTRPKAS* |
| Ga0066388_1006722573 | 3300005332 | Tropical Forest Soil | MEKKRPYEPPAVTSEQIFETTALACGKVAAVGGKCNSRPKAS* |
| Ga0066388_1009200332 | 3300005332 | Tropical Forest Soil | MERKRPYEPPAITSEQIFETTALACGKKSGQGGQCNPRPKAS* |
| Ga0070668_1003049754 | 3300005347 | Switchgrass Rhizosphere | MDKRPEPAEDKRRPYEPPAIVSEQIFETTALACAKRPAEGGKCNLRAKAS* |
| Ga0070694_1001318851 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKKRPYEPPAVTSEQIFETTALACGKKPAQGGKCNTRPKAS* |
| Ga0070663_1020207321 | 3300005455 | Corn Rhizosphere | MEKSDPPAAPGKRPYEAPAIVSEQIFETTALACGKRPAQGGKCNVRPKAS* |
| Ga0070662_1002468253 | 3300005457 | Corn Rhizosphere | GMRETAMDKPEAAREQARRPYEPPAILSEQIFETTALACSKRPAQGGKCNARPKSS* |
| Ga0070662_1013126791 | 3300005457 | Corn Rhizosphere | KRPYEAPAIVSEQIFETTALACGKVPAQGGKCNARPKAS* |
| Ga0068867_1000494723 | 3300005459 | Miscanthus Rhizosphere | MDKPEAAREQARRPYEPPAILSEQIFETTALACSKRPAQGGKCNSRPKSS* |
| Ga0070696_1003128233 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRPQEPQTGKRPYEPPAITSEAVFETTALACNKRMGQSAKCNFSPKNS* |
| Ga0070702_1017886652 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MQEPQRAADSGKRPYEAPAISSEQIFETTALACGKRQAQGGKCNTRPKAS* |
| Ga0068866_112753032 | 3300005718 | Miscanthus Rhizosphere | EKSDPAAAPGKRPYEAPAIVSEQIFETTALACGKRPAQGGKCNARPKAS* |
| Ga0068861_1006348122 | 3300005719 | Switchgrass Rhizosphere | MDKPEAASEQARRPYEPPAIVSEQIFETTALACAKRQGQGLKCLFRPKSS* |
| Ga0066903_1000344287 | 3300005764 | Tropical Forest Soil | MDKSEATGEQARRPYEPPAIVSEQMFETTALACGKRTGEGGKCNSRPKSS* |
| Ga0066903_1024990643 | 3300005764 | Tropical Forest Soil | MDTEPSREEARPAPSARRPYEPPRILSETIFETTALACGKLPAQGGKCSSRPKNS* |
| Ga0075417_101323662 | 3300006049 | Populus Rhizosphere | MEQERVGESGKRPYEAPAIVSEQIFETTALACGKRPAQGGKCNARPKAS* |
| Ga0082029_13103872 | 3300006169 | Termite Nest | MEKRRPYEPPAVTSEQIFETTALACAKKAAQGGKCNTRPKAS* |
| Ga0075422_101119892 | 3300006196 | Populus Rhizosphere | EETAMDKRPEQAEDKRRPYEPPRIVSEQIFETTALACAKRPAEGGKCNLRAKSS* |
| Ga0079222_103923291 | 3300006755 | Agricultural Soil | MESERTAETGKRPYEAPAISSEQIFETTALACGKRQAQGGKCNARPKAS* |
| Ga0079221_101135072 | 3300006804 | Agricultural Soil | MDKPESGKRPYEPPAVTSEQIFETTALACGKKPAQGGKCNSRPQTS* |
| Ga0075428_10000245613 | 3300006844 | Populus Rhizosphere | MDKPEAASEQARRPYEPPAIVSEQIFETTALACAKRQGQGSKCLFRSKSS* |
| Ga0075428_1002325095 | 3300006844 | Populus Rhizosphere | MDTRPEQAEDKRRPYEPPRIVSEQIFETTALACAKRPAEGGKCNLRAKSS* |
| Ga0075421_1015248112 | 3300006845 | Populus Rhizosphere | MEQSGRAAEPAKRPYEAPAIVSEQIFETTALACGKRSGPGSLCKGRPKAS* |
| Ga0075431_1000808412 | 3300006847 | Populus Rhizosphere | MGESERVEPGKRPYEAPAIVSEQIFETTALACGKRPAQGGKCNARPKAS* |
| Ga0075433_101045222 | 3300006852 | Populus Rhizosphere | MMDKKRPYEPPAVTSEQIFETTALACGKKPAQGGKCTARPKAS* |
| Ga0079217_107217522 | 3300006876 | Agricultural Soil | VKTPETSAQQGKRPYEAPAIVSERLFETTALACGKRMGQGAKCNARPKAS* |
| Ga0075429_1010314283 | 3300006880 | Populus Rhizosphere | MDKPEAASEQARRPYELPAIVSEQIFETTALACAKRQGQGSKCLFRSKSS* |
| Ga0079215_101394903 | 3300006894 | Agricultural Soil | VKTPETAAQQGKRPYEAPAIVSERLFETTALACGKRMGQGAKCNARPKAS* |
| Ga0079215_117344742 | 3300006894 | Agricultural Soil | MDKKRPYEPPAITSEQIFETTALACGKKQAQGGKCNARPKAS* |
| Ga0075426_113869002 | 3300006903 | Populus Rhizosphere | MDKKRPYEPPAITSEQIFETTALACGKIAAQGGKCNARPKAS* |
| Ga0079219_102248502 | 3300006954 | Agricultural Soil | GELEEIVMDKPESGKRPYEPPAVTSEQIFETTALACGKKPAQGGKCNSRPQTS* |
| Ga0075419_104027991 | 3300006969 | Populus Rhizosphere | MDKRPEQAEDKRRPYEPPRIVSEQIFETTALACAKRPAEGGKCNLRAKSS* |
| Ga0111539_102134154 | 3300009094 | Populus Rhizosphere | MDKKRPYEPPAVTSEQIFETTALACGKKPAQGGKCTARPKAS* |
| Ga0105245_105925902 | 3300009098 | Miscanthus Rhizosphere | YEPPAILSEQIFETTALACSKRPAQGGKCNSRPKSS* |
| Ga0075418_103532912 | 3300009100 | Populus Rhizosphere | MTMEQERVGESGKRPYEAPAIVSEQIFETTALACGKRPAQGGKCNARPKAS* |
| Ga0114129_119415682 | 3300009147 | Populus Rhizosphere | MQEPERAAEQVKRPYEAPAIASEQIFETTALACGKKPAQSGPCIVKRKAS* |
| Ga0111538_134633712 | 3300009156 | Populus Rhizosphere | MDKRPEPAEDKRRPYEPPRIVSEQIFETTALACAKRPAEGGKCNLRAKSS* |
| Ga0105092_101542562 | 3300009157 | Freshwater Sediment | VEQPERGAEQGKRPYEAPAIVSEQIFETTALACGKLPAQGGKCNARPKAS* |
| Ga0105242_100747275 | 3300009176 | Miscanthus Rhizosphere | MDKPEAAREQARRPYEPPAILSEQIFETTALACSKRPAQGGKCNARPKSS* |
| Ga0105249_116383501 | 3300009553 | Switchgrass Rhizosphere | MDKPEVAREQARRPYEPPAILSEQIFETTALACSKRPAQGGKCNSRPKS |
| Ga0126380_103210422 | 3300010043 | Tropical Forest Soil | MRENAMDKPGATAEPARRPYEPPAIVSEQIFETTALACAKNQGQGGKCNARPKSS* |
| Ga0126376_122153431 | 3300010359 | Tropical Forest Soil | GDTSMERKRPYEPPAITSEQIFETTALACGKKSGQGGQCNPRPKAS* |
| Ga0126372_127102121 | 3300010360 | Tropical Forest Soil | NAMDKPGATVEPARRPYEPPAIVSEQMFETTALACGKRTGEGGKCNSRPKSS* |
| Ga0126377_125323063 | 3300010362 | Tropical Forest Soil | MERKRPYEPPAITSEHIFETTALACGKKSGQGGQCNPRPKAS* |
| Ga0126377_134984512 | 3300010362 | Tropical Forest Soil | MRESAMDKPEATGGSARRPYEPPAIVSEQIFETTALACAKRQGQGAKCNVRPKSS* |
| Ga0136847_115766502 | 3300010391 | Freshwater Sediment | MQESERAAEQVKRPYEAPAIASEQIFETTALACGKKPAQGGKCNARRKAS* |
| Ga0134123_104304152 | 3300010403 | Terrestrial Soil | MQEPQRAADSGKRPYEAPAISSEQIFETTALACGKKTAQGGKCNTRPKAS* |
| Ga0134123_124951032 | 3300010403 | Terrestrial Soil | MDRSEATEKQARRPYEPPAIVSEQIFETTALACSKRPAQGGKCNARPKSS* |
| Ga0137454_10503762 | 3300011406 | Soil | MQESERAAEQGKRPYEAPAIASEQIFETTALACGKRPAQGGKCNVRPKAS* |
| Ga0137369_101468903 | 3300012355 | Vadose Zone Soil | MQESERTAEQGKRPYEAPAIASEQIFETTALACGKRLAEGGKCTTRPKAS* |
| Ga0137358_103678512 | 3300012582 | Vadose Zone Soil | MTESERTAEPTKRPYEAPAIASEQLFETTALACGKRPAQGGKCNTRPKAS* |
| Ga0137397_100854083 | 3300012685 | Vadose Zone Soil | MEKKRPYEPPAVTSEQIFETTALACGKKPAQGGKCNARPKAS* |
| Ga0137397_111167842 | 3300012685 | Vadose Zone Soil | MDKPEAAREQTRRPYEPPAILSEQIFETTALACSKRPAQGGKCNTRPKSS* |
| Ga0137394_101386153 | 3300012922 | Vadose Zone Soil | MQESERAAEQGKRPYEAPAIASEQIFETTALACGKRPAQGGKCNARPKAS* |
| Ga0137394_105198673 | 3300012922 | Vadose Zone Soil | MDKPEAAREQTRRPYEPPAILSEQIFETTALACSKRPAQGGKCNARPKSS* |
| Ga0157373_109968232 | 3300013100 | Corn Rhizosphere | GGGMRETAMDKPEAAREQARRPYEPPAILSEQIFETTALACSKRPAQGGKCNSRPKSS* |
| Ga0157372_123622653 | 3300013307 | Corn Rhizosphere | MDKPEAAREQARRPYEPPAIVSEQIFETTALACAKRQGQGLKCLFRPKSS* |
| Ga0075326_10617052 | 3300014271 | Natural And Restored Wetlands | RRRKEEPMESSEPGTRQGKRPYEAPAVVSERIFETTALACGKKTGGAGKCMGLPKAS* |
| Ga0075327_11006431 | 3300014272 | Natural And Restored Wetlands | PYEAPAVVSERIFETTALACGKKTGGAGKCMGLPKAS* |
| Ga0075310_11377072 | 3300014302 | Natural And Restored Wetlands | VEQPERGAEQGKRPYEAPAIVSEQIFETTALACGKVPAQGGKCIGRPKAS* |
| Ga0157380_101343972 | 3300014326 | Switchgrass Rhizosphere | MDRSEATGEQARRPYEPPAILSEQIFETTALACSKRPAQGCKCNSRPKSP* |
| Ga0157380_121344252 | 3300014326 | Switchgrass Rhizosphere | MEKSERGAEQGKRPYEPPAILSEQIFETTALACSKRPAQGGKCNSRPKSS* |
| Ga0173483_107261812 | 3300015077 | Soil | YEAPAIVSEQIFETTALACGKRPAQGGKCNARPKAS* |
| Ga0137403_101212071 | 3300015264 | Vadose Zone Soil | RSPMTESERTAEPTKRPYEAPAIASEQLFETTALACGKRPAQGGKCNTRPKAS* |
| Ga0132258_126536623 | 3300015371 | Arabidopsis Rhizosphere | MRESAMDKPEATDHQARRPYEPPAIVSEQIFETTALACSKRPAQGGKCNSRPKSS* |
| Ga0132258_130636731 | 3300015371 | Arabidopsis Rhizosphere | TGEQARRPYEPPAIVSEQIFETTALACAKRQGQGAKCNVRPKSS* |
| Ga0132256_1034606042 | 3300015372 | Arabidopsis Rhizosphere | MRESAMDKPEATDKQARRPYEPPAILSEQVFETTALACSKRPAQGGKCNARPKSS* |
| Ga0132255_1037346311 | 3300015374 | Arabidopsis Rhizosphere | DKQARRPYEPPAILSGQAFETTALACSKRPAQGGKCNARPKSS* |
| Ga0187779_109365802 | 3300017959 | Tropical Peatland | MEKKRPYEPPAVTSEQIFETTALACGKKPAQGGKCNARPKSS |
| Ga0187776_100870253 | 3300017966 | Tropical Peatland | VDKKRPYEPPAVVSEQIFETTALACAKKPAQGGKCNARPKAS |
| Ga0184610_10775792 | 3300017997 | Groundwater Sediment | MQESERAAEQVKRPYEAPAIASEQIFETTALACGKKPAQGGKCSARPKAS |
| Ga0184610_12095151 | 3300017997 | Groundwater Sediment | MQESERAAEQGKRPYEAPAIASEQIFETTALACGKKPAQGGKCSARPKAS |
| Ga0184605_100225283 | 3300018027 | Groundwater Sediment | MQESERAAEQGKRPYEAPAIVSEQIFETTALACGKRPAQGGKCNARPKAS |
| Ga0184608_102838211 | 3300018028 | Groundwater Sediment | NPYGAASGGVTEESMQEPERAAEQVKRPYEAPAIASEQIFETTALACGKRPAQGGKCNARPKSS |
| Ga0184634_100047812 | 3300018031 | Groundwater Sediment | MQESERAAEQVKRPYEAPAIASEQIFETTALACGKKPAQGGKCNARRKAS |
| Ga0184638_11508012 | 3300018052 | Groundwater Sediment | MQESQRAAEQGKRPYEAPAIASEQIFETTALACGKKPAQGGKCNARPKAS |
| Ga0184621_100252392 | 3300018054 | Groundwater Sediment | MQESERAAEQGKRPYEAPAIVSEQIFETTALACGKKPAQGGKCAARPKAS |
| Ga0184615_106881152 | 3300018059 | Groundwater Sediment | MQESERAAEQGKRPYEAPAIASEQIFETTALACGKRPAQGGKCNVRPKAS |
| Ga0184615_106937582 | 3300018059 | Groundwater Sediment | MQESERAAEQGKRPYEAPAIASEQIFETTALACGKRPAQGGKCNARPKAS |
| Ga0184619_105265242 | 3300018061 | Groundwater Sediment | MQEPERAADQVKRPYEAPAIVSEQIFETTALACGKRPAQGGKCNVRPKAS |
| Ga0184637_104167901 | 3300018063 | Groundwater Sediment | QVKRPYEAPAIASEQIFETTALACGKKPAQGGKCSARPKAS |
| Ga0184618_101478122 | 3300018071 | Groundwater Sediment | MQESERAAEQGKRPYEAPAIVSEQIFETTALACGKRPAQGGKCNVRPKAS |
| Ga0184632_101527592 | 3300018075 | Groundwater Sediment | MQESERAAEQGKRPYEAPAIASEQIFETTALACGKRPAQGSKCNARPKAS |
| Ga0184609_103221661 | 3300018076 | Groundwater Sediment | MQESERAAEQGKRPYEAPAIASEQIFETTALACGKKPAQGGKCAARPKAS |
| Ga0184609_104619382 | 3300018076 | Groundwater Sediment | MQESQRAAEQGKRPYEAPAIASEQIFETTALACGKLAGQGAKCNARPKAS |
| Ga0184633_100268222 | 3300018077 | Groundwater Sediment | MQESERAAEQVKRPYEAPAIASEQIFETTALACGKKPAQGGKCNARPKAS |
| Ga0184612_100383853 | 3300018078 | Groundwater Sediment | MQESEHAAEQGKRPYEAPAIASEQIFETTALACGKKPAQGGKCNARPKAS |
| Ga0190265_118134991 | 3300018422 | Soil | QSERVVEQGKRPYEAPAIVSEQIFETTALACGKRPAQGGKCNARPKAS |
| Ga0066669_105193392 | 3300018482 | Grasslands Soil | MDKSEPRKRPYEPPAVTSEQIFETTALACGKKPAQGGKCNARPQTS |
| Ga0066669_110088442 | 3300018482 | Grasslands Soil | MEKKRPYEPPAVTSEQIFETTALACGKKPAQGGKCNARPKAS |
| Ga0187894_104890751 | 3300019360 | Microbial Mat On Rocks | MAAAPNETPGGKRPYEAPAITSEAVFETTALACNKKMGQSAKCNASPKNS |
| Ga0137408_10562263 | 3300019789 | Vadose Zone Soil | MTESERTAEPTKRPYEAPAIASEQLFETTALACGKRPAQGGKCNTRPKAS |
| Ga0193755_10303523 | 3300020004 | Soil | MAESERTAEPTKRPYEAPAIASEQLFETTALACGKRPAQGGKCNARPKAS |
| Ga0210379_100654212 | 3300021081 | Groundwater Sediment | MQESERAAEQGKRPYEAPAIASEQIFETTALACGKRPAEGGKCNARPKAS |
| Ga0209519_105082753 | 3300025318 | Soil | MEHSERVAVPGKRPYEAPAIVSEQIFETTALACGKVPPQGGKCIGRPKAS |
| Ga0209640_105915362 | 3300025324 | Soil | MDKPEREGEPSKRPYEAPAIVSEQIFETTALACGKRPAQGGKCNRRPKAS |
| Ga0209751_101146363 | 3300025327 | Soil | MDKSEQGKRPYEAPAIVSEQIFETTALACGKRPAQGGKCNARPKAS |
| Ga0207642_105654601 | 3300025899 | Miscanthus Rhizosphere | QPGKRPYEAPAIVSEQIFETTALACGKVPAQGGKCNARPKAS |
| Ga0207654_102202893 | 3300025911 | Corn Rhizosphere | MDKPEAAREQARRPYEPPAILSEQIFETTALACSKRPAQGGKCNSRPKSS |
| Ga0207707_103797103 | 3300025912 | Corn Rhizosphere | MEKSERVAQPGKRPYEAPAIVSEQIFETTALACGKVPAQGGKCNARPKAS |
| Ga0207681_103420933 | 3300025923 | Switchgrass Rhizosphere | MDKRPEPAEDKRRPYEPPAIVSEQIFETTALACAKRPAEGGKCNLRAKAS |
| Ga0207650_114379201 | 3300025925 | Switchgrass Rhizosphere | MEKSDPAAAPGKRPYEAPAIVSEQIFETTALACGKRPAQGGKCNVRPKTS |
| Ga0207686_114609051 | 3300025934 | Miscanthus Rhizosphere | MDKPEAAREQARRPYEPPAILSEQIFETTALACSKRPAQGGKCNARPKSS |
| Ga0207709_106970053 | 3300025935 | Miscanthus Rhizosphere | MDRSEATGEQARRPYEPPAIVSEQIFETTALACSKRPAQVGKCNARPKSS |
| Ga0207704_105669722 | 3300025938 | Miscanthus Rhizosphere | MRETAMDKPEAAREQARRPYEPPAILSEQIFETTALACSKRPAQGGKCNSRPKSS |
| Ga0207689_102402394 | 3300025942 | Miscanthus Rhizosphere | MDKKRPYEPPAVTSEQIFETTALACGKKTAQGGKCNTRPKAS |
| Ga0207712_102558153 | 3300025961 | Switchgrass Rhizosphere | TAMDKPEVAREQARRPYEPPAILSEQIFETTALACSKRPAQGGKCNSRPKSS |
| Ga0207712_108079993 | 3300025961 | Switchgrass Rhizosphere | MDKPEAAREQARRPYEPPAILSEQIFETTALACSKRPAQGGKCNSRP |
| Ga0207708_103386482 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKSDPAAAPGKRPYEAPAIVSEQIFETTALACGKRPAQGGKCNARPKAS |
| Ga0256867_101736022 | 3300026535 | Soil | MERSEPGTQQGKRPYETPAVVSERIFETTALACGKKTGGAGKCMGQPKAS |
| Ga0207570_10197292 | 3300026944 | Soil | EKSERVAQPGKRPYEAPAIVSEQIFETTALACGKVPAQGGKCNARPKAS |
| Ga0209818_11832101 | 3300027637 | Agricultural Soil | VKTPETSAQQGKRPYEAPAIVSERLFETTALACGKRMGQGAKCNARPKAS |
| Ga0209177_103170752 | 3300027775 | Agricultural Soil | GHAARGGVAEVTMESERTAETGKRPYEAPAISSEQIFETTALACGKRQAQGGKCNARPKA |
| Ga0209074_103656201 | 3300027787 | Agricultural Soil | GKRPYEAPAISSEQIFETTALACGKRQAQGGKCNARPKAS |
| Ga0209814_100997853 | 3300027873 | Populus Rhizosphere | MEQERVGESGKRPYEAPAIVSEQIFETTALACGKRPAQGGKCNARPKAS |
| Ga0209481_105360421 | 3300027880 | Populus Rhizosphere | MDTRPEQAEDKRRPYEPPRIVSEQIFETTALACAKRPAEGGKCNLRAKSS |
| Ga0207428_100674322 | 3300027907 | Populus Rhizosphere | MDKPEAASEQARRPYELPAIVSEQIFETTALACAKRQGQGSKCLFRSKSS |
| Ga0207428_106767211 | 3300027907 | Populus Rhizosphere | MDKRPEQAEDKRRPYEPPRIVSEQIFETTALACAKRPAEGGKCNLRAKSS |
| Ga0209382_103398462 | 3300027909 | Populus Rhizosphere | MGESERVEPGKRPYEAPAIVSEQIFETTALACGKRPAQGGKCNTRPKAS |
| Ga0209382_113174753 | 3300027909 | Populus Rhizosphere | MEQSGRAAEPAKRPYEAPAIVSEQIFETTALACGKRSGPGSLCKGRPKAS |
| Ga0268265_112384221 | 3300028380 | Switchgrass Rhizosphere | MEKKRPYEPPAVTSEQIFETTALACGKKPAQGGKCNTRPKAS |
| Ga0268264_100203396 | 3300028381 | Switchgrass Rhizosphere | MDKPEAAREQARRPYAPPAILSEQIFETTALACSKRPAQGGKCNSRPKSS |
| Ga0268264_122445343 | 3300028381 | Switchgrass Rhizosphere | RPYEPPAVTSEQIFETTALACGKKTAQGGKCNTRPKAS |
| Ga0247818_105333762 | 3300028589 | Soil | RRPYELPAIVSEQIFETTALACAKRQGQGSKCLFRSKSS |
| Ga0247818_105571362 | 3300028589 | Soil | MEQSGRAAEPGKRPYEAPAIVSEQIFETTALACGKRSGPGSLCKGRPKAS |
| Ga0247823_110804002 | 3300028590 | Soil | MGESERVEPGKRPYEAPAIVSEQIFETTALACGKRPAQGGKCSARPKAS |
| Ga0247822_101861282 | 3300028592 | Soil | MDKPEAASEQARRPYEPPAIVSEQIFETTALACAKRQGQGSKCLFRSKSS |
| Ga0247821_110272221 | 3300028596 | Soil | YELPAIVSEQIFETTALACAKRQGQGSKCLFRSKSS |
| Ga0307301_101195313 | 3300028719 | Soil | MQESERAAEQGKRPYEAPAIVSEQIFETTALACGKRPAQGGK |
| Ga0247825_100301666 | 3300028812 | Soil | MGESERVEPGKRPYEAPAIVSEQIFETTALACGKRPAQGGKCSA |
| Ga0247825_112064802 | 3300028812 | Soil | PYEAPAIVSEQIFETTALACGKRPAEGGKCNARPKAS |
| Ga0307302_103094652 | 3300028814 | Soil | EAPAIVSEQIFETTALACGKRPAQGGKCNVRPKAS |
| Ga0307278_100338593 | 3300028878 | Soil | MQESERAAEQGKRPYEAPAIASEQIFETTALACGKRPSEGGKCVARPKAS |
| Ga0247827_104311561 | 3300028889 | Soil | RERGMEQSGRAAEPGKRPYEAPAIVSEQIFETTALACGKRSGPGSLCKGRPKAS |
| Ga0299907_101855993 | 3300030006 | Soil | VEQSERGAAQGKRPYEAPAIVSEQIFETTALACGKLPAQGGKCNARPKAS |
| Ga0299907_103202752 | 3300030006 | Soil | MTDSERVAEHGKRPYEAPAIVSEQIFETTALACGKRPAEGGKCNARPKAS |
| Ga0302046_100149066 | 3300030620 | Soil | SERVAVPGKRPYEAPAIVSEQIFETTALACGKVPPQGGKCIGRPKAS |
| Ga0307499_101020552 | 3300031184 | Soil | MDRSEATEKQARRPYEPPAIVSEQIFETTALACAKRQGQGAKCNVRPKSS |
| Ga0310886_100927822 | 3300031562 | Soil | MEKSERGAEQGKRPYEAPVIVSEQIFETTALACGKRPAQGGKCNARPKAS |
| Ga0315291_101650812 | 3300031707 | Sediment | KPYSKPACVSEEIFETTALACAKRPGQGGTCNAAPRSS |
| Ga0310813_100866202 | 3300031716 | Soil | MQESQRAADSGKRPYEAPAISSEQIFETTALACGKRQAQGGKCNTRPKAS |
| Ga0307469_100713763 | 3300031720 | Hardwood Forest Soil | PGAPPIKEKNMEKKRPYEPPAVTSEQIFETTALACGKKPAQGGKCNSRPKAS |
| Ga0307469_102239312 | 3300031720 | Hardwood Forest Soil | MDKPEAAGEQTRRPYEPPAIVSEQIFETTALACAKRQGQGLKCLFRPKSS |
| Ga0307469_106140583 | 3300031720 | Hardwood Forest Soil | MDKPEATDKQARRPYEPPAILSEQVFETTALACGKRPAQGGKCNNRPKSS |
| Ga0307468_1000977313 | 3300031740 | Hardwood Forest Soil | MDKPEAASEQARRPYEPPAIVSEQIFETTALACAKRQGQGLKCLFRPKSS |
| Ga0307468_1002149672 | 3300031740 | Hardwood Forest Soil | MDKSADGKRPYEPPAITSEQIFETTALACGKKQAQGGKCAARPKAS |
| Ga0307468_1004274522 | 3300031740 | Hardwood Forest Soil | MRESAMDKPEATDKQARRPYEPPAILSEQVFETTALACGKRPAQGGKCNNRPKSS |
| Ga0307468_1007559741 | 3300031740 | Hardwood Forest Soil | MPEPERAAEPVKRPYEAPAIASEQIFETTALACGKKPAQGGKCNSRPKAS |
| Ga0307468_1009050872 | 3300031740 | Hardwood Forest Soil | MDRSEATGEQARRPYEPPAIVSEQIFETTALACAKRQGQGAKCNVRPKSS |
| Ga0307468_1010907643 | 3300031740 | Hardwood Forest Soil | MDKPEAASEQARRPYEPPAIVSEQIFETTALACAKRQGQGLKCLFRP |
| Ga0307468_1017631951 | 3300031740 | Hardwood Forest Soil | MRERVMDKPEAAREQARRPYEPPAIVSEQIFETTALACSKRPAQGGKCNARPKSS |
| Ga0307468_1018348601 | 3300031740 | Hardwood Forest Soil | MGESERVESGKRPYEAPAIVSEQIFETTALACGKRPAQGG |
| Ga0307473_102069362 | 3300031820 | Hardwood Forest Soil | MDKSEAVGEQTRRPYELSAIVSEQIFETTALACAKRPAQGGKCNARPKAS |
| Ga0307473_109058503 | 3300031820 | Hardwood Forest Soil | MEKKRPYEPPAVTSEQIFETTALACGKKPAQGGKCTARPKAS |
| Ga0310904_103407561 | 3300031854 | Soil | HAARAGVVEEPMEKSERVAQPGKRPYEAPAIVSEQIFETTALACGKVPAQGGKCNARPKA |
| Ga0310900_101470532 | 3300031908 | Soil | MDKRPEPAEDKRRPYEPPRIVSEQIFETTALACAKRPAEGGKCNLRAKSS |
| Ga0310900_113371991 | 3300031908 | Soil | MDRSEATGEQARRPYEPPAIVSEQIFDTTALACAKRQGQGAKCNVRP |
| Ga0307412_119154282 | 3300031911 | Rhizosphere | EPVKTPETSAQQGKRPYEAPAIVSERLFETTALACGKRMGQGAKCNARPKAS |
| Ga0310884_101254161 | 3300031944 | Soil | MGESERVEPGKRPYEAPAIVSEQIFETTALACGKRPAQGGKCSARPK |
| Ga0214473_119289622 | 3300031949 | Soil | MKPSEPAAPGAKRPYEPPAIVSEQIFETTALACGKRMGQGGKCNARPKAS |
| Ga0310903_100619472 | 3300032000 | Soil | MDRSEATGEQARRPYEPPAIVSEQIFETTALACAKRQGQGSKCLFRSKSS |
| Ga0310902_108711841 | 3300032012 | Soil | ARSPYEPPAIVSEQIFETTALACAKRQGQGSKCLFRSKSS |
| Ga0310899_102709391 | 3300032017 | Soil | EATGEQARRPYEPPAIVSEQIFETTALACAKRQGQGAKCNVRPKSS |
| Ga0310895_102228791 | 3300032122 | Soil | DRSEATGEQARRPYEPPAIVSEQIFETTALACAKRQGQGAKCNVRPKSS |
| Ga0307471_1012179382 | 3300032180 | Hardwood Forest Soil | YEPPAIVSEQIFETTALACSKRPAQGGKCNARPKSS |
| Ga0307471_1032188011 | 3300032180 | Hardwood Forest Soil | MDKPEATDKQARRPYEPPAIVSEQIFETTALACSKRPAQGGKCNARPKSS |
| Ga0307472_1019822582 | 3300032205 | Hardwood Forest Soil | MDKPEAAREQARRPYEPPAIVSEQIFETTALACSKRPAQGGKCNARPKSS |
| Ga0307472_1020423302 | 3300032205 | Hardwood Forest Soil | MDKPKRPYEPPAIVSEQIFETTALACAKKPAQGGKCVARPKSS |
| Ga0335085_100997723 | 3300032770 | Soil | MDKKRPYEPPAVTSEQIFETTALACGKKPAQGGKCNARPKAS |
| Ga0335085_125969752 | 3300032770 | Soil | MDQPEAAGERRPYEPPAIVSEQIFETTALACSKRPAQGGKCNARPKSS |
| Ga0335080_101492462 | 3300032828 | Soil | MDKPEAAGERRPYEPPAIVSEQIFETTALACSKRPAQGGKCNARPKSS |
| Ga0335084_104562662 | 3300033004 | Soil | MDKPEAAGERRPYEAPAIVSEQIFETTALACSKRPAQGGKCNARPKSS |
| Ga0310810_100674053 | 3300033412 | Soil | MQEPQRAADSGKRPYEAPAISSEQIFETTALACGKRQAQGGKCNTRPKAS |
| Ga0247830_105364192 | 3300033551 | Soil | MGESERVEPGKRPYEAPAIVSEQIFETTALACGKRPAQGGKCNARPKAS |
| Ga0364934_0000673_815_967 | 3300034178 | Sediment | MKTSEPGAQPAKRPYEAPAIVSEQIFETTALACGKRIGQGGKCNTRPKAS |
| ⦗Top⦘ |