| Basic Information | |
|---|---|
| Family ID | F027289 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 195 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MWDLCTNALDTAKLRGAAYGDVRVMHLRQRDLTTKNGQVG |
| Number of Associated Samples | 165 |
| Number of Associated Scaffolds | 195 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 45.13 % |
| % of genes near scaffold ends (potentially truncated) | 98.46 % |
| % of genes from short scaffolds (< 2000 bps) | 89.74 % |
| Associated GOLD sequencing projects | 158 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (65.641 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.103 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.231 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.06% β-sheet: 0.00% Coil/Unstructured: 52.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 195 Family Scaffolds |
|---|---|---|
| PF00670 | AdoHcyase_NAD | 43.59 |
| PF05221 | AdoHcyase | 37.95 |
| PF02773 | S-AdoMet_synt_C | 2.56 |
| PF00795 | CN_hydrolase | 1.54 |
| PF00072 | Response_reg | 0.51 |
| PF13442 | Cytochrome_CBB3 | 0.51 |
| PF07642 | BBP2 | 0.51 |
| PF05036 | SPOR | 0.51 |
| PF01245 | Ribosomal_L19 | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 195 Family Scaffolds |
|---|---|---|---|
| COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 81.54 |
| COG0192 | S-adenosylmethionine synthetase | Coenzyme transport and metabolism [H] | 2.56 |
| COG0335 | Ribosomal protein L19 | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 65.64 % |
| All Organisms | root | All Organisms | 34.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_105718754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
| 3300001154|JGI12636J13339_1003235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2710 | Open in IMG/M |
| 3300004092|Ga0062389_104714509 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300004631|Ga0058899_12002135 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300004635|Ga0062388_102208156 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300005468|Ga0070707_100051767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3936 | Open in IMG/M |
| 3300005540|Ga0066697_10050599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2354 | Open in IMG/M |
| 3300005549|Ga0070704_100708549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 893 | Open in IMG/M |
| 3300005556|Ga0066707_10280121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1091 | Open in IMG/M |
| 3300005558|Ga0066698_10782115 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300005598|Ga0066706_11294847 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005712|Ga0070764_10122430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1409 | Open in IMG/M |
| 3300005843|Ga0068860_101795306 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300006050|Ga0075028_100717233 | Not Available | 603 | Open in IMG/M |
| 3300006052|Ga0075029_100048346 | All Organisms → cellular organisms → Bacteria | 2458 | Open in IMG/M |
| 3300006057|Ga0075026_100514712 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300006162|Ga0075030_101569718 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300006173|Ga0070716_100362999 | Not Available | 1029 | Open in IMG/M |
| 3300006176|Ga0070765_100363423 | Not Available | 1347 | Open in IMG/M |
| 3300006176|Ga0070765_101339903 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300006755|Ga0079222_10088183 | All Organisms → cellular organisms → Bacteria | 1589 | Open in IMG/M |
| 3300006797|Ga0066659_10866101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300006904|Ga0075424_100440437 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300006914|Ga0075436_100521055 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300007255|Ga0099791_10546300 | Not Available | 564 | Open in IMG/M |
| 3300007788|Ga0099795_10367753 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300009038|Ga0099829_10589488 | Not Available | 924 | Open in IMG/M |
| 3300009038|Ga0099829_11256232 | Not Available | 613 | Open in IMG/M |
| 3300009088|Ga0099830_10525834 | Not Available | 966 | Open in IMG/M |
| 3300009089|Ga0099828_11378453 | Not Available | 623 | Open in IMG/M |
| 3300009137|Ga0066709_101254903 | Not Available | 1089 | Open in IMG/M |
| 3300009148|Ga0105243_12550379 | Not Available | 551 | Open in IMG/M |
| 3300009764|Ga0116134_1212456 | Not Available | 671 | Open in IMG/M |
| 3300009792|Ga0126374_10660745 | Not Available | 780 | Open in IMG/M |
| 3300010047|Ga0126382_10618715 | Not Available | 894 | Open in IMG/M |
| 3300010048|Ga0126373_10106833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2598 | Open in IMG/M |
| 3300010048|Ga0126373_12247072 | Not Available | 606 | Open in IMG/M |
| 3300010048|Ga0126373_13137655 | Not Available | 515 | Open in IMG/M |
| 3300010098|Ga0127463_1031668 | Not Available | 678 | Open in IMG/M |
| 3300010108|Ga0127474_1123272 | Not Available | 1256 | Open in IMG/M |
| 3300010326|Ga0134065_10201628 | Not Available | 720 | Open in IMG/M |
| 3300010337|Ga0134062_10001220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8664 | Open in IMG/M |
| 3300010337|Ga0134062_10563471 | Not Available | 582 | Open in IMG/M |
| 3300010360|Ga0126372_10582759 | Not Available | 1069 | Open in IMG/M |
| 3300010362|Ga0126377_13105889 | Not Available | 536 | Open in IMG/M |
| 3300010376|Ga0126381_100229522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2501 | Open in IMG/M |
| 3300010376|Ga0126381_102917826 | Not Available | 681 | Open in IMG/M |
| 3300010398|Ga0126383_12834384 | Not Available | 566 | Open in IMG/M |
| 3300010398|Ga0126383_13269207 | Not Available | 529 | Open in IMG/M |
| 3300011120|Ga0150983_12137724 | Not Available | 992 | Open in IMG/M |
| 3300011120|Ga0150983_13230309 | Not Available | 510 | Open in IMG/M |
| 3300011271|Ga0137393_10238927 | Not Available | 1540 | Open in IMG/M |
| 3300011271|Ga0137393_11690849 | Not Available | 522 | Open in IMG/M |
| 3300012096|Ga0137389_10981284 | Not Available | 724 | Open in IMG/M |
| 3300012189|Ga0137388_11400580 | Not Available | 638 | Open in IMG/M |
| 3300012206|Ga0137380_11759478 | Not Available | 503 | Open in IMG/M |
| 3300012212|Ga0150985_109765551 | Not Available | 892 | Open in IMG/M |
| 3300012359|Ga0137385_10044964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3955 | Open in IMG/M |
| 3300012361|Ga0137360_10559457 | Not Available | 977 | Open in IMG/M |
| 3300012363|Ga0137390_10825990 | Not Available | 884 | Open in IMG/M |
| 3300012364|Ga0134027_1130481 | Not Available | 571 | Open in IMG/M |
| 3300012374|Ga0134039_1159416 | Not Available | 724 | Open in IMG/M |
| 3300012382|Ga0134038_1260137 | Not Available | 1000 | Open in IMG/M |
| 3300012395|Ga0134044_1191175 | Not Available | 1109 | Open in IMG/M |
| 3300012685|Ga0137397_10272336 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300012685|Ga0137397_10672147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
| 3300012923|Ga0137359_10577812 | Not Available | 987 | Open in IMG/M |
| 3300012923|Ga0137359_11095753 | Not Available | 681 | Open in IMG/M |
| 3300012924|Ga0137413_10870330 | Not Available | 697 | Open in IMG/M |
| 3300012924|Ga0137413_11094472 | Not Available | 630 | Open in IMG/M |
| 3300012927|Ga0137416_10927604 | Not Available | 775 | Open in IMG/M |
| 3300012927|Ga0137416_12138050 | Not Available | 514 | Open in IMG/M |
| 3300012929|Ga0137404_10846066 | Not Available | 832 | Open in IMG/M |
| 3300012930|Ga0137407_11358719 | Not Available | 675 | Open in IMG/M |
| 3300012930|Ga0137407_12261240 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300012960|Ga0164301_10537944 | Not Available | 850 | Open in IMG/M |
| 3300012964|Ga0153916_10883668 | Not Available | 974 | Open in IMG/M |
| 3300012971|Ga0126369_10983209 | Not Available | 931 | Open in IMG/M |
| 3300012982|Ga0168317_1028014 | Not Available | 1567 | Open in IMG/M |
| 3300014150|Ga0134081_10092763 | Not Available | 944 | Open in IMG/M |
| 3300014158|Ga0181521_10451413 | Not Available | 623 | Open in IMG/M |
| 3300014166|Ga0134079_10620550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300015054|Ga0137420_1470408 | All Organisms → cellular organisms → Bacteria | 3636 | Open in IMG/M |
| 3300016357|Ga0182032_11982398 | Not Available | 511 | Open in IMG/M |
| 3300016357|Ga0182032_12010527 | Not Available | 507 | Open in IMG/M |
| 3300017930|Ga0187825_10038442 | Not Available | 1616 | Open in IMG/M |
| 3300017943|Ga0187819_10490858 | Not Available | 701 | Open in IMG/M |
| 3300017947|Ga0187785_10689924 | Not Available | 535 | Open in IMG/M |
| 3300017961|Ga0187778_10329468 | Not Available | 992 | Open in IMG/M |
| 3300017975|Ga0187782_11130198 | Not Available | 612 | Open in IMG/M |
| 3300017995|Ga0187816_10463459 | Not Available | 568 | Open in IMG/M |
| 3300018012|Ga0187810_10193684 | Not Available | 825 | Open in IMG/M |
| 3300018015|Ga0187866_1146511 | Not Available | 922 | Open in IMG/M |
| 3300018060|Ga0187765_10183619 | Not Available | 1200 | Open in IMG/M |
| 3300020199|Ga0179592_10228791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 839 | Open in IMG/M |
| 3300020579|Ga0210407_10740147 | Not Available | 761 | Open in IMG/M |
| 3300020580|Ga0210403_10508841 | Not Available | 978 | Open in IMG/M |
| 3300020581|Ga0210399_11591143 | Not Available | 504 | Open in IMG/M |
| 3300020581|Ga0210399_11591279 | Not Available | 504 | Open in IMG/M |
| 3300021046|Ga0215015_10869959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1133 | Open in IMG/M |
| 3300021086|Ga0179596_10057418 | Not Available | 1641 | Open in IMG/M |
| 3300021151|Ga0179584_1222163 | Not Available | 548 | Open in IMG/M |
| 3300021168|Ga0210406_11048580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 603 | Open in IMG/M |
| 3300021170|Ga0210400_10399209 | Not Available | 1134 | Open in IMG/M |
| 3300021170|Ga0210400_11344327 | Not Available | 571 | Open in IMG/M |
| 3300021178|Ga0210408_10023376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4917 | Open in IMG/M |
| 3300021178|Ga0210408_11307316 | Not Available | 550 | Open in IMG/M |
| 3300021403|Ga0210397_11628958 | Not Available | 501 | Open in IMG/M |
| 3300021406|Ga0210386_10959289 | Not Available | 730 | Open in IMG/M |
| 3300021406|Ga0210386_11160160 | Not Available | 654 | Open in IMG/M |
| 3300021432|Ga0210384_11851056 | Not Available | 509 | Open in IMG/M |
| 3300021477|Ga0210398_10084385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2581 | Open in IMG/M |
| 3300021477|Ga0210398_11289123 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 574 | Open in IMG/M |
| 3300021478|Ga0210402_11531803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 594 | Open in IMG/M |
| 3300021560|Ga0126371_13903954 | Not Available | 502 | Open in IMG/M |
| 3300022531|Ga0242660_1101913 | Not Available | 703 | Open in IMG/M |
| 3300022722|Ga0242657_1001654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2778 | Open in IMG/M |
| 3300022726|Ga0242654_10209535 | Not Available | 681 | Open in IMG/M |
| 3300024186|Ga0247688_1047966 | Not Available | 683 | Open in IMG/M |
| 3300024330|Ga0137417_1062952 | Not Available | 1068 | Open in IMG/M |
| 3300024330|Ga0137417_1344644 | All Organisms → cellular organisms → Bacteria | 1608 | Open in IMG/M |
| 3300024330|Ga0137417_1393249 | All Organisms → cellular organisms → Bacteria | 1884 | Open in IMG/M |
| 3300025477|Ga0208192_1038697 | Not Available | 998 | Open in IMG/M |
| 3300025905|Ga0207685_10553466 | Not Available | 612 | Open in IMG/M |
| 3300025914|Ga0207671_10610298 | Not Available | 869 | Open in IMG/M |
| 3300025917|Ga0207660_11134366 | Not Available | 637 | Open in IMG/M |
| 3300026088|Ga0207641_11988803 | Not Available | 582 | Open in IMG/M |
| 3300026285|Ga0209438_1105004 | Not Available | 842 | Open in IMG/M |
| 3300026310|Ga0209239_1136725 | Not Available | 995 | Open in IMG/M |
| 3300026319|Ga0209647_1209247 | Not Available | 670 | Open in IMG/M |
| 3300026532|Ga0209160_1152199 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1057 | Open in IMG/M |
| 3300026542|Ga0209805_1061090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1854 | Open in IMG/M |
| 3300026547|Ga0209156_10230350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 871 | Open in IMG/M |
| 3300026555|Ga0179593_1094572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 2889 | Open in IMG/M |
| 3300026835|Ga0207782_105564 | Not Available | 1119 | Open in IMG/M |
| 3300027039|Ga0207855_1007829 | All Organisms → cellular organisms → Bacteria | 1555 | Open in IMG/M |
| 3300027061|Ga0209729_1045535 | Not Available | 556 | Open in IMG/M |
| 3300027376|Ga0209004_1014161 | Not Available | 1218 | Open in IMG/M |
| 3300027625|Ga0208044_1171538 | Not Available | 592 | Open in IMG/M |
| 3300027643|Ga0209076_1110492 | Not Available | 778 | Open in IMG/M |
| 3300027660|Ga0209736_1058191 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1088 | Open in IMG/M |
| 3300027678|Ga0209011_1000517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 14590 | Open in IMG/M |
| 3300027698|Ga0209446_1082669 | Not Available | 821 | Open in IMG/M |
| 3300027765|Ga0209073_10170368 | Not Available | 814 | Open in IMG/M |
| 3300027829|Ga0209773_10408140 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300027862|Ga0209701_10281627 | Not Available | 962 | Open in IMG/M |
| 3300027862|Ga0209701_10537986 | Not Available | 629 | Open in IMG/M |
| 3300027862|Ga0209701_10542907 | Not Available | 625 | Open in IMG/M |
| 3300027879|Ga0209169_10407197 | Not Available | 715 | Open in IMG/M |
| 3300027882|Ga0209590_10734126 | Not Available | 630 | Open in IMG/M |
| 3300027986|Ga0209168_10075139 | Not Available | 1768 | Open in IMG/M |
| 3300028023|Ga0265357_1017791 | Not Available | 764 | Open in IMG/M |
| 3300028381|Ga0268264_10505122 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1180 | Open in IMG/M |
| 3300028906|Ga0308309_10643812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 920 | Open in IMG/M |
| 3300030013|Ga0302178_10313035 | Not Available | 719 | Open in IMG/M |
| 3300030399|Ga0311353_10447931 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1153 | Open in IMG/M |
| 3300031057|Ga0170834_104419753 | Not Available | 647 | Open in IMG/M |
| 3300031682|Ga0318560_10694038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 550 | Open in IMG/M |
| 3300031715|Ga0307476_10408660 | Not Available | 1003 | Open in IMG/M |
| 3300031720|Ga0307469_12331742 | Not Available | 522 | Open in IMG/M |
| 3300031724|Ga0318500_10525823 | Not Available | 596 | Open in IMG/M |
| 3300031736|Ga0318501_10302035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 854 | Open in IMG/M |
| 3300031753|Ga0307477_10208606 | Not Available | 1358 | Open in IMG/M |
| 3300031754|Ga0307475_10071577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2651 | Open in IMG/M |
| 3300031754|Ga0307475_10240292 | Not Available | 1450 | Open in IMG/M |
| 3300031754|Ga0307475_11286089 | Not Available | 567 | Open in IMG/M |
| 3300031769|Ga0318526_10418875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 547 | Open in IMG/M |
| 3300031770|Ga0318521_10236537 | Not Available | 1063 | Open in IMG/M |
| 3300031771|Ga0318546_10178679 | Not Available | 1442 | Open in IMG/M |
| 3300031777|Ga0318543_10429677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 592 | Open in IMG/M |
| 3300031792|Ga0318529_10111119 | Not Available | 1243 | Open in IMG/M |
| 3300031796|Ga0318576_10094757 | Not Available | 1356 | Open in IMG/M |
| 3300031798|Ga0318523_10131492 | Not Available | 1239 | Open in IMG/M |
| 3300031820|Ga0307473_10310143 | Not Available | 997 | Open in IMG/M |
| 3300031823|Ga0307478_10143437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1890 | Open in IMG/M |
| 3300031880|Ga0318544_10012060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2759 | Open in IMG/M |
| 3300031890|Ga0306925_10029693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5557 | Open in IMG/M |
| 3300031890|Ga0306925_11231355 | Not Available | 748 | Open in IMG/M |
| 3300031941|Ga0310912_10227980 | Not Available | 1429 | Open in IMG/M |
| 3300031942|Ga0310916_11482244 | Not Available | 554 | Open in IMG/M |
| 3300031954|Ga0306926_10301433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1983 | Open in IMG/M |
| 3300031959|Ga0318530_10069659 | Not Available | 1359 | Open in IMG/M |
| 3300032051|Ga0318532_10076789 | Not Available | 1166 | Open in IMG/M |
| 3300032055|Ga0318575_10133416 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1226 | Open in IMG/M |
| 3300032066|Ga0318514_10160742 | Not Available | 1168 | Open in IMG/M |
| 3300032076|Ga0306924_11109946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 861 | Open in IMG/M |
| 3300032180|Ga0307471_100408925 | Not Available | 1486 | Open in IMG/M |
| 3300032180|Ga0307471_100839485 | Not Available | 1086 | Open in IMG/M |
| 3300032180|Ga0307471_102211455 | Not Available | 693 | Open in IMG/M |
| 3300032261|Ga0306920_100084970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4662 | Open in IMG/M |
| 3300032783|Ga0335079_10036444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5649 | Open in IMG/M |
| 3300032954|Ga0335083_10401633 | Not Available | 1171 | Open in IMG/M |
| 3300033134|Ga0335073_10132063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3186 | Open in IMG/M |
| 3300033289|Ga0310914_11637022 | Not Available | 547 | Open in IMG/M |
| 3300033289|Ga0310914_11723934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.49% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.64% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.62% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.59% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.56% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.05% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.05% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.05% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.05% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.05% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.05% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.54% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.03% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.03% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.03% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.03% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.51% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.51% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.51% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.51% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.51% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.51% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.51% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.51% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.51% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010098 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010108 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012374 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012382 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012982 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026835 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1057187542 | 3300000955 | Soil | MYDLANLALDTAQLRGASYCDARVMHLRQRDLTTKNGQ |
| JGI12636J13339_10032351 | 3300001154 | Forest Soil | MWDLSTHAIDTAQLRGASYADVRVMHIRQRDLTTK |
| Ga0062389_1047145091 | 3300004092 | Bog Forest Soil | MWDYCGHSLEVARLRGATYADVRVMHLRQRDLTTKSGRVGTLGQ |
| Ga0058899_120021352 | 3300004631 | Forest Soil | MWDYCGHSLDVARLRGATYADVRVMHLRQSDLTTKSGEVGTL |
| Ga0062388_1022081562 | 3300004635 | Bog Forest Soil | MWDYCGHSLDVARLRGATYADVRVMHLRQRDLTTKNGNVGTLGQ |
| Ga0070707_1000517674 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MWDLTTGAIETAKLRGATYADARLMHLRQRDLTTKNGAVGTLAQSES |
| Ga0066697_100505993 | 3300005540 | Soil | LANSMWDFCTNALDTAKLRGASYGDVRAMHLRQRDLTTKNGQVG |
| Ga0070704_1007085491 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MWDLTAVALEMAKLRGATYADARLMHLRQRDLTTKNGQVGTLAQSES |
| Ga0066707_102801211 | 3300005556 | Soil | MWDLAAHSLDIAKLRGASYADARVMHLRQRDLTTKNGAVG |
| Ga0066698_107821151 | 3300005558 | Soil | MWDFCTNALDTAKLRGASYGDVRAMHLRQRDLTAKNGQVGTLA |
| Ga0066706_112948471 | 3300005598 | Soil | MFDLASVALNTAKLRGVTYADARVMHLRQRDLTTKNGAVG |
| Ga0070764_101224301 | 3300005712 | Soil | MWDLATACLETAKLRGAKYADVRVMHLRQRDLTTKNGQVG |
| Ga0068860_1017953062 | 3300005843 | Switchgrass Rhizosphere | MWDLTAVALETAKLRGATYADARLMHLRQRDLTTKNGQV |
| Ga0075028_1007172331 | 3300006050 | Watersheds | MWDLCTNALDTARVRGAAYGDVRVMHLRQRDLTTKNGQVGTLSQSESIGL |
| Ga0075029_1000483463 | 3300006052 | Watersheds | MWDLCTNALDTARVRGAAYGDVRVMHLRQRDLTTKNGQVGTLSQSESIG |
| Ga0075026_1005147122 | 3300006057 | Watersheds | MWDYCGHSLDIARLRGATYADVRAMHIRQRDLTTKNGKVGTLGQ |
| Ga0075030_1015697182 | 3300006162 | Watersheds | MWDYCGHSLDVARLRGATYADVRVMHLRQRDLTTKSGEVG |
| Ga0070716_1003629992 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MWDLCICSLETARLRGASYADVRVMHQRQRDLTTK |
| Ga0070765_1003634233 | 3300006176 | Soil | MWDLCTNALDTARLRGAAYGDVRAMHIRQRDLTTK |
| Ga0070765_1013399031 | 3300006176 | Soil | MYDLAVAALETAKLRGATYADVRVMHMRQRDLTTKN |
| Ga0079222_100881832 | 3300006755 | Agricultural Soil | MWDLCTNALDTAKLRGASYGDVRAMHLRQRDLTTKNGQVGTLAQS |
| Ga0066659_108661011 | 3300006797 | Soil | MYDLANLALDTAKLRGASYGDVRAMHLRQRDLTTKN |
| Ga0075424_1004404371 | 3300006904 | Populus Rhizosphere | MWDLTTDALNTAKLRGATYADARLMHIRQRDLTTKNGAVG |
| Ga0075436_1005210552 | 3300006914 | Populus Rhizosphere | MWDLTADALEMAKLRGATYADARLMHLRQRDLTTKNGQ |
| Ga0099791_105463001 | 3300007255 | Vadose Zone Soil | MWDLCTHSLDTSKIRGATYADVRVMHLRQRDLTTKNGEV |
| Ga0099795_103677532 | 3300007788 | Vadose Zone Soil | MWDLTTSALETAKLRGATYSDARLMHLRQRDLTTKNGAVGTLAQS |
| Ga0099829_105894882 | 3300009038 | Vadose Zone Soil | MWDLCTNALDTARLRGALYGDVRVMHLRQRDLTTKNGQVGTPSQSESIGL |
| Ga0099829_112562322 | 3300009038 | Vadose Zone Soil | MYDLATTALDTAKIRGASYADVRVMHLRQRDLTTKNG |
| Ga0099830_105258342 | 3300009088 | Vadose Zone Soil | MWGLCTNALDTAKVRGAAYGDVRMMHLGQRDLTTKN |
| Ga0099828_113784531 | 3300009089 | Vadose Zone Soil | MWDLCTNSLDTARLRGAAYGDVRVMHLRQRDLTTKNGQVG |
| Ga0066709_1012549031 | 3300009137 | Grasslands Soil | MWDLAAHSLDIAKLRGASYADARVMHLRQRDLTTKNGTVGT |
| Ga0105243_125503791 | 3300009148 | Miscanthus Rhizosphere | MWDLASVALETARVRGSSYADARLMLFLNHNATTKNGQV |
| Ga0116134_12124562 | 3300009764 | Peatland | MMWEHCGHSLDVARLRGATDADVRVMYQRQRDLTTKNG |
| Ga0126374_106607452 | 3300009792 | Tropical Forest Soil | MWDLAAHSLDIAKLRGATYADARVMHLKQRDLTTKNGQV |
| Ga0126382_106187151 | 3300010047 | Tropical Forest Soil | MWDLCTNALDTAKLHGASYGDVRAMHLRQRDLTAKNGQVGTLAQSESIPTGVPV |
| Ga0126373_101068333 | 3300010048 | Tropical Forest Soil | MWDLCTNALDTAKLRGASYGDVRAMHLRQRDLTTKNGQVGTLAHS |
| Ga0126373_122470721 | 3300010048 | Tropical Forest Soil | MWDLCTNALDTAKTRGATYGDARVMHLRQRDLTTKNGQVGT |
| Ga0126373_131376551 | 3300010048 | Tropical Forest Soil | MWDYCANSLDVAHLRGAAYGDVRVMHVRQRNLTTKNRRVGTLGQTESVGLGIR |
| Ga0127463_10316682 | 3300010098 | Grasslands Soil | MWDLCTNALDTARLRGAAYGDVRVMHLRQRDLTTKNGQVGTLSQSESIGL |
| Ga0127474_11232721 | 3300010108 | Grasslands Soil | MWDLCTNALDTAKLRGASYGDVRAMHLRQRDLTTKNGQVGT |
| Ga0134065_102016281 | 3300010326 | Grasslands Soil | MWDLSTNALDTAKLRGATYGDVRVMHLRQRDLTTKNGQVGT |
| Ga0134062_100012201 | 3300010337 | Grasslands Soil | MWDLCTNALDTARLRGAAYRDVRVMHLRQRDLTTKNGQV |
| Ga0134062_105634712 | 3300010337 | Grasslands Soil | MWDLSTNALDTAKLRGATYGDVRVMHLRQRDLTTKNGQV |
| Ga0126372_105827591 | 3300010360 | Tropical Forest Soil | MWDLTAVVLETAKLRGAKYTDARIMHLRQRDLTTKNGQVGTLAE |
| Ga0126377_131058892 | 3300010362 | Tropical Forest Soil | MWDLTAVALETAKVRGSSYADARLMHLRQRDLTTKN |
| Ga0126381_1002295221 | 3300010376 | Tropical Forest Soil | MMLMWDLCTNALDTAKLRGASYGDVRMMHLRQRDLTTKNGQVGTL |
| Ga0126381_1029178262 | 3300010376 | Tropical Forest Soil | MWDLAKRSLDTAKRRGATYADVRVMHLRQRDLTTK |
| Ga0126383_128343842 | 3300010398 | Tropical Forest Soil | MWDLTAVVLETAKLRGAKYTDARVMHLRQRDLTTKNGQVGTL |
| Ga0126383_132692072 | 3300010398 | Tropical Forest Soil | MWDFCGHALDTARLRGAAYADVRVMHLRQRDLTTKGGEV |
| Ga0150983_121377241 | 3300011120 | Forest Soil | MWDLCTNALDTARLRGAAYGDVRVMHLRQRDLTTKNGRVGTLS |
| Ga0150983_132303092 | 3300011120 | Forest Soil | MWDLSTNALDTARLRGATYADVRMMHLRQRDLTTKN |
| Ga0137393_102389271 | 3300011271 | Vadose Zone Soil | MWDLCTNALDTARLRGAAYGDVRVMHLRQRDLTTKNGQVGTLSQS |
| Ga0137393_116908492 | 3300011271 | Vadose Zone Soil | MWDLCTNALDTAKLRGAVYGDVRVMHLRQRDLTTKNGQVGTLSQS |
| Ga0137389_109812841 | 3300012096 | Vadose Zone Soil | MIMCDLSTHAIDTAQLRGASYADVRVMHIRQRDLTTKNGQ |
| Ga0137388_114005802 | 3300012189 | Vadose Zone Soil | MWDLCTNALDTARLRGAAYGDVRVMHLRQRDLTTKNGQV |
| Ga0137380_117594781 | 3300012206 | Vadose Zone Soil | MWDLCTNALDTAKLRGASYGDVRVMHLRQRDLTTKNGQ |
| Ga0150985_1097655511 | 3300012212 | Avena Fatua Rhizosphere | MWDLSTHALETAKLRGSSYADVRVMYLRQRDLTTKNGQV |
| Ga0137385_100449644 | 3300012359 | Vadose Zone Soil | MWDLCINALDTARLRGAAYGDVRVMHLRQRDLTTKNGQVGTLSQSE |
| Ga0137360_105594571 | 3300012361 | Vadose Zone Soil | MWDLCTNALDTAKLRGASYGDVRVMHLRQRDLTTKNGQV |
| Ga0137390_108259901 | 3300012363 | Vadose Zone Soil | MWDLCTNALDTARLRGAAYGDVRVMHSRQRDLTTKNGQVGTLSQSES |
| Ga0134027_11304812 | 3300012364 | Grasslands Soil | MWDLCTNALDTARLRGAAYRDVRVMHLRQRDLTTK |
| Ga0134039_11594162 | 3300012374 | Grasslands Soil | MMLMWDLCTNALDTAKLRGASYGDVRAMHLRQRDLTTKNGQ |
| Ga0134038_12601372 | 3300012382 | Grasslands Soil | MMLMWDLCTNALDTAKLRGASYGDVRAMHLRQRDLTTKNG |
| Ga0134044_11911751 | 3300012395 | Grasslands Soil | MWDLCTNALDTARLRGAAYGDVRVMHLRQRDLTTKNG |
| Ga0137397_102723363 | 3300012685 | Vadose Zone Soil | MWDLSTNALDTAQLRGASYCDARVMHLRQRDLTTKNGQV |
| Ga0137397_106721471 | 3300012685 | Vadose Zone Soil | MYDLANLALDTAQLRGASYCDARVMHLRQRDLTTKNG |
| Ga0137359_105778122 | 3300012923 | Vadose Zone Soil | MWDLCTHSLDTSKIRGATYADVRVMHLRQRDLTTKNGDVGTLA |
| Ga0137359_110957531 | 3300012923 | Vadose Zone Soil | MWDLCTHSLDTSKIRGATYADVRVMHLRQRDLTTKN |
| Ga0137413_108703303 | 3300012924 | Vadose Zone Soil | MWDLTSTALDTAKLRGATYADARSMHIRQRDLTTKN |
| Ga0137413_110944722 | 3300012924 | Vadose Zone Soil | MYDLATAALDTTKIRGAFYADVRVMHLRQRDLTTKNGEVG |
| Ga0137416_109276042 | 3300012927 | Vadose Zone Soil | MYDLARASLDTAKIRGATYADVRVMHLRQRDLTTKNGE |
| Ga0137416_121380502 | 3300012927 | Vadose Zone Soil | MWDLAAHSLDIAKLRGASYADARVMHLRQRDLTTK |
| Ga0137404_108460662 | 3300012929 | Vadose Zone Soil | MWDFCTDSLDTARLGGAKYADVRVMHLRQRDLTTKNGHVG |
| Ga0137407_113587191 | 3300012930 | Vadose Zone Soil | MWDYCGHSLDIARLRGATYADVRVMHLRQRDLTTKS |
| Ga0137407_122612401 | 3300012930 | Vadose Zone Soil | MWDLSTNSLDTAKLRGAAYGDVRVMYLRQGDLTTKNGQVGTLSQSESIGLGIRV |
| Ga0164301_105379441 | 3300012960 | Soil | MYDLASLALETTKLQGATYADVRVMHLRQRDLTTKNG |
| Ga0153916_108836681 | 3300012964 | Freshwater Wetlands | MWDLATHALDTARLRGATYADVRTMHLRQRDLTTKNGQ |
| Ga0126369_109832091 | 3300012971 | Tropical Forest Soil | MWDYCANSLDVARLRGAAYGDVRAMHIRQRNLTTKNCKVGTLGQTESVGLGI |
| Ga0168317_10280142 | 3300012982 | Weathered Mine Tailings | MWDLASHALDTARLRGASYADVRVMHLRQRDLTTKNGQV |
| Ga0134081_100927631 | 3300014150 | Grasslands Soil | MWDLCTNSLDTAGLRGASYGDARLMHLRQRDLTTK |
| Ga0181521_104514132 | 3300014158 | Bog | MWEHCGHSLDVARLRGATYADVRVMDMRQRDLTTK |
| Ga0134079_106205502 | 3300014166 | Grasslands Soil | MYDLANLALDTAKLRGASYGDVRAMHLRQRDLTTKNGQVGTLA |
| Ga0137420_14704085 | 3300015054 | Vadose Zone Soil | MWDWHTLSDIAKLRGATYADVRVMHMRQRDLTTKNGAVGTLAQTDPSAWAFAF* |
| Ga0182032_119823982 | 3300016357 | Soil | MWDYCANSLDVAHLRGATYGDVRVMHVRQRNLTTKNRRVGTLGQTE |
| Ga0182032_120105271 | 3300016357 | Soil | MWDYCGHSLETARLRGATYADVRVMHLRQRDLTTKNGQV |
| Ga0187825_100384421 | 3300017930 | Freshwater Sediment | MWDLTATALDTAKLRGATYADARLMHLRQRDLTTKNGQVGTLAQSE |
| Ga0187819_104908582 | 3300017943 | Freshwater Sediment | MWEYCENSLEVARLRGATYADVRVMHLRRRDLTTKSGHIGTLGQSESL |
| Ga0187785_106899242 | 3300017947 | Tropical Peatland | MWDDCGHALNTARLRGATYSDVRVMHQRQRVLTTKNGR |
| Ga0187778_103294681 | 3300017961 | Tropical Peatland | MWDYCGHSLDVARLRGATYADVRVMHQRQRDLTTKSGKVGTL |
| Ga0187782_111301981 | 3300017975 | Tropical Peatland | MWDYCGHSLDVARLRGATYADVRVMHQRQRDLTTKNGCVGTLG |
| Ga0187816_104634591 | 3300017995 | Freshwater Sediment | MWEHCGNSLDVARLRGATYADMRVMHQRQRDLTTKNGQVGTLGQS |
| Ga0187810_101936842 | 3300018012 | Freshwater Sediment | MMWDLCNNALDTARLRGASYGDVRVMHLRQRDLTTKNGQVGTLA |
| Ga0187866_11465112 | 3300018015 | Peatland | MWEHCGHSLGVARLRGATYADVRVMHMRQRDLTTKN |
| Ga0187765_101836191 | 3300018060 | Tropical Peatland | MWDYCGHALNIAKLRGATYSDVRVMHQRQRVLTTKNGRVGSL |
| Ga0179592_102287912 | 3300020199 | Vadose Zone Soil | MPAVRAKFMWDLCTHSLAISKVRGASYADVRVMHLRQRDLTTKNG |
| Ga0210407_107401471 | 3300020579 | Soil | MWDYCGHSLDIARLRGATYADVRAMHLRQRDLTTKSGEVGTLGQS |
| Ga0210403_105088412 | 3300020580 | Soil | MWDLCTNALDTARLRGAAYGDVPVMHLLQRDLTTK |
| Ga0210399_115911432 | 3300020581 | Soil | MWDLTANALDTAKLRGATYADARLMHIRQRDLTTKNSG |
| Ga0210399_115912792 | 3300020581 | Soil | MWDLCTNALDTARLRGAAYGDVRVMHLRQRDLTTKNGQVG |
| Ga0215015_108699592 | 3300021046 | Soil | MYDLANLSIDTAQLRGASCADVRVMHLRQRDLTTKNGQVGTLAQSESNPA |
| Ga0179596_100574182 | 3300021086 | Vadose Zone Soil | MWDLCTNALDTARLRGASYGDVRVMHLRQRDLTTKNGQVGTLSQSES |
| Ga0179584_12221631 | 3300021151 | Vadose Zone Soil | MWDLCTNALDTAKLRGASYGDVRVMHMRQRDLTTKNG |
| Ga0210406_110485801 | 3300021168 | Soil | MWDLCTNALDTAKLRGATYGDVRGMHIRQRDLTTKNGQVGTLAQTE |
| Ga0210400_103992091 | 3300021170 | Soil | MWDFCTNALDTARLRGATYADVRMMHLRQRDLTTKNGQVGTL |
| Ga0210400_113443271 | 3300021170 | Soil | MWDLCNNALDTARLRGAAYGDVRVMHLRQRDLTTKNGQVG |
| Ga0210408_100233761 | 3300021178 | Soil | MYDLATAGLDTAKIRGASYTDVRVMHLRQRDLTTKNGHVGT |
| Ga0210408_113073162 | 3300021178 | Soil | MWDLCTNALDTAKLRGAAYGDVRVMHLRQRDLTTK |
| Ga0210397_116289582 | 3300021403 | Soil | MWDYCGHSLDVARLRGATYADVRVMHLRQRDLTTKSGEVGTL |
| Ga0210386_109592891 | 3300021406 | Soil | MWDLSAHALDTARLRGAKYADMRVMHLRQRDLTTKNGQVGT |
| Ga0210386_111601601 | 3300021406 | Soil | MYDLATAALDTAKIRGASYADVRVMHLRQRDLTTKN |
| Ga0210384_118510561 | 3300021432 | Soil | MWDYCGHSLDVARLRGATYADVRVMHLRQRDLTTKS |
| Ga0210398_100843853 | 3300021477 | Soil | MWDYCGHSLEVARLRGATYADVRMMHHRQRDLTTKSGRVGTLGQSDSIG |
| Ga0210398_112891232 | 3300021477 | Soil | MWDLATHCLEAAELRRATYADVRLMHMRQRDLTTKNGHIGTLAQ |
| Ga0210402_115318031 | 3300021478 | Soil | MWDYCAHSLDIARLRGATYADVRVMHLRQRDLTTKS |
| Ga0126371_139039541 | 3300021560 | Tropical Forest Soil | MWDLTAVALETAKLRGAAYSDARLIHLRKRELTTKNGQVGTLAQSES |
| Ga0242660_11019132 | 3300022531 | Soil | MWDLCTNALDTAKLRGAAYGDVRVMHLRQRDLTTKNGQVGTLS |
| Ga0242657_10016543 | 3300022722 | Soil | MWDLSTNALDTARLRGATYADVRMMHWRQRDLTTKNGQ |
| Ga0242654_102095352 | 3300022726 | Soil | MWDLCTNALDTAKLRGAAYGDVRVMHLRQRDLTTKNGQVG |
| Ga0247688_10479662 | 3300024186 | Soil | MWDLTAAALEMAKLRGATYADARLMHLRQRDLTSKNGQVGTL |
| Ga0137417_10629522 | 3300024330 | Vadose Zone Soil | MWDLCTNALDTAKLRGATYADVRVMHLRQRDLTTK |
| Ga0137417_13446443 | 3300024330 | Vadose Zone Soil | MWDLCTNSLDTARLRGAAYGDVRVMHLRQRDLTTKNGQVGT |
| Ga0137417_13932493 | 3300024330 | Vadose Zone Soil | MWDLCTNALDTARLRGASYGDVRVMHLRQRDLTTKNGQVGTLSQSESIA |
| Ga0208192_10386971 | 3300025477 | Peatland | MWEHCGHSLGVARLRGATYADVRVMHMRQRDLTTKNGQVGTLG |
| Ga0207685_105534661 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MWDLTAVALETAKLRGATYADARLMHLRQRDLTTKNGR |
| Ga0207671_106102981 | 3300025914 | Corn Rhizosphere | MWDLTAVALETAKVRGSRYADARLMHLRQRDLTTKNGQV |
| Ga0207660_111343662 | 3300025917 | Corn Rhizosphere | MYDLANLSLETAKLQGATYADVRVMHLRQRDLTTK |
| Ga0207641_119888031 | 3300026088 | Switchgrass Rhizosphere | MWDLTAVALETAKLRGATYADARLMHLRQRDLTTKNGQVGTL |
| Ga0209438_11050042 | 3300026285 | Grasslands Soil | MWDYCGHSLDIARLRGATYADVRVMHLRQRDLTTK |
| Ga0209239_11367252 | 3300026310 | Grasslands Soil | MWDFCTNALDTAKLRGASYGDVRAMHLRQRDLTTKNGH |
| Ga0209647_12092472 | 3300026319 | Grasslands Soil | MWDLCTNALDTARLRGAAYGDVRVMHLRQRDLTTKNGQVGTLSQSESI |
| Ga0209160_11521992 | 3300026532 | Soil | MLMWDLCTNALDTAKLRGASYGDVRAMHLRQRDLT |
| Ga0209805_10610901 | 3300026542 | Soil | MWDLCTNALDTAKLRGATYGDVRVMHLRQRDLTTKNGQVGTLAQSES |
| Ga0209156_102303501 | 3300026547 | Soil | MYDLANLALDTAKLRGASYGDVRAMHLRQRDLTTKNGQVGTLAQSE |
| Ga0179593_10945721 | 3300026555 | Vadose Zone Soil | MWDLCTNALDTAQLRGAAYADVRVMHLRQRDLTTKNGQ |
| Ga0207782_1055641 | 3300026835 | Tropical Forest Soil | MWDYCANSLDVARLRGATYGDVRAMHIRQRNLTTKNRQ |
| Ga0207855_10078293 | 3300027039 | Tropical Forest Soil | MWDFCGHSLETARLRGATYADVRVMHQRQRVLTTKNGRV |
| Ga0209729_10455351 | 3300027061 | Forest Soil | MMLMWDLCTNALDTAKLRGASYGDVRAMHLRQRDLTTKNGQVGTLAQSE |
| Ga0209004_10141611 | 3300027376 | Forest Soil | MWDYCSHSLDIARLRGATYADVRVMHLRQRDLTSKSGEV |
| Ga0208044_11715381 | 3300027625 | Peatlands Soil | MWEYCGHSLDVARLRGATYADVRAMHMRQRDLTTKN |
| Ga0209076_11104921 | 3300027643 | Vadose Zone Soil | MWDLCTNALDTAQLRGASYCDARVMHLGQRDLTTKNGQV |
| Ga0209736_10581911 | 3300027660 | Forest Soil | MYDLAIAALDTARIRGASYADVRVMHLRQRDLTTKNG |
| Ga0209011_100051713 | 3300027678 | Forest Soil | MWDLCTNALDTAKLRGAAYGDVRVMHLRQRDLTTKNGQVGTLSQSES |
| Ga0209446_10826691 | 3300027698 | Bog Forest Soil | MWEYCGHSLEIARLRGATYADVRLMHSRQRDLTTKSGCVGTL |
| Ga0209073_101703682 | 3300027765 | Agricultural Soil | MWDLCTNALDTAKLRGASYGDARVMHLRQRDLTTKNGQVGTLAQSES |
| Ga0209773_104081401 | 3300027829 | Bog Forest Soil | MWDYCGHSLEVARLRGATYADVRVMHQRQRDLTTKSGKVGTLGQS |
| Ga0209701_102816272 | 3300027862 | Vadose Zone Soil | MWDLCTNALDTAKLRGAAYGDVRVMHLRQRDLTTKNGQV |
| Ga0209701_105379861 | 3300027862 | Vadose Zone Soil | MWDLCTNALDTAKLRGASYGDVRVMHLRQRDLTTKNGQVGTL |
| Ga0209701_105429071 | 3300027862 | Vadose Zone Soil | MWDLCTNALDTARLRGAAYGDVRVMHLRQRDLTTKNGQ |
| Ga0209169_104071971 | 3300027879 | Soil | MWDLSVQALDTARLRGAKYADVRVMHLRQRDLTTKN |
| Ga0209590_107341262 | 3300027882 | Vadose Zone Soil | MWDLCTNALDTAKLRGAAYGDVRMMHLRQRDLTTKNGQVGTLSQSES |
| Ga0209168_100751392 | 3300027986 | Surface Soil | MWDLATACLETARLRGAKYADVRVMHLRQRDLTTKNGQVGTLA |
| Ga0265357_10177911 | 3300028023 | Rhizosphere | MWDLCTNALDTTRLRGATYADVRMMHLRQRDLTTKN |
| Ga0268264_105051221 | 3300028381 | Switchgrass Rhizosphere | MWDLTAVALETAKLRGATYADARLMHLRQRDLTTKNGQVGT |
| Ga0308309_106438121 | 3300028906 | Soil | MWDYCGHSLDIARLRGATYADVRAMHIRQRDLTTKNGKVGTL |
| Ga0302178_103130351 | 3300030013 | Palsa | MWDLSTQALDTARIRGATYADVRMMHLRQRDLTTKNGQV |
| Ga0311353_104479311 | 3300030399 | Palsa | MWDLATHSLDVAKLRGASYADVRVMHLRQRDLTTKNG |
| Ga0170834_1044197531 | 3300031057 | Forest Soil | MWDLTANALDTAKLRGASYADARLMHIRQRDLTTKN |
| Ga0318560_106940381 | 3300031682 | Soil | MWDYCANSLDVARLRGANYADVRLMHMRQRNLTTKNRQVGTLGQTESIG |
| Ga0307476_104086602 | 3300031715 | Hardwood Forest Soil | MWDLATHCLEVARLRGATYADVRLMHMRQRDLTTKNGQIG |
| Ga0307469_123317422 | 3300031720 | Hardwood Forest Soil | MWDLSIDALDTARLRGATYADVRVMHLRQRDLTTKNGQIGTLA |
| Ga0318500_105258231 | 3300031724 | Soil | MWDYCEHSLETARLRGARYADVRVMHHRQRDLTSK |
| Ga0318501_103020351 | 3300031736 | Soil | MWDYCANSLDVAHLRGATYGDVRVMHVRQRNLTTKN |
| Ga0307477_102086061 | 3300031753 | Hardwood Forest Soil | MWDLCTNALDTAELRGAAYGDVRVMHLRQRDLTTKNGQVGTL |
| Ga0307475_100715773 | 3300031754 | Hardwood Forest Soil | MYDLATTALDTAKIRGASYADVRVMHLRQRDLTTKNGQV |
| Ga0307475_102402922 | 3300031754 | Hardwood Forest Soil | MYDLATAALDTAKIRGASYSDVRVMHLRQRDLTTKNGQVGTL |
| Ga0307475_112860892 | 3300031754 | Hardwood Forest Soil | MWDLTTGALDIAKLRGATYADARFMHIRQRDLTKKNGQVGTLAQSE |
| Ga0318526_104188751 | 3300031769 | Soil | MWDYCANSLDVAHLRGATYGDVRVMHVRQRNLTTKNRRVGTLG |
| Ga0318521_102365372 | 3300031770 | Soil | MWDYCANSLDVARLRGANYADVRLMHMRQRNLTTKNRQVGTLGQTE |
| Ga0318546_101786791 | 3300031771 | Soil | MWDYCANSLDVARLRGATYGDVRAMHIRQRNLTTKNR |
| Ga0318543_104296772 | 3300031777 | Soil | MWDYCANALDVARLRGATYADVRAMHIRQRNLTTKNREVGTL |
| Ga0318529_101111192 | 3300031792 | Soil | MWDYCANSLDVAHLRGATYGDVRVMHVRQRNLTTKNRRVGALGQTESV |
| Ga0318576_100947572 | 3300031796 | Soil | MMLMWDLCTNALDTAKLRGASYGDVRAIHLRQRDLTTKNGQVGTLAHSESVG |
| Ga0318523_101314921 | 3300031798 | Soil | MWDYCAHSLDVAHLRGAAYGDVRVMHVRQRNLTTKNRRVGTLGQTESVG |
| Ga0307473_103101431 | 3300031820 | Hardwood Forest Soil | MWDLCTNALDTARLRGAAYGDVRVMHLRQRDLTTKNGQVGTLSQSES |
| Ga0307478_101434373 | 3300031823 | Hardwood Forest Soil | MWDLTTTALDTAKLRGATYADVRSMHIRQRDLTTK |
| Ga0318544_100120603 | 3300031880 | Soil | MMLMWDLCTNALDTAKLRGASYGDVRAIHLRQRDLTTKNGQVGTLAHSESV |
| Ga0306925_100296938 | 3300031890 | Soil | MMLMWDLCTNALDTAKLRGASYGDVRAIHLRQRDLTTKNGQVGTLALSESVG |
| Ga0306925_112313551 | 3300031890 | Soil | MWDFCGYALDTARLRGATYADVRVMHLRQRDLTTKGGEVG |
| Ga0310912_102279802 | 3300031941 | Soil | MWDYCANSLDVARLRGATYGDVRAMHIRQRNLTTK |
| Ga0310916_114822441 | 3300031942 | Soil | MWDYCANSLDVARLRGATYGDVRAMHIRQRNLTTKNRQVGTLGQSESVGLGI |
| Ga0306926_103014331 | 3300031954 | Soil | MWDFCSHSLGAAKLRGASYADVRVMHQRQRVLTTKNRRVGTLG |
| Ga0318530_100696591 | 3300031959 | Soil | MMLMWDLCTSALDTAKLRGASYGDVRAIHLRQRDLTTKNGQVGT |
| Ga0318532_100767892 | 3300032051 | Soil | MWDYCANSLDVAHLRGATYGDVRVMHVRQRNLTTKNRRVGALGQTE |
| Ga0318575_101334162 | 3300032055 | Soil | MMLMWDLCTSALDTAKLRGASYGDVRAIHLRQRDLTTKNGQVGTLAHSES |
| Ga0318514_101607422 | 3300032066 | Soil | MMLMWDLCTSALDTAKLRGASYGDVRAIHLRQRDLTTKNG |
| Ga0306924_111099462 | 3300032076 | Soil | MWDYCANSLDVAHLRGATYGDVRVMHVRQRNLTTKNRRVGTL |
| Ga0307471_1004089252 | 3300032180 | Hardwood Forest Soil | MWDLCTNALDTAKLRGAPYGDVRVMHLRQRDLTTKNGQVGT |
| Ga0307471_1008394853 | 3300032180 | Hardwood Forest Soil | MWDLATAALDTARLRGATYADTRLMHLRQRDLTTKNGAVGTLAQSE |
| Ga0307471_1022114551 | 3300032180 | Hardwood Forest Soil | MWDYCGHSLDIARLRGATYADVRVMHLRHRDLTTKS |
| Ga0306920_1000849705 | 3300032261 | Soil | MWDYCANALDVARLRGATYADVRAMHIRQRNLTTKNREVGTLGQ |
| Ga0335079_100364441 | 3300032783 | Soil | MWELASHSLDIAKLRGASYTDARVMHLRQRDLTTKNGQVGTLAQSESI |
| Ga0335083_104016332 | 3300032954 | Soil | MWDFTGHALDTARLRGATYADVRVIHARQRDLTTKN |
| Ga0335073_101320634 | 3300033134 | Soil | MWDLSIEALDTARLRGATYADVRVMHLRQRDLTTKNG |
| Ga0310914_116370222 | 3300033289 | Soil | MWDYCANSLDVARLRGATYGDVRAMHIRQRNLTTKNRQVGTLGQS |
| Ga0310914_117239342 | 3300033289 | Soil | LWGTMWDFCSHSLGAAKLRGASYADVRVMHQRQRVLTTKNRRVGTLGQSESL |
| ⦗Top⦘ |