Metagenome / Metatranscriptome Family F027274

Basic Information
Family ID	F027274
Family Type	Metagenome / Metatranscriptome
Number of Sequences	195
Average Sequence Length	40 residues
Representative Sequence	ERPQSVFALQKAIRDIPPKKRKLTFFGNLKRKLFTEIGA
Number of Associated Samples	177
Number of Associated Scaffolds	195

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.51 %
% of genes near scaffold ends (potentially truncated)	99.49 %
% of genes from short scaffolds (< 2000 bps)	95.38 %
Associated GOLD sequencing projects	166
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.33

Most Common Taxonomy
Group	Bacteria (100.000 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.718 % of family members)
Environment Ontology (ENVO)	Unclassified (30.256 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (31.282 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 44.78% β-sheet: 0.00% Coil/Unstructured: 55.22%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 195 Family Scaffolds
PF13672	PP2C_2	93.33
PF00929	RNase_T	4.62
PF13458	Peripla_BP_6	0.51
PF13089	PP_kinase_N	0.51
PF03480	DctP	0.51
PF00069	Pkinase	0.51

COG ID	Name	Functional Category	% Frequency in 195 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	2.05

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	100.00 %
Unclassified	root	N/A	0.00 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	100.00 %
Unclassified	root	N/A	0.00 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	100.00 %
Unclassified	root	N/A	0.00 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	99.49 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.51 %
Unclassified	root	N/A	0.00 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	97.44 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.51 %
Unclassified	root	N/A	0.00 %

Name	Rank	Taxonomy	Distribution
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	2.05 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.03 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.51 %
Unclassified	root	N/A	0.00 %

Name	Rank	Taxonomy	Distribution
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.03 %
Gallionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae	0.51 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.51 %
Unclassified	root	N/A	0.00 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000559\|F14TC_100701262	All Organisms → cellular organisms → Bacteria → Acidobacteria	503	Open in IMG/M
3300000579\|AP72_2010_repI_A01DRAFT_1009565	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1587	Open in IMG/M
3300000891\|JGI10214J12806_10329465	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	656	Open in IMG/M
3300000955\|JGI1027J12803_105514314	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	805	Open in IMG/M
3300002075\|JGI24738J21930_10117685	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	576	Open in IMG/M
3300003152\|Ga0052254_1122253	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	514	Open in IMG/M
3300003203\|JGI25406J46586_10238725	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	533	Open in IMG/M
3300004062\|Ga0055500_10081072	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	697	Open in IMG/M
3300004155\|Ga0066600_10220490	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	828	Open in IMG/M
3300004157\|Ga0062590_102323142	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	564	Open in IMG/M
3300004780\|Ga0062378_10167958	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	591	Open in IMG/M
3300004782\|Ga0062382_10008783	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3001	Open in IMG/M
3300005330\|Ga0070690_100751364	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	753	Open in IMG/M
3300005333\|Ga0070677_10489454	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	665	Open in IMG/M
3300005336\|Ga0070680_100498321	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1042	Open in IMG/M
3300005339\|Ga0070660_100330201	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1254	Open in IMG/M
3300005339\|Ga0070660_100866715	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	761	Open in IMG/M
3300005340\|Ga0070689_100184335	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1697	Open in IMG/M
3300005367\|Ga0070667_100878737	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	834	Open in IMG/M
3300005435\|Ga0070714_100292962	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1515	Open in IMG/M
3300005536\|Ga0070697_101659086	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	572	Open in IMG/M
3300005538\|Ga0070731_10046062	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2912	Open in IMG/M
3300005544\|Ga0070686_100226690	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1353	Open in IMG/M
3300005548\|Ga0070665_101572078	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	666	Open in IMG/M
3300005553\|Ga0066695_10814921	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	537	Open in IMG/M
3300005556\|Ga0066707_10936758	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	530	Open in IMG/M
3300005563\|Ga0068855_102069349	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	574	Open in IMG/M
3300005564\|Ga0070664_100033365	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	4312	Open in IMG/M
3300005566\|Ga0066693_10208490	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	762	Open in IMG/M
3300005578\|Ga0068854_101951898	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	540	Open in IMG/M
3300005615\|Ga0070702_101025294	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	655	Open in IMG/M
3300005616\|Ga0068852_100076345	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2958	Open in IMG/M
3300005764\|Ga0066903_104597351	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	735	Open in IMG/M
3300005764\|Ga0066903_105563953	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	664	Open in IMG/M
3300005764\|Ga0066903_108710363	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	516	Open in IMG/M
3300005836\|Ga0074470_11062067	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	791	Open in IMG/M
3300005840\|Ga0068870_10345033	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	954	Open in IMG/M
3300005841\|Ga0068863_101015134	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	833	Open in IMG/M
3300005841\|Ga0068863_101827023	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	617	Open in IMG/M
3300006046\|Ga0066652_100259399	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1526	Open in IMG/M
3300006047\|Ga0075024_100210787	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	915	Open in IMG/M
3300006047\|Ga0075024_100879113	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	508	Open in IMG/M
3300006050\|Ga0075028_100826877	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	566	Open in IMG/M
3300006174\|Ga0075014_100993950	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	508	Open in IMG/M
3300006755\|Ga0079222_11292592	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	664	Open in IMG/M
3300006804\|Ga0079221_10270638	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	978	Open in IMG/M
3300006854\|Ga0075425_100245761	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2059	Open in IMG/M
3300006954\|Ga0079219_11200509	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	656	Open in IMG/M
3300007076\|Ga0075435_100752819	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	847	Open in IMG/M
3300009053\|Ga0105095_10237489	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	999	Open in IMG/M
3300009081\|Ga0105098_10377452	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	699	Open in IMG/M
3300009087\|Ga0105107_10124410	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1816	Open in IMG/M
3300009131\|Ga0115027_11474621	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	557	Open in IMG/M
3300009147\|Ga0114129_12929411	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	563	Open in IMG/M
3300009162\|Ga0075423_11726227	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	674	Open in IMG/M
3300009167\|Ga0113563_12216193	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	660	Open in IMG/M
3300009553\|Ga0105249_11214372	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	825	Open in IMG/M
3300010041\|Ga0126312_11300947	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	538	Open in IMG/M
3300010335\|Ga0134063_10404197	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	670	Open in IMG/M
3300010361\|Ga0126378_11293933	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	824	Open in IMG/M
3300010361\|Ga0126378_12667593	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	571	Open in IMG/M
3300010366\|Ga0126379_10543475	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1240	Open in IMG/M
3300010391\|Ga0136847_13016894	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	619	Open in IMG/M
3300010397\|Ga0134124_10524944	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1149	Open in IMG/M
3300010403\|Ga0134123_10362953	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1313	Open in IMG/M
3300011106\|Ga0151489_1624592	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	579	Open in IMG/M
3300011422\|Ga0137425_1177973	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	532	Open in IMG/M
3300012045\|Ga0136623_10024940	All Organisms → cellular organisms → Bacteria → Proteobacteria	2566	Open in IMG/M
3300012198\|Ga0137364_10254987	All Organisms → cellular organisms → Bacteria → Proteobacteria	1297	Open in IMG/M
3300012208\|Ga0137376_10551853	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	998	Open in IMG/M
3300012211\|Ga0137377_11950049	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	504	Open in IMG/M
3300012349\|Ga0137387_11305967	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	507	Open in IMG/M
3300012509\|Ga0157334_1010494	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	866	Open in IMG/M
3300012509\|Ga0157334_1084404	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	501	Open in IMG/M
3300012519\|Ga0157352_1048430	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	626	Open in IMG/M
3300012582\|Ga0137358_10675739	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	691	Open in IMG/M
3300012895\|Ga0157309_10289911	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	549	Open in IMG/M
3300012955\|Ga0164298_10712213	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	706	Open in IMG/M
3300012955\|Ga0164298_11524910	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	523	Open in IMG/M
3300012960\|Ga0164301_10956291	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	669	Open in IMG/M
3300012971\|Ga0126369_13671376	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	503	Open in IMG/M
3300012975\|Ga0134110_10621300	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	504	Open in IMG/M
3300012984\|Ga0164309_11384917	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	599	Open in IMG/M
3300012988\|Ga0164306_10418967	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1011	Open in IMG/M
3300013102\|Ga0157371_10001512	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	24037	Open in IMG/M
3300013104\|Ga0157370_10192742	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1892	Open in IMG/M
3300013297\|Ga0157378_10403739	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1347	Open in IMG/M
3300013308\|Ga0157375_11314583	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	850	Open in IMG/M
3300014166\|Ga0134079_10686256	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	520	Open in IMG/M
3300014326\|Ga0157380_11097757	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	834	Open in IMG/M
3300014829\|Ga0120104_1109813	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	557	Open in IMG/M
3300014968\|Ga0157379_11030843	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	785	Open in IMG/M
3300014968\|Ga0157379_11152041	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	744	Open in IMG/M
3300014969\|Ga0157376_10222543	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1749	Open in IMG/M
3300015168\|Ga0167631_1066283	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	593	Open in IMG/M
3300015200\|Ga0173480_10141423	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1219	Open in IMG/M
3300015356\|Ga0134073_10315802	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	563	Open in IMG/M
3300015373\|Ga0132257_101469762	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	869	Open in IMG/M
3300015373\|Ga0132257_101579844	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	839	Open in IMG/M
3300015373\|Ga0132257_101653037	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	820	Open in IMG/M
3300016445\|Ga0182038_11410343	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	624	Open in IMG/M
3300017974\|Ga0187777_10554981	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	806	Open in IMG/M
3300018058\|Ga0187766_11109050	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	568	Open in IMG/M
3300018060\|Ga0187765_11018646	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	569	Open in IMG/M
3300018429\|Ga0190272_11751937	All Organisms → cellular organisms → Bacteria → Proteobacteria	646	Open in IMG/M
3300018468\|Ga0066662_10963697	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	842	Open in IMG/M
3300018476\|Ga0190274_13971353	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	501	Open in IMG/M
3300018481\|Ga0190271_10330337	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1598	Open in IMG/M
3300019888\|Ga0193751_1265670	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	516	Open in IMG/M
3300021081\|Ga0210379_10308824	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	692	Open in IMG/M
3300021082\|Ga0210380_10241496	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	819	Open in IMG/M
3300021337\|Ga0210341_1632363	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	621	Open in IMG/M
3300021560\|Ga0126371_10680379	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1177	Open in IMG/M
3300021560\|Ga0126371_11553715	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	789	Open in IMG/M
3300025290\|Ga0207673_1026700	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	792	Open in IMG/M
3300025878\|Ga0209584_10148786	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	881	Open in IMG/M
3300025893\|Ga0207682_10327248	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	720	Open in IMG/M
3300025917\|Ga0207660_11323589	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	585	Open in IMG/M
3300025920\|Ga0207649_11180407	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	605	Open in IMG/M
3300025921\|Ga0207652_10774125	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	853	Open in IMG/M
3300025923\|Ga0207681_10906399	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	738	Open in IMG/M
3300025933\|Ga0207706_10935645	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	731	Open in IMG/M
3300025941\|Ga0207711_11566534	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	602	Open in IMG/M
3300025945\|Ga0207679_11209328	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	694	Open in IMG/M
3300025965\|Ga0210090_1058164	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	525	Open in IMG/M
3300026041\|Ga0207639_10805805	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	875	Open in IMG/M
3300026059\|Ga0208540_1019653	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	750	Open in IMG/M
3300026310\|Ga0209239_1362157	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	508	Open in IMG/M
3300026323\|Ga0209472_1181775	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	747	Open in IMG/M
3300026538\|Ga0209056_10261522	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae	1223	Open in IMG/M
3300026542\|Ga0209805_1291534	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	621	Open in IMG/M
3300027543\|Ga0209999_1097398	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	572	Open in IMG/M
3300027713\|Ga0209286_1145470	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	871	Open in IMG/M
3300027725\|Ga0209178_1103292	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	954	Open in IMG/M
3300027735\|Ga0209261_10182022	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	562	Open in IMG/M
3300027762\|Ga0209288_10051313	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1238	Open in IMG/M
3300027768\|Ga0209772_10046276	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1290	Open in IMG/M
3300027775\|Ga0209177_10126715	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	841	Open in IMG/M
3300027841\|Ga0209262_10326471	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	747	Open in IMG/M
3300027869\|Ga0209579_10031079	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2912	Open in IMG/M
3300027877\|Ga0209293_10351070	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	757	Open in IMG/M
3300027885\|Ga0209450_10174506	All Organisms → cellular organisms → Bacteria → Proteobacteria	1503	Open in IMG/M
3300027956\|Ga0209820_1112281	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	744	Open in IMG/M
3300028379\|Ga0268266_10470189	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1197	Open in IMG/M
3300028380\|Ga0268265_12345100	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	540	Open in IMG/M
3300028665\|Ga0302160_10161641	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	526	Open in IMG/M
3300028733\|Ga0302261_1101621	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	680	Open in IMG/M
3300028743\|Ga0302262_10206091	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	670	Open in IMG/M
3300028828\|Ga0307312_10555040	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	759	Open in IMG/M
3300029980\|Ga0302298_10216401	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	628	Open in IMG/M
3300030000\|Ga0311337_12023452	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	506	Open in IMG/M
3300030047\|Ga0302286_10089414	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1589	Open in IMG/M
3300030114\|Ga0311333_10143735	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1817	Open in IMG/M
3300030336\|Ga0247826_10664327	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	805	Open in IMG/M
3300031057\|Ga0170834_109574870	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1022	Open in IMG/M
3300031200\|Ga0307496_10112393	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	544	Open in IMG/M
3300031543\|Ga0318516_10239876	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1048	Open in IMG/M
3300031543\|Ga0318516_10565601	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	650	Open in IMG/M
3300031716\|Ga0310813_10721855	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	891	Open in IMG/M
3300031720\|Ga0307469_11576876	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	630	Open in IMG/M
3300031731\|Ga0307405_11937065	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	526	Open in IMG/M
3300031736\|Ga0318501_10404357	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	738	Open in IMG/M
3300031740\|Ga0307468_101773531	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	583	Open in IMG/M
3300031748\|Ga0318492_10822347	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	500	Open in IMG/M
3300031799\|Ga0318565_10331853	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	738	Open in IMG/M
3300031938\|Ga0308175_100625218	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1162	Open in IMG/M
3300031944\|Ga0310884_10949623	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	532	Open in IMG/M
3300032003\|Ga0310897_10211806	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	850	Open in IMG/M
3300032003\|Ga0310897_10269012	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	769	Open in IMG/M
3300032018\|Ga0315272_10515529	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	598	Open in IMG/M
3300032018\|Ga0315272_10726206	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	507	Open in IMG/M
3300032053\|Ga0315284_11054259	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	910	Open in IMG/M
3300032122\|Ga0310895_10254250	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	813	Open in IMG/M
3300032143\|Ga0315292_11066894	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	669	Open in IMG/M
3300032144\|Ga0315910_10050299	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3036	Open in IMG/M
3300032163\|Ga0315281_10795826	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	976	Open in IMG/M
3300032179\|Ga0310889_10034502	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1884	Open in IMG/M
3300032256\|Ga0315271_11744937	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	534	Open in IMG/M
3300032342\|Ga0315286_10317647	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1647	Open in IMG/M
3300032342\|Ga0315286_10639110	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1093	Open in IMG/M
3300033004\|Ga0335084_11254705	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	739	Open in IMG/M
3300033413\|Ga0316603_10223676	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1618	Open in IMG/M
3300033413\|Ga0316603_10873557	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	847	Open in IMG/M
3300033413\|Ga0316603_11265146	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	699	Open in IMG/M
3300033418\|Ga0316625_102518171	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	520	Open in IMG/M
3300033419\|Ga0316601_102048269	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	577	Open in IMG/M
3300033482\|Ga0316627_102739290	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	523	Open in IMG/M
3300033486\|Ga0316624_12043016	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	532	Open in IMG/M
3300033521\|Ga0316616_100264991	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1785	Open in IMG/M
3300033551\|Ga0247830_10347526	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1146	Open in IMG/M
3300033557\|Ga0316617_102545549	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	531	Open in IMG/M
3300033808\|Ga0314867_162891	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	524	Open in IMG/M
3300033810\|Ga0314872_016051	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	621	Open in IMG/M
3300034127\|Ga0370489_0211692	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	577	Open in IMG/M
3300034176\|Ga0364931_0130384	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	805	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	78.46%
Host-Associated	Host-Associated	21.54%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	58.97%
Plants	Host-Associated → Plants	21.54%
Aquatic	Environmental → Aquatic	19.49%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	54.87%
Freshwater	Environmental → Aquatic → Freshwater	14.87%
Rhizosphere	Host-Associated → Plants → Rhizosphere	13.85%
Rhizoplane	Host-Associated → Plants → Rhizoplane	7.69%
Peat	Environmental → Terrestrial → Peat	3.59%
Sediment	Environmental → Aquatic → Sediment	3.08%
Marine	Environmental → Aquatic → Marine	1.54%
Floodplain	Environmental → Terrestrial → Floodplain	0.51%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	39.49%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	8.72%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	7.69%
Loam	Environmental → Terrestrial → Soil → Loam	6.67%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	6.15%
Soil	Host-Associated → Plants → Rhizosphere → Soil	6.15%
Sediment	Environmental → Aquatic → Freshwater → Sediment	5.13%
Lake	Environmental → Aquatic → Freshwater → Lake	4.62%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	3.59%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.08%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	2.56%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.54%
Lentic	Environmental → Aquatic → Freshwater → Lentic	1.03%
Pond	Environmental → Aquatic → Freshwater → Pond	1.03%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.03%
Ice	Environmental → Aquatic → Freshwater → Ice	0.51%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.51%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.51%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	20.51%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	8.72%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	7.69%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	6.15%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	6.15%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	5.13%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	5.13%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	5.64%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	4.62%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.62%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	4.10%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	3.59%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.08%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.08%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	2.05%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.54%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.54%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	1.03%
Sediment	Environmental → Aquatic → Freshwater → Pond → Sediment	1.03%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.03%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	1.03%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.51%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.51%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	0.51%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.51%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.51%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	8.72%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	5.13%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.62%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	4.10%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	4.10%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	3.59%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	3.08%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.08%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	3.08%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	2.56%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.56%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.56%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	2.05%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	2.05%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.05%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.05%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	1.54%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.54%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.54%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.54%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.54%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.54%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.54%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.54%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.54%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	1.03%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	1.03%
Freshwater	Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater	1.03%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.03%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.03%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.03%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.03%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.03%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.03%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	1.03%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.03%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.03%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.03%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.03%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.51%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment	0.51%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment	0.51%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.51%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.51%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	0.51%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	0.51%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.51%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.51%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.51%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.51%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.51%
Unplanted Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil	0.51%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.51%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	0.51%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.51%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.51%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.51%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.51%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.51%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.51%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.51%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.51%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.51%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.51%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.51%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.51%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental	Open in IMG/M
3300000579	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01	Environmental	Open in IMG/M
3300000891	Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Host-Associated	Open in IMG/M
3300003152	Freshwater sediment microbial communities from Loktak Lake, India	Environmental	Open in IMG/M
3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated	Open in IMG/M
3300004062	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2	Environmental	Open in IMG/M
3300004155	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004780	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh	Environmental	Open in IMG/M
3300004782	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh	Environmental	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Host-Associated	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005538	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1	Environmental	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005553	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005566	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142	Environmental	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005836	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB	Environmental	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental	Open in IMG/M
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental	Open in IMG/M
3300006174	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009053	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009081	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009087	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009131	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009167	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)	Environmental	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental	Open in IMG/M
3300010335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010391	Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011106	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011422	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2	Environmental	Open in IMG/M
3300012045	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012509	Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6	Environmental	Open in IMG/M
3300012519	Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012895	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012975	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014829	Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M	Environmental	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015168	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake)	Environmental	Open in IMG/M
3300015200	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)	Environmental	Open in IMG/M
3300015356	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300017974	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG	Environmental	Open in IMG/M
3300018058	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG	Environmental	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300019888	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2	Environmental	Open in IMG/M
3300021081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo	Environmental	Open in IMG/M
3300021082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo	Environmental	Open in IMG/M
3300021337	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.425 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300025290	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5	Host-Associated	Open in IMG/M
3300025878	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)	Environmental	Open in IMG/M
3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025965	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 (SPAdes)	Environmental	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026059	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 (SPAdes)	Environmental	Open in IMG/M
3300026310	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)	Environmental	Open in IMG/M
3300026323	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)	Environmental	Open in IMG/M
3300026538	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)	Environmental	Open in IMG/M
3300026542	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)	Environmental	Open in IMG/M
3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes)	Host-Associated	Open in IMG/M
3300027713	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300027725	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)	Environmental	Open in IMG/M
3300027735	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh (SPAdes)	Environmental	Open in IMG/M
3300027762	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027768	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)	Environmental	Open in IMG/M
3300027775	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)	Environmental	Open in IMG/M
3300027841	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes)	Environmental	Open in IMG/M
3300027869	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027877	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)	Environmental	Open in IMG/M
3300027885	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)	Environmental	Open in IMG/M
3300027956	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028665	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3	Environmental	Open in IMG/M
3300028733	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_4	Environmental	Open in IMG/M
3300028743	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4	Environmental	Open in IMG/M
3300028828	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202	Environmental	Open in IMG/M
3300029980	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3	Environmental	Open in IMG/M
3300030000	I_Fen_N3 coassembly	Environmental	Open in IMG/M
3300030047	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3	Environmental	Open in IMG/M
3300030114	I_Fen_E2 coassembly	Environmental	Open in IMG/M
3300030336	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1	Environmental	Open in IMG/M
3300031057	Oak Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031200	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_S	Environmental	Open in IMG/M
3300031543	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300031736	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031748	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22	Environmental	Open in IMG/M
3300031799	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21	Environmental	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300031944	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1	Environmental	Open in IMG/M
3300032003	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1	Environmental	Open in IMG/M
3300032018	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle	Environmental	Open in IMG/M
3300032053	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16	Environmental	Open in IMG/M
3300032122	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4	Environmental	Open in IMG/M
3300032143	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0	Environmental	Open in IMG/M
3300032144	Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil	Environmental	Open in IMG/M
3300032163	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0	Environmental	Open in IMG/M
3300032179	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2	Environmental	Open in IMG/M
3300032256	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top	Environmental	Open in IMG/M
3300032342	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300033413	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT	Environmental	Open in IMG/M
3300033418	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A	Environmental	Open in IMG/M
3300033419	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT	Environmental	Open in IMG/M
3300033482	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C	Environmental	Open in IMG/M
3300033486	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A	Environmental	Open in IMG/M
3300033521	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B	Environmental	Open in IMG/M
3300033551	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5	Environmental	Open in IMG/M
3300033557	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B	Environmental	Open in IMG/M
3300033808	Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20	Environmental	Open in IMG/M
3300033810	Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_E	Environmental	Open in IMG/M
3300034127	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_16	Environmental	Open in IMG/M
3300034176	Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
F14TC_1007012622	3300000559	Soil	PQSVFALQKAIRDIPPKRRKLTFIDSIKKRLFTEVM*
AP72_2010_repI_A01DRAFT_10095651	3300000579	Forest Soil	LDPLERPQSVFALQKAIREIPPRKRKLTFFNNLKRKLFSEVV*
JGI10214J12806_103294651	3300000891	Soil	ERPQSVFALQRAIRDIAPNKRKLTFLGNLKRLLFSEIGA*
JGI1027J12803_1055143141	3300000955	Soil	CLRLDPLERPQSVFALQKAIRDIPPRKRKLTFLDTLKKKLFSEVV*
JGI24738J21930_101176852	3300002075	Corn Rhizosphere	ERPQSVFALQRAIRDIAPNKRKVTXLGSLKRLLFSEIGA*
Ga0052254_11222531	3300003152	Sediment	CLRLDPLERPQSVFALQKAIRDIAPKKRKVGFLGNLKKKLFTEIA*
JGI25406J46586_102387252	3300003203	Tabebuia Heterophylla Rhizosphere	PLERPQSVFALQKAIRDIPPKKRKVTFLGNLKRRLFSEISA*
Ga0055500_100810722	3300004062	Natural And Restored Wetlands	PLERPQSVFALQKAIRDIPPKKPKLTVFGNLKRRLFTEIGA*
Ga0066600_102204901	3300004155	Freshwater	ERPQSVFALQKAIRDIPPKKRKLTFFGNLKRKLFTEIGA*
Ga0062590_1023231422	3300004157	Soil	DPLERPQSVFALQKAIREIAPRKRKLTFLDNLKKRLFTEVM*
Ga0062378_101679582	3300004780	Wetland Sediment	CLRLDPLERPQSVFALQKAIRDIPQTKRKLSFMGNLKKMLFSQIGA*
Ga0062382_100087834	3300004782	Wetland Sediment	ERPQSVFALQKAIRDIPPRKRKLTFIDAVKRRLFSEIGA*
Ga0070690_1007513641	3300005330	Switchgrass Rhizosphere	LDPLERPQSVFALQKAIRDIPLKKRKLSFFGNLKRKLFTEIGA*
Ga0070677_104894542	3300005333	Miscanthus Rhizosphere	ERPQSVFALQKAIRDIPQTKRKVTFFGSIKKMLFSEIGA*
Ga0070680_1004983211	3300005336	Corn Rhizosphere	PLERPQSVFALQKAIRDIPQTKRKVTFLGSLKKMLFSEIGA*
Ga0070660_1003302013	3300005339	Corn Rhizosphere	LDPLERPQSVFALQRAIRDIAPIKRKLTFFGNLKRLLFSEIGV*
Ga0070660_1008667151	3300005339	Corn Rhizosphere	PLERPQSVFALQRAIRDIAPNKRKLTFLGNLKRLLFSEIGA*
Ga0070689_1001843353	3300005340	Switchgrass Rhizosphere	DPLERPQSVFALQRAIRDIPPKKRKLTLLASLRRKLGSESSA*
Ga0070667_1008787372	3300005367	Switchgrass Rhizosphere	RLDPLERPQSVFSLQKAIKDIPPKKRKVSFLGNLKKKLFTEIGA*
Ga0070714_1002929621	3300005435	Agricultural Soil	PLERPQSVFALQKAIREIPPRKRKRTFIDSLKKKLFTEVM*
Ga0070697_1016590862	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	LDPLERPQSVFALQKAIRDIPPRKRKLTFLDTLKKKLFSEVM*
Ga0070731_100460624	3300005538	Surface Soil	LERPQSVFALQKAIRDIAPRKRKLTFFDNLKKRLFTEVL*
Ga0070686_1002266901	3300005544	Switchgrass Rhizosphere	LERPQSVFALQKAIRDIPQTKRKISFFGSLKKMLFSEIGA*
Ga0070665_1015720782	3300005548	Switchgrass Rhizosphere	DPLERPQSVFALQKAIRDIPPKKRKITVLGSLKRKLFTEIGA*
Ga0066695_108149212	3300005553	Soil	SVFALQKAIRDIPPRKRKLTFFNTLKKKLFSEVA*
Ga0066707_109367581	3300005556	Soil	SVFALQKAIRDIPPKRRKLTFLGNLKKRLFTEVM*
Ga0068855_1020693492	3300005563	Corn Rhizosphere	LDPLERPQSVFALQRAIRDIAPNKRKLTFLGNLKRLLFSEIGA*
Ga0070664_1000333655	3300005564	Corn Rhizosphere	ERPQSVFALQRAIRDIPPKKRKLTLMGNLKRMLFSEIGA*
Ga0066693_102084901	3300005566	Soil	DPLERPQSVFALQRAIRDIPPRKRKLTLLGSIKRRLFSEISA*
Ga0068854_1019518982	3300005578	Corn Rhizosphere	PQSIFALQKAIRDIAPKKRKLTFLGALKNRLFSDIGA*
Ga0070702_1010252942	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	ERPQSVFALQKAIRDIPPKKRKLTVLGNLKRKLFTEIGA*
Ga0068852_1000763455	3300005616	Corn Rhizosphere	LDPLERPQSVFALQRAIRDIAPNKRKVTFLGSLKRLLFSEIGA*
Ga0066903_1045973512	3300005764	Tropical Forest Soil	RLDPLERPQSVFALQKAIRDIPPKKRKLTFLGSLKRKLFSEIGA*
Ga0066903_1055639532	3300005764	Tropical Forest Soil	VFALQKAIKDIPPKKRKESFLGNLKKKLFTEIGA*
Ga0066903_1087103632	3300005764	Tropical Forest Soil	LERPQSVFALQKAIRDIPPKKRKLTFLGKFKKRLFTEVM*
Ga0074470_110620671	3300005836	Sediment (Intertidal)	ERPQSVFALQNAIRDIPPRKRKLTFLGSLKRKLFSEIGA*
Ga0068870_103450332	3300005840	Miscanthus Rhizosphere	SVFALQKAIRDITQTKRKVSFFGSLRKMLFSEIGA*
Ga0068863_1010151342	3300005841	Switchgrass Rhizosphere	PQSVFALQKAIRDIPPKKRKLTVFGNLKRKLFTEIGA*
Ga0068863_1018270232	3300005841	Switchgrass Rhizosphere	VFALQKAIRDIPPKKRKLSLIGNIKRVLFSEIGA*
Ga0066652_1002593993	3300006046	Soil	RLDPLERPQSVFALQKAIRDIPPKKRKVGFLGNLKKKLFTEIA*
Ga0075024_1002107872	3300006047	Watersheds	PQSVFALQKAIREIPPKKRKLTFFGSLKRKLFSEIGA*
Ga0075024_1008791131	3300006047	Watersheds	RPQSVFALQKAIRDIPPKKRKLTVLGNLKRKLFTEIGA*
Ga0075028_1008268772	3300006050	Watersheds	RPQSVFALQKAIREIPPKKRKLTFFGSLKRRLFTEIGA*
Ga0075014_1009939502	3300006174	Watersheds	QSVFALQKAIREIPPKKRKLTFFGNLKRKLFTEIGA*
Ga0079222_112925922	3300006755	Agricultural Soil	PLERPQSVFALQKAIRDIPPRKRKLTFFNTLKKKLFSEVV*
Ga0079221_102706381	3300006804	Agricultural Soil	PQSVFALQRAIRDIAPVKRKLTFLGNLKRLLFSEIGA*
Ga0075425_1002457613	3300006854	Populus Rhizosphere	LDPLERPQSVFALQRAIRDIPPRKRKLTLLGSIKRRLFSEISA*
Ga0079219_112005092	3300006954	Agricultural Soil	PRSVFALQRAIRDIAPVTRKLTFFGNLKRVLFSEIGV*
Ga0075435_1007528191	3300007076	Populus Rhizosphere	LDPLERPQSVFALQRAIRDIAPIKRKLTFFANLKRLLFSEIGV*
Ga0105095_102374891	3300009053	Freshwater Sediment	VFALQKAIRDIPPKKRKLTFIAAVKRKLFSEIGA*
Ga0105098_103774522	3300009081	Freshwater Sediment	RPQSVFALQKAIRDIPAKKRKLTFMGNLKRVLFSEIGA*
Ga0105107_101244103	3300009087	Freshwater Sediment	QSVFALQKAIRDIPPKKRKLTFIAAVKRKLFSEIGA*
Ga0115027_114746212	3300009131	Wetland	QSVFALQKAIRDIAPRKRKLTFMGNLKRVLFTEIGA*
Ga0114129_129294111	3300009147	Populus Rhizosphere	RPQSVFALQRAIRDIAPIKRKLTFFGNLKRFLFSEIGA*
Ga0075423_117262271	3300009162	Populus Rhizosphere	SVFALQKAIREIPPKKRKLTFFGSLKRKLFSEIGA*
Ga0113563_122161931	3300009167	Freshwater Wetlands	PLERPQSVFALQKAIRDIAPRKRKLTFMGNLKRVLFTEIGA*
Ga0105249_112143722	3300009553	Switchgrass Rhizosphere	LDPLERPQSVFALQRAIRDIPPKKRKLTLLASLRRKLGSESSA*
Ga0126312_113009471	3300010041	Serpentine Soil	LERPQSVFALQKAIRDIPPKKRKVTFLGNLKRRLFSETAA*
Ga0134063_104041972	3300010335	Grasslands Soil	CLRLDPLERPQSVFALQKAIRDIPPRKRKLTFLNTLKKKLFSEVV*
Ga0126378_112939331	3300010361	Tropical Forest Soil	PLERPQSVFALQKTIRDIPPRKRKLTFLDSLKKKLFSEVM*
Ga0126378_126675932	3300010361	Tropical Forest Soil	RLDPLERPQSVFALQKAIRDIPPRKRKLTFLDSLKKKLFSEVM*
Ga0126379_105434753	3300010366	Tropical Forest Soil	PLERPQSVFALQKAIRDIPPRKRKLTFLDSLKKKLFSEVM*
Ga0136847_130168941	3300010391	Freshwater Sediment	LRLDPLERPQSVFALQKAIRDIPPKKRKLTVLGNLKRKLFTEIGA*
Ga0134124_105249441	3300010397	Terrestrial Soil	DPLERPQSVFALQRAIRDIAPNKRKLTFLGNLKRLLFSEIGA*
Ga0134123_103629532	3300010403	Terrestrial Soil	PLERAQSVFALQKAIREIPQTRKKLTFLGSIKKMLFSEVGA*
Ga0151489_16245921	3300011106	Soil	LDPLERPQSVFALQKAIRDIPQTKRKLTFMGNLKKMLFSQIGA*
Ga0137425_11779731	3300011422	Soil	LDPLERPQSVFALQKAIRDIPPKKRKLTLLGSLKRRLFSEMSA*
Ga0136623_100249404	3300012045	Polar Desert Sand	LRLDPLERPQSIFALQKAIRDIPPVKRKLSFFGSLKKLLFSEIGA*
Ga0137364_102549871	3300012198	Vadose Zone Soil	QSVFALQKAIRDIAPRKRKLTFLDTIKKRLFSETT*
Ga0137376_105518531	3300012208	Vadose Zone Soil	RPQSVFALQKAIRDIAPRKRKLTFLDTIKKRLFSETT*
Ga0137377_119500491	3300012211	Vadose Zone Soil	PLERPQSVFALQKAIRDIPPRKRKLSFLDTLKKKLFSEVV*
Ga0137387_113059672	3300012349	Vadose Zone Soil	PLERPQSVFALQKAIRDIPPRKRKLTFLNTLKKKLFSEVV*
Ga0157334_10104941	3300012509	Soil	DPLERPQSVFALQRAIRDIAPVRRKLTFLGNLKRLLFSEIGA*
Ga0157334_10844042	3300012509	Soil	QSVFALQRAIRDIAPNKRKLTFLGNLKRLLFSEIGA*
Ga0157352_10484301	3300012519	Unplanted Soil	QSVFALQKAIREIPPKKRKVTFFGSLKRRLFSEIGA*
Ga0137358_106757392	3300012582	Vadose Zone Soil	DPLERPQSVFALQKAIRDIPPKKRKLTFIDSIKKRLFTEVM*
Ga0157309_102899112	3300012895	Soil	RPQSVFALQKAIREIPQVKRKLTLLGSLKKMLFSEVGA*
Ga0164298_107122131	3300012955	Soil	QSVFALQRAIRDIAPNKRKLTFFGNLKRLLFSEIGA*
Ga0164298_115249101	3300012955	Soil	LDPLERPQSVFALQKAIRDIPPRKRKLTFLDTLKKKLFSEVV*
Ga0164301_109562911	3300012960	Soil	LRLDQLERPQSVFALQKSIRDITPKKRKVGFLGNLKKKLFTEIA*
Ga0126369_136713761	3300012971	Tropical Forest Soil	SVFALQKAIRDIPQTKRKVTFLGSLKKMLFSEIGA*
Ga0134110_106213002	3300012975	Grasslands Soil	LERPQSVFALQKAIRDIPPRKRKLTFLNTLKKKLFSEVV*
Ga0164309_113849171	3300012984	Soil	QSVFALQKAIREIAPRKRKLTFLDNLKKRLFTEVM*
Ga0164306_104189671	3300012988	Soil	SVFALQRAIRDIAPNKRKVTFLGSLKRLLFSEIGA*
Ga0157371_1000151222	3300013102	Corn Rhizosphere	DPLERPQSVFALQRAIRDIAPNKRKVTFLGSLKRLLFSEIGA*
Ga0157370_101927423	3300013104	Corn Rhizosphere	PQSVFALQRAIRDIAPIKRKLTFFGNLKRLLFSEIGV*
Ga0157378_104037393	3300013297	Miscanthus Rhizosphere	RPQSVFALQRAIRDIAPNKRKLSFLGNLKRLLFSEIGA*
Ga0157375_113145831	3300013308	Miscanthus Rhizosphere	LRLDPLERPQSVFALQKAIRDIPQTKRKVSFFGSLRKMLFSEIGA*
Ga0134079_106862562	3300014166	Grasslands Soil	QSVFALQKAIRDIPPTKRKLTLFGSLKRKLMSEIGA*
Ga0157380_110977572	3300014326	Switchgrass Rhizosphere	LERPQSVFALQKAIRDIPQTKRKVSFFGSLKKMLFSEIGA*
Ga0120104_11098131	3300014829	Permafrost	LDPLERPQSVFALQKAIRDIAPRKRKLTFLDTIKKRLFSETT*
Ga0157379_110308432	3300014968	Switchgrass Rhizosphere	QSVFALQKAIRDIPLKKRKLSFFGNLKRKLFTEIGA*
Ga0157379_111520412	3300014968	Switchgrass Rhizosphere	RLDPLERPQSVFALQKAIRDIPPKKRKLTVFGNLKRKLFTEIGA*
Ga0157376_102225433	3300014969	Miscanthus Rhizosphere	PQSVFALQKAIRDIPQTKRKVTFLGSLKKMLFSEIGA*
Ga0167631_10662832	3300015168	Glacier Forefield Soil	CLRLDPLERPQSVFALQKAIRDIAPRKRKLTFLDTIKKRLFSETT*
Ga0173480_101414231	3300015200	Soil	MPSATRPQSVFALQRAIRDIAPNKRKLTFLGNLKRLLFSEIGA*
Ga0134073_103158022	3300015356	Grasslands Soil	LRLDPLERPQSVFALQKAIRDIPPRKRKLTFFNTLKKRLFSEVV*
Ga0132257_1014697621	3300015373	Arabidopsis Rhizosphere	RLDPLERPQSVFALQKAIRDIPPKKRKLTVLGNLKRKLFTEIGA*
Ga0132257_1015798442	3300015373	Arabidopsis Rhizosphere	LDPLERPQSVFALQRAIRDIAPVRRKLTFLGNLKRLLFSEIGA*
Ga0132257_1016530371	3300015373	Arabidopsis Rhizosphere	PLERPQSVFALQKAIREIAPRKRKLTFLDNLKKRLFTEVM*
Ga0182038_114103432	3300016445	Soil	DPLERPQSVFALQKAIRDIPPKKRKLTFLGKFKKRLFTEVM
Ga0187777_105549811	3300017974	Tropical Peatland	PQSVFALQKAIRDIPQTKRKVTFFGSLKKMLFSEIGA
Ga0187766_111090501	3300018058	Tropical Peatland	PLERPQSVFALQKAIREIPPRKRKLTFIDSIKKRLFSEVM
Ga0187765_110186461	3300018060	Tropical Peatland	PLERPQSVFALQKAIREIPPKKRKLTFFGNLKRKLFTEIGA
Ga0190272_117519371	3300018429	Soil	LRLDPLERPQSVFALQRAIRDITPNRRKLTFFGNLKRLLFSEIGT
Ga0066662_109636971	3300018468	Grasslands Soil	LDPLERPQSVFALQRAIRDIPPKKRKLTFIGNLKRVLFSEIGA
Ga0190274_139713531	3300018476	Soil	LERPQSVFALQKAIRDIPQTKRKVTFFGSIKKMLFSEIGA
Ga0190271_103303371	3300018481	Soil	QSVFALQKAIRDIAPRKRKLTFMGNLKRVLFSEIGA
Ga0193751_12656701	3300019888	Soil	PLERPQSVFALQKAIRDIAPRKRKLTFLDTIKKRLFSEMT
Ga0210379_103088241	3300021081	Groundwater Sediment	QSVFALQKAIRDIAPKRRKLSFFDALKRKLFSEIGA
Ga0210380_102414962	3300021082	Groundwater Sediment	PLERPQSVFALQKAIRDIPAKKRKSTFFGSLKRKLFSEIGA
Ga0210341_16323631	3300021337	Estuarine	PLERPQSVFALQKAIRDIPPKKPKLTVFGNLKRRLFTEIGA
Ga0126371_106803793	3300021560	Tropical Forest Soil	RLDPLERPQSVFALQKAIRDIPPRKRKLTFLDSLKKKLFSEVM
Ga0126371_115537151	3300021560	Tropical Forest Soil	PQSVFALQRAIRDIAPIKRKLTFFGNLKRLLFSEIGV
Ga0207673_10267002	3300025290	Corn, Switchgrass And Miscanthus Rhizosphere	LERPQSVFALQRAIRDIAPNKRKLTFLGNLKRLLFSEIGA
Ga0209584_101487861	3300025878	Arctic Peat Soil	PQSVFALQKAIRDIAPKKRKLSFIDNLKKRLFTEVM
Ga0207682_103272481	3300025893	Miscanthus Rhizosphere	PQSVFALQKAIRDIPPKKRKLTVLGSLKRKLFTEIGA
Ga0207660_113235892	3300025917	Corn Rhizosphere	SVFALQRAIRDIAPNKRKLTFLGNLKRLLFSEIGA
Ga0207649_111804072	3300025920	Corn Rhizosphere	CLRLDPLERPQSVFALQRAIRDIAPNKRKATFLGSLKRLLFSEIGA
Ga0207652_107741251	3300025921	Corn Rhizosphere	PQSVFALQKAIRDIPTRKRKLSFLGNLKRVLFSEIGA
Ga0207681_109063992	3300025923	Switchgrass Rhizosphere	ERPQSVFALQKAIRDIPPKKRKLTVLGNLKRKLFTEIGA
Ga0207706_109356452	3300025933	Corn Rhizosphere	PLERPQSVFALQRAIRDIAPNKRKLTFLGNLKRLLFSEIGA
Ga0207711_115665342	3300025941	Switchgrass Rhizosphere	ERPQSVFALQRAIRDIPQRKPKLTFIGNLKRMLFSEIGA
Ga0207679_112093281	3300025945	Corn Rhizosphere	ERPQSVFALQRAIRDIAPVKRKLTFFGNLKRVLFSEIGV
Ga0210090_10581642	3300025965	Natural And Restored Wetlands	QSVFALQKAIREIPPKKRKLTFFGNIKRKLFSEIGA
Ga0207639_108058051	3300026041	Corn Rhizosphere	LERPQSVFALQKAIRDIPTRKRKLTLLGNLKRVLFSEIGA
Ga0208540_10196532	3300026059	Natural And Restored Wetlands	LDPLERPQSVFALQKAIRDIAPRKRKLTFMGNLKRVLFTEIGA
Ga0209239_13621571	3300026310	Grasslands Soil	QSVFALQKAIRDIPPRKRKLTFLDTLKKKLFSEVV
Ga0209472_11817752	3300026323	Soil	DPLERPQSVFALQKAIRDIPPRKRKLSFLDTLKKKLFSEVV
Ga0209056_102615223	3300026538	Soil	DPLERPQSVFALQKAIRDIAPRKRKLTFFDSLKKRLFSEVM
Ga0209805_12915342	3300026542	Soil	DPLERPQSVFALQRAIRDIPPRKRKLTLLGSIKRRLFSEISAS
Ga0209999_10973982	3300027543	Arabidopsis Thaliana Rhizosphere	DPLERPQSVFALQRAIRDITPNKRKLTFLGNLKRLLFLEIGA
Ga0209286_11454702	3300027713	Freshwater Sediment	PQSVFALQKAIRDIAPRKRKLTFMGNLKRVLFTEIGA
Ga0209178_11032921	3300027725	Agricultural Soil	SVFALQRAIRDIAPVKRKLTFLGNLKRLLFSEIGA
Ga0209261_101820221	3300027735	Wetland Sediment	QSVFALQKAIRDFAPKRRRHTFFGNLKRKLFSEIGA
Ga0209288_100513131	3300027762	Freshwater Sediment	PLERPQSIFALQKAIRDIPPKRRKLTFLDNLKRRLFTEIGA
Ga0209772_100462763	3300027768	Bog Forest Soil	DPLERPQSVFALQKAIRDIPPRKRKLTFLDTLKKKLFSEVM
Ga0209177_101267152	3300027775	Agricultural Soil	PQSIFALQKAIRDIAPRKRKLTFFGALKRRLFSEIGA
Ga0209262_103264711	3300027841	Freshwater	DSLERPQSIFALQKAIRDIPPKKRKLTFFDNLKRRLFTEIGA
Ga0209579_100310794	3300027869	Surface Soil	LERPQSVFALQKAIRDIAPRKRKLTFFDNLKKRLFTEVL
Ga0209293_103510701	3300027877	Wetland	ERPQSVFALQKAIRDIPPRKRKLTLFGNVKRRLFSEIGAG
Ga0209450_101745063	3300027885	Freshwater Lake Sediment	PQSIFALQKAIRDIPPKRRKLTFLDNLKRRLFTEIGA
Ga0209820_11122812	3300027956	Freshwater Sediment	LDPLERPQSVFALQKAIRDIPAKKRKLTFMGNLKRVLFSEIGA
Ga0268266_104701891	3300028379	Switchgrass Rhizosphere	RPQSVFALQKAIRDIPPKKRKLTVLGNLKRKLFTEIGA
Ga0268265_123451001	3300028380	Switchgrass Rhizosphere	LRLDPLERPQSVFALQKAIRDIPPKKRKLTLLGSIKRRLFSEMNA
Ga0302160_101616412	3300028665	Fen	RPQSVFALQKAIRDIPQAKRKLTLMGNLKKMLFSQIGA
Ga0302261_11016211	3300028733	Fen	LERPQSVFALQKAIRDIPAKKRKTTFLGNLKRKLFSEIGA
Ga0302262_102060911	3300028743	Fen	ERPQSVFALQKAIRDIPQTKRKLTFMGNLKKMLFSQIGA
Ga0307312_105550402	3300028828	Soil	SVFALQRAIRDIPPRKRKLTLLGSIKRRLFSEISA
Ga0302298_102164012	3300029980	Fen	RPQSVFALQKAIREIPPKKRKLTFFGSLKRRLFTEIGA
Ga0311337_120234521	3300030000	Fen	RPQSVFALQKAIRDIPAKKRKLTFIDTIKKRLFTEVM
Ga0302286_100894141	3300030047	Fen	PLERPQSVFALQKAIRDIPQAKRKLTLMGNLKKMLFSQIGA
Ga0311333_101437353	3300030114	Fen	SVFALQKAIRDIPQTKRKLTFMGNLKKMLFSQIGA
Ga0247826_106643272	3300030336	Soil	ERPQSVFALQKAIRDIPPKKRKLSLLGNIKRVLFSEIGA
Ga0170834_1095748702	3300031057	Forest Soil	ERPQSVFALQKAIRDISPRKRKLTFLDTIKKRLFTEVM
Ga0307496_101123931	3300031200	Soil	LDPLERPQSVFALQKAIREIPPKRRKLTFFGSLKRKLFSEIGA
Ga0318516_102398762	3300031543	Soil	SVFALQRAIRDIPPKKRKLTFMGTIKRALFSEIGA
Ga0318516_105656011	3300031543	Soil	LRLDPLERPQSVFALQRAIRDIPPKKRKLTFIGNLKRVLFSEIGA
Ga0310813_107218551	3300031716	Soil	DPLERPQSVFALQRAIRDIAPNKRKLTFFGNLKRLLFSEIGV
Ga0307469_115768761	3300031720	Hardwood Forest Soil	PLERPQSVFALQKAIREIPPKKRKLTFFGSLKRKLFSEIGA
Ga0307405_119370651	3300031731	Rhizosphere	DPLERPQSVFALQKAIRDIAPRKRKLTFMGNLKRVLFSEIGA
Ga0318501_104043571	3300031736	Soil	PQSVFALQKAIRDIPPRKRKLTFLDTLKKKLFSEVM
Ga0307468_1017735312	3300031740	Hardwood Forest Soil	PLERPQSVFALQKAIRDIPPKKRKLTVLGSLKRKLFTEIGA
Ga0318492_108223472	3300031748	Soil	PQSVFALQRAIRDIPPKKRKLTFIGNLKRVLFSEIGA
Ga0318565_103318531	3300031799	Soil	LRLDPLERPQSVFALQKAIRDIPPRKRKLTFLDSLKKKLFSEVM
Ga0308175_1006252181	3300031938	Soil	LERPQSVFALQRAIRDIAPIKRKLTFFASLKRLLFSEIGV
Ga0310884_109496231	3300031944	Soil	CLRLDPLERPQSVFALQKAIRDIPPKKRKLTVLGSLKRKLFTEIGA
Ga0310897_102118061	3300032003	Soil	SVFALQKAIRDIPPKKRKLSLLGNIKRVLFSEIGA
Ga0310897_102690122	3300032003	Soil	QSVFALQRAIRDIAPNKRKLTFLGNLKRLLFSEIGA
Ga0315272_105155292	3300032018	Sediment	CLRLDPLERPQSVFALQKAIRDIPPKKKKLTVLGNLKRKLFTEIGA
Ga0315272_107262061	3300032018	Sediment	RPQSVFALQKAIRDIPPKKPKLTVFGNLKRRLFTEIGA
Ga0315284_110542592	3300032053	Sediment	LDPLERPQSVFALQKAIRDIPPKKRKLTVFGNLKRRLFTEIGA
Ga0310895_102542502	3300032122	Soil	PQSVFALQRAIRDIAPNKRKLTFLGNLKRLLFSEIGA
Ga0315292_110668942	3300032143	Sediment	RLDPLERPQSVFALQKAIRDIPPKKRKLTVLGNLKRKLFTEIGA
Ga0315910_100502991	3300032144	Soil	DPLERPQSVFALQKAIRDIPPRKRKLTLIGNLKRVLFSEIGA
Ga0315281_107958261	3300032163	Sediment	ERPQSVFALQKAIRDIPPKKRKLTFFDAVKRKLFSELGA
Ga0310889_100345023	3300032179	Soil	ERPQSVFALQRAIRDIAPNKRKLTFLGNLKRLLFSEIGA
Ga0315271_117449372	3300032256	Sediment	LERPQSVFALQKAIRDIPPKKRKLSLFDTVKRKLFSEIGA
Ga0315286_103176473	3300032342	Sediment	RLDPLERPQSVFALQKAIRDSPPKKRKIGLFGSLKRKLFTEIDA
Ga0315286_106391101	3300032342	Sediment	QSVFALQKAIRDIPPKKKKLTVLGNLKRKLFTEIGA
Ga0335084_112547052	3300033004	Soil	RLDPLERPQSVFALQRAIRDIPPKKRKLTFFGNLKRRLFSEIGA
Ga0316603_102236763	3300033413	Soil	RPQSVFALQKAIRDIAPRKRKLTFMGNLKRVLFTEIGA
Ga0316603_108735572	3300033413	Soil	RLDPLERPQSVFALQKAIREIPQTKRKVSFFGSLKKMFFSEIGA
Ga0316603_112651462	3300033413	Soil	LRLDPLERPQSVFALQRAIRDIPPKKRKLTLLGSLKRRLGSESGA
Ga0316625_1025181711	3300033418	Soil	PLERPQSIFALQKAIRDIPPKRRKLTFFDNLKRRLFTEIGA
Ga0316601_1020482692	3300033419	Soil	LRLDPLERPQSVFALQKAIRDIAPKRRKATVFGALKRKLFTEIGT
Ga0316627_1027392902	3300033482	Soil	SVFALQKAIRDIAPKRRKATVFGTLKRKLFTEIGT
Ga0316624_120430162	3300033486	Soil	LERPQSIFALQRAIRDIPPPKRKLTFFGNLKRLLFSEIGA
Ga0316616_1002649913	3300033521	Soil	CLRLDPLERPQSVFALQKAIRDLPPKKRKHTFLGNLKRKLWTEIGA
Ga0247830_103475261	3300033551	Soil	RLDPLERPQSVFALQKAIREIPQVKRKLTLLGSLKKMLFSEVGA
Ga0316617_1025455492	3300033557	Soil	LRLDPLERPQSVFALQKAIRDLPPRKRRLTVLGNVKRRLFSEIGAG
Ga0314867_162891_400_522	3300033808	Peatland	PLERPQSVFALQKAIREIPPRKRKLTFFNNLKRKLFSEVV
Ga0314872_016051_1_123	3300033810	Peatland	LERPQSVFALQKAIRDIPPKRRKPTFLGNLKRKLFTEIGA
Ga0370489_0211692_3_131	3300034127	Untreated Peat Soil	DPLERPQSVFALQKAIRDIPQTKHKVSFFGSLKKMLFSEIGA
Ga0364931_0130384_1_111	3300034176	Sediment	PQSVFALQKTIRDIPPRKRKLTFLDSLKKKLFSEVM

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.33
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.33
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F027274

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign