| Basic Information | |
|---|---|
| Family ID | F027274 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 195 |
| Average Sequence Length | 40 residues |
| Representative Sequence | ERPQSVFALQKAIRDIPPKKRKLTFFGNLKRKLFTEIGA |
| Number of Associated Samples | 177 |
| Number of Associated Scaffolds | 195 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.51 % |
| % of genes near scaffold ends (potentially truncated) | 99.49 % |
| % of genes from short scaffolds (< 2000 bps) | 95.38 % |
| Associated GOLD sequencing projects | 166 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.718 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.256 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (31.282 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.78% β-sheet: 0.00% Coil/Unstructured: 55.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 195 Family Scaffolds |
|---|---|---|
| PF13672 | PP2C_2 | 93.33 |
| PF00929 | RNase_T | 4.62 |
| PF13458 | Peripla_BP_6 | 0.51 |
| PF13089 | PP_kinase_N | 0.51 |
| PF03480 | DctP | 0.51 |
| PF00069 | Pkinase | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 195 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.05 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_100701262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1009565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1587 | Open in IMG/M |
| 3300000891|JGI10214J12806_10329465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 656 | Open in IMG/M |
| 3300000955|JGI1027J12803_105514314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 805 | Open in IMG/M |
| 3300002075|JGI24738J21930_10117685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 576 | Open in IMG/M |
| 3300003152|Ga0052254_1122253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 514 | Open in IMG/M |
| 3300003203|JGI25406J46586_10238725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 533 | Open in IMG/M |
| 3300004062|Ga0055500_10081072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 697 | Open in IMG/M |
| 3300004155|Ga0066600_10220490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 828 | Open in IMG/M |
| 3300004157|Ga0062590_102323142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 564 | Open in IMG/M |
| 3300004780|Ga0062378_10167958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 591 | Open in IMG/M |
| 3300004782|Ga0062382_10008783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3001 | Open in IMG/M |
| 3300005330|Ga0070690_100751364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 753 | Open in IMG/M |
| 3300005333|Ga0070677_10489454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 665 | Open in IMG/M |
| 3300005336|Ga0070680_100498321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1042 | Open in IMG/M |
| 3300005339|Ga0070660_100330201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1254 | Open in IMG/M |
| 3300005339|Ga0070660_100866715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 761 | Open in IMG/M |
| 3300005340|Ga0070689_100184335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1697 | Open in IMG/M |
| 3300005367|Ga0070667_100878737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 834 | Open in IMG/M |
| 3300005435|Ga0070714_100292962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1515 | Open in IMG/M |
| 3300005536|Ga0070697_101659086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 572 | Open in IMG/M |
| 3300005538|Ga0070731_10046062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2912 | Open in IMG/M |
| 3300005544|Ga0070686_100226690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1353 | Open in IMG/M |
| 3300005548|Ga0070665_101572078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 666 | Open in IMG/M |
| 3300005553|Ga0066695_10814921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 537 | Open in IMG/M |
| 3300005556|Ga0066707_10936758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 530 | Open in IMG/M |
| 3300005563|Ga0068855_102069349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 574 | Open in IMG/M |
| 3300005564|Ga0070664_100033365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4312 | Open in IMG/M |
| 3300005566|Ga0066693_10208490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 762 | Open in IMG/M |
| 3300005578|Ga0068854_101951898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 540 | Open in IMG/M |
| 3300005615|Ga0070702_101025294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 655 | Open in IMG/M |
| 3300005616|Ga0068852_100076345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2958 | Open in IMG/M |
| 3300005764|Ga0066903_104597351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 735 | Open in IMG/M |
| 3300005764|Ga0066903_105563953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 664 | Open in IMG/M |
| 3300005764|Ga0066903_108710363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 516 | Open in IMG/M |
| 3300005836|Ga0074470_11062067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 791 | Open in IMG/M |
| 3300005840|Ga0068870_10345033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 954 | Open in IMG/M |
| 3300005841|Ga0068863_101015134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 833 | Open in IMG/M |
| 3300005841|Ga0068863_101827023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 617 | Open in IMG/M |
| 3300006046|Ga0066652_100259399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1526 | Open in IMG/M |
| 3300006047|Ga0075024_100210787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 915 | Open in IMG/M |
| 3300006047|Ga0075024_100879113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 508 | Open in IMG/M |
| 3300006050|Ga0075028_100826877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 566 | Open in IMG/M |
| 3300006174|Ga0075014_100993950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 508 | Open in IMG/M |
| 3300006755|Ga0079222_11292592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 664 | Open in IMG/M |
| 3300006804|Ga0079221_10270638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 978 | Open in IMG/M |
| 3300006854|Ga0075425_100245761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2059 | Open in IMG/M |
| 3300006954|Ga0079219_11200509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 656 | Open in IMG/M |
| 3300007076|Ga0075435_100752819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 847 | Open in IMG/M |
| 3300009053|Ga0105095_10237489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 999 | Open in IMG/M |
| 3300009081|Ga0105098_10377452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 699 | Open in IMG/M |
| 3300009087|Ga0105107_10124410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1816 | Open in IMG/M |
| 3300009131|Ga0115027_11474621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 557 | Open in IMG/M |
| 3300009147|Ga0114129_12929411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 563 | Open in IMG/M |
| 3300009162|Ga0075423_11726227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 674 | Open in IMG/M |
| 3300009167|Ga0113563_12216193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 660 | Open in IMG/M |
| 3300009553|Ga0105249_11214372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 825 | Open in IMG/M |
| 3300010041|Ga0126312_11300947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 538 | Open in IMG/M |
| 3300010335|Ga0134063_10404197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 670 | Open in IMG/M |
| 3300010361|Ga0126378_11293933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 824 | Open in IMG/M |
| 3300010361|Ga0126378_12667593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 571 | Open in IMG/M |
| 3300010366|Ga0126379_10543475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1240 | Open in IMG/M |
| 3300010391|Ga0136847_13016894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 619 | Open in IMG/M |
| 3300010397|Ga0134124_10524944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1149 | Open in IMG/M |
| 3300010403|Ga0134123_10362953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1313 | Open in IMG/M |
| 3300011106|Ga0151489_1624592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 579 | Open in IMG/M |
| 3300011422|Ga0137425_1177973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 532 | Open in IMG/M |
| 3300012045|Ga0136623_10024940 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2566 | Open in IMG/M |
| 3300012198|Ga0137364_10254987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1297 | Open in IMG/M |
| 3300012208|Ga0137376_10551853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 998 | Open in IMG/M |
| 3300012211|Ga0137377_11950049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 504 | Open in IMG/M |
| 3300012349|Ga0137387_11305967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 507 | Open in IMG/M |
| 3300012509|Ga0157334_1010494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 866 | Open in IMG/M |
| 3300012509|Ga0157334_1084404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 501 | Open in IMG/M |
| 3300012519|Ga0157352_1048430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 626 | Open in IMG/M |
| 3300012582|Ga0137358_10675739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 691 | Open in IMG/M |
| 3300012895|Ga0157309_10289911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 549 | Open in IMG/M |
| 3300012955|Ga0164298_10712213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 706 | Open in IMG/M |
| 3300012955|Ga0164298_11524910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 523 | Open in IMG/M |
| 3300012960|Ga0164301_10956291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 669 | Open in IMG/M |
| 3300012971|Ga0126369_13671376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 503 | Open in IMG/M |
| 3300012975|Ga0134110_10621300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 504 | Open in IMG/M |
| 3300012984|Ga0164309_11384917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 599 | Open in IMG/M |
| 3300012988|Ga0164306_10418967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1011 | Open in IMG/M |
| 3300013102|Ga0157371_10001512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 24037 | Open in IMG/M |
| 3300013104|Ga0157370_10192742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1892 | Open in IMG/M |
| 3300013297|Ga0157378_10403739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1347 | Open in IMG/M |
| 3300013308|Ga0157375_11314583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 850 | Open in IMG/M |
| 3300014166|Ga0134079_10686256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 520 | Open in IMG/M |
| 3300014326|Ga0157380_11097757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 834 | Open in IMG/M |
| 3300014829|Ga0120104_1109813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 557 | Open in IMG/M |
| 3300014968|Ga0157379_11030843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 785 | Open in IMG/M |
| 3300014968|Ga0157379_11152041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 744 | Open in IMG/M |
| 3300014969|Ga0157376_10222543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1749 | Open in IMG/M |
| 3300015168|Ga0167631_1066283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 593 | Open in IMG/M |
| 3300015200|Ga0173480_10141423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1219 | Open in IMG/M |
| 3300015356|Ga0134073_10315802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 563 | Open in IMG/M |
| 3300015373|Ga0132257_101469762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 869 | Open in IMG/M |
| 3300015373|Ga0132257_101579844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 839 | Open in IMG/M |
| 3300015373|Ga0132257_101653037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 820 | Open in IMG/M |
| 3300016445|Ga0182038_11410343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 624 | Open in IMG/M |
| 3300017974|Ga0187777_10554981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 806 | Open in IMG/M |
| 3300018058|Ga0187766_11109050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 568 | Open in IMG/M |
| 3300018060|Ga0187765_11018646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 569 | Open in IMG/M |
| 3300018429|Ga0190272_11751937 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
| 3300018468|Ga0066662_10963697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 842 | Open in IMG/M |
| 3300018476|Ga0190274_13971353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 501 | Open in IMG/M |
| 3300018481|Ga0190271_10330337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1598 | Open in IMG/M |
| 3300019888|Ga0193751_1265670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 516 | Open in IMG/M |
| 3300021081|Ga0210379_10308824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 692 | Open in IMG/M |
| 3300021082|Ga0210380_10241496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 819 | Open in IMG/M |
| 3300021337|Ga0210341_1632363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 621 | Open in IMG/M |
| 3300021560|Ga0126371_10680379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 1177 | Open in IMG/M |
| 3300021560|Ga0126371_11553715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 789 | Open in IMG/M |
| 3300025290|Ga0207673_1026700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 792 | Open in IMG/M |
| 3300025878|Ga0209584_10148786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 881 | Open in IMG/M |
| 3300025893|Ga0207682_10327248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 720 | Open in IMG/M |
| 3300025917|Ga0207660_11323589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 585 | Open in IMG/M |
| 3300025920|Ga0207649_11180407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 605 | Open in IMG/M |
| 3300025921|Ga0207652_10774125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 853 | Open in IMG/M |
| 3300025923|Ga0207681_10906399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 738 | Open in IMG/M |
| 3300025933|Ga0207706_10935645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 731 | Open in IMG/M |
| 3300025941|Ga0207711_11566534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 602 | Open in IMG/M |
| 3300025945|Ga0207679_11209328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 694 | Open in IMG/M |
| 3300025965|Ga0210090_1058164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 525 | Open in IMG/M |
| 3300026041|Ga0207639_10805805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 875 | Open in IMG/M |
| 3300026059|Ga0208540_1019653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 750 | Open in IMG/M |
| 3300026310|Ga0209239_1362157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 508 | Open in IMG/M |
| 3300026323|Ga0209472_1181775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 747 | Open in IMG/M |
| 3300026538|Ga0209056_10261522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae | 1223 | Open in IMG/M |
| 3300026542|Ga0209805_1291534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 621 | Open in IMG/M |
| 3300027543|Ga0209999_1097398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 572 | Open in IMG/M |
| 3300027713|Ga0209286_1145470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 871 | Open in IMG/M |
| 3300027725|Ga0209178_1103292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 954 | Open in IMG/M |
| 3300027735|Ga0209261_10182022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 562 | Open in IMG/M |
| 3300027762|Ga0209288_10051313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1238 | Open in IMG/M |
| 3300027768|Ga0209772_10046276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 1290 | Open in IMG/M |
| 3300027775|Ga0209177_10126715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 841 | Open in IMG/M |
| 3300027841|Ga0209262_10326471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 747 | Open in IMG/M |
| 3300027869|Ga0209579_10031079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2912 | Open in IMG/M |
| 3300027877|Ga0209293_10351070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 757 | Open in IMG/M |
| 3300027885|Ga0209450_10174506 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1503 | Open in IMG/M |
| 3300027956|Ga0209820_1112281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 744 | Open in IMG/M |
| 3300028379|Ga0268266_10470189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1197 | Open in IMG/M |
| 3300028380|Ga0268265_12345100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 540 | Open in IMG/M |
| 3300028665|Ga0302160_10161641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 526 | Open in IMG/M |
| 3300028733|Ga0302261_1101621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 680 | Open in IMG/M |
| 3300028743|Ga0302262_10206091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 670 | Open in IMG/M |
| 3300028828|Ga0307312_10555040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 759 | Open in IMG/M |
| 3300029980|Ga0302298_10216401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 628 | Open in IMG/M |
| 3300030000|Ga0311337_12023452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 506 | Open in IMG/M |
| 3300030047|Ga0302286_10089414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 1589 | Open in IMG/M |
| 3300030114|Ga0311333_10143735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1817 | Open in IMG/M |
| 3300030336|Ga0247826_10664327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 805 | Open in IMG/M |
| 3300031057|Ga0170834_109574870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1022 | Open in IMG/M |
| 3300031200|Ga0307496_10112393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 544 | Open in IMG/M |
| 3300031543|Ga0318516_10239876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1048 | Open in IMG/M |
| 3300031543|Ga0318516_10565601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 650 | Open in IMG/M |
| 3300031716|Ga0310813_10721855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 891 | Open in IMG/M |
| 3300031720|Ga0307469_11576876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 630 | Open in IMG/M |
| 3300031731|Ga0307405_11937065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 526 | Open in IMG/M |
| 3300031736|Ga0318501_10404357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 738 | Open in IMG/M |
| 3300031740|Ga0307468_101773531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 583 | Open in IMG/M |
| 3300031748|Ga0318492_10822347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 500 | Open in IMG/M |
| 3300031799|Ga0318565_10331853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 738 | Open in IMG/M |
| 3300031938|Ga0308175_100625218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1162 | Open in IMG/M |
| 3300031944|Ga0310884_10949623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 532 | Open in IMG/M |
| 3300032003|Ga0310897_10211806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 850 | Open in IMG/M |
| 3300032003|Ga0310897_10269012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 769 | Open in IMG/M |
| 3300032018|Ga0315272_10515529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 598 | Open in IMG/M |
| 3300032018|Ga0315272_10726206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 507 | Open in IMG/M |
| 3300032053|Ga0315284_11054259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 910 | Open in IMG/M |
| 3300032122|Ga0310895_10254250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 813 | Open in IMG/M |
| 3300032143|Ga0315292_11066894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 669 | Open in IMG/M |
| 3300032144|Ga0315910_10050299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3036 | Open in IMG/M |
| 3300032163|Ga0315281_10795826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 976 | Open in IMG/M |
| 3300032179|Ga0310889_10034502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1884 | Open in IMG/M |
| 3300032256|Ga0315271_11744937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 534 | Open in IMG/M |
| 3300032342|Ga0315286_10317647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1647 | Open in IMG/M |
| 3300032342|Ga0315286_10639110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1093 | Open in IMG/M |
| 3300033004|Ga0335084_11254705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 739 | Open in IMG/M |
| 3300033413|Ga0316603_10223676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1618 | Open in IMG/M |
| 3300033413|Ga0316603_10873557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 847 | Open in IMG/M |
| 3300033413|Ga0316603_11265146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 699 | Open in IMG/M |
| 3300033418|Ga0316625_102518171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 520 | Open in IMG/M |
| 3300033419|Ga0316601_102048269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 577 | Open in IMG/M |
| 3300033482|Ga0316627_102739290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 523 | Open in IMG/M |
| 3300033486|Ga0316624_12043016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 532 | Open in IMG/M |
| 3300033521|Ga0316616_100264991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1785 | Open in IMG/M |
| 3300033551|Ga0247830_10347526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1146 | Open in IMG/M |
| 3300033557|Ga0316617_102545549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 531 | Open in IMG/M |
| 3300033808|Ga0314867_162891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 524 | Open in IMG/M |
| 3300033810|Ga0314872_016051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 621 | Open in IMG/M |
| 3300034127|Ga0370489_0211692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 577 | Open in IMG/M |
| 3300034176|Ga0364931_0130384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 805 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.62% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.10% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.59% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.08% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.08% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.56% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.05% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.05% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.05% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.54% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.54% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.54% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.54% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.54% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.03% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.03% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 1.03% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.03% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.03% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.03% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.03% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.03% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.03% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.03% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.03% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.03% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.03% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.51% |
| Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.51% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.51% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.51% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.51% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.51% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.51% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.51% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.51% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.51% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.51% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.51% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.51% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.51% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.51% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.51% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.51% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.51% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.51% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.51% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Host-Associated | Open in IMG/M |
| 3300003152 | Freshwater sediment microbial communities from Loktak Lake, India | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004155 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004780 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh | Environmental | Open in IMG/M |
| 3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011422 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2 | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015168 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021337 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.425 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Host-Associated | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025965 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026059 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027713 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027735 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027841 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028665 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300028733 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_4 | Environmental | Open in IMG/M |
| 3300028743 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300029980 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031200 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
| 3300033810 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_E | Environmental | Open in IMG/M |
| 3300034127 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_16 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1007012622 | 3300000559 | Soil | PQSVFALQKAIRDIPPKRRKLTFIDSIKKRLFTEVM* |
| AP72_2010_repI_A01DRAFT_10095651 | 3300000579 | Forest Soil | LDPLERPQSVFALQKAIREIPPRKRKLTFFNNLKRKLFSEVV* |
| JGI10214J12806_103294651 | 3300000891 | Soil | ERPQSVFALQRAIRDIAPNKRKLTFLGNLKRLLFSEIGA* |
| JGI1027J12803_1055143141 | 3300000955 | Soil | CLRLDPLERPQSVFALQKAIRDIPPRKRKLTFLDTLKKKLFSEVV* |
| JGI24738J21930_101176852 | 3300002075 | Corn Rhizosphere | ERPQSVFALQRAIRDIAPNKRKVTXLGSLKRLLFSEIGA* |
| Ga0052254_11222531 | 3300003152 | Sediment | CLRLDPLERPQSVFALQKAIRDIAPKKRKVGFLGNLKKKLFTEIA* |
| JGI25406J46586_102387252 | 3300003203 | Tabebuia Heterophylla Rhizosphere | PLERPQSVFALQKAIRDIPPKKRKVTFLGNLKRRLFSEISA* |
| Ga0055500_100810722 | 3300004062 | Natural And Restored Wetlands | PLERPQSVFALQKAIRDIPPKKPKLTVFGNLKRRLFTEIGA* |
| Ga0066600_102204901 | 3300004155 | Freshwater | ERPQSVFALQKAIRDIPPKKRKLTFFGNLKRKLFTEIGA* |
| Ga0062590_1023231422 | 3300004157 | Soil | DPLERPQSVFALQKAIREIAPRKRKLTFLDNLKKRLFTEVM* |
| Ga0062378_101679582 | 3300004780 | Wetland Sediment | CLRLDPLERPQSVFALQKAIRDIPQTKRKLSFMGNLKKMLFSQIGA* |
| Ga0062382_100087834 | 3300004782 | Wetland Sediment | ERPQSVFALQKAIRDIPPRKRKLTFIDAVKRRLFSEIGA* |
| Ga0070690_1007513641 | 3300005330 | Switchgrass Rhizosphere | LDPLERPQSVFALQKAIRDIPLKKRKLSFFGNLKRKLFTEIGA* |
| Ga0070677_104894542 | 3300005333 | Miscanthus Rhizosphere | ERPQSVFALQKAIRDIPQTKRKVTFFGSIKKMLFSEIGA* |
| Ga0070680_1004983211 | 3300005336 | Corn Rhizosphere | PLERPQSVFALQKAIRDIPQTKRKVTFLGSLKKMLFSEIGA* |
| Ga0070660_1003302013 | 3300005339 | Corn Rhizosphere | LDPLERPQSVFALQRAIRDIAPIKRKLTFFGNLKRLLFSEIGV* |
| Ga0070660_1008667151 | 3300005339 | Corn Rhizosphere | PLERPQSVFALQRAIRDIAPNKRKLTFLGNLKRLLFSEIGA* |
| Ga0070689_1001843353 | 3300005340 | Switchgrass Rhizosphere | DPLERPQSVFALQRAIRDIPPKKRKLTLLASLRRKLGSESSA* |
| Ga0070667_1008787372 | 3300005367 | Switchgrass Rhizosphere | RLDPLERPQSVFSLQKAIKDIPPKKRKVSFLGNLKKKLFTEIGA* |
| Ga0070714_1002929621 | 3300005435 | Agricultural Soil | PLERPQSVFALQKAIREIPPRKRKRTFIDSLKKKLFTEVM* |
| Ga0070697_1016590862 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LDPLERPQSVFALQKAIRDIPPRKRKLTFLDTLKKKLFSEVM* |
| Ga0070731_100460624 | 3300005538 | Surface Soil | LERPQSVFALQKAIRDIAPRKRKLTFFDNLKKRLFTEVL* |
| Ga0070686_1002266901 | 3300005544 | Switchgrass Rhizosphere | LERPQSVFALQKAIRDIPQTKRKISFFGSLKKMLFSEIGA* |
| Ga0070665_1015720782 | 3300005548 | Switchgrass Rhizosphere | DPLERPQSVFALQKAIRDIPPKKRKITVLGSLKRKLFTEIGA* |
| Ga0066695_108149212 | 3300005553 | Soil | SVFALQKAIRDIPPRKRKLTFFNTLKKKLFSEVA* |
| Ga0066707_109367581 | 3300005556 | Soil | SVFALQKAIRDIPPKRRKLTFLGNLKKRLFTEVM* |
| Ga0068855_1020693492 | 3300005563 | Corn Rhizosphere | LDPLERPQSVFALQRAIRDIAPNKRKLTFLGNLKRLLFSEIGA* |
| Ga0070664_1000333655 | 3300005564 | Corn Rhizosphere | ERPQSVFALQRAIRDIPPKKRKLTLMGNLKRMLFSEIGA* |
| Ga0066693_102084901 | 3300005566 | Soil | DPLERPQSVFALQRAIRDIPPRKRKLTLLGSIKRRLFSEISA* |
| Ga0068854_1019518982 | 3300005578 | Corn Rhizosphere | PQSIFALQKAIRDIAPKKRKLTFLGALKNRLFSDIGA* |
| Ga0070702_1010252942 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | ERPQSVFALQKAIRDIPPKKRKLTVLGNLKRKLFTEIGA* |
| Ga0068852_1000763455 | 3300005616 | Corn Rhizosphere | LDPLERPQSVFALQRAIRDIAPNKRKVTFLGSLKRLLFSEIGA* |
| Ga0066903_1045973512 | 3300005764 | Tropical Forest Soil | RLDPLERPQSVFALQKAIRDIPPKKRKLTFLGSLKRKLFSEIGA* |
| Ga0066903_1055639532 | 3300005764 | Tropical Forest Soil | VFALQKAIKDIPPKKRKESFLGNLKKKLFTEIGA* |
| Ga0066903_1087103632 | 3300005764 | Tropical Forest Soil | LERPQSVFALQKAIRDIPPKKRKLTFLGKFKKRLFTEVM* |
| Ga0074470_110620671 | 3300005836 | Sediment (Intertidal) | ERPQSVFALQNAIRDIPPRKRKLTFLGSLKRKLFSEIGA* |
| Ga0068870_103450332 | 3300005840 | Miscanthus Rhizosphere | SVFALQKAIRDITQTKRKVSFFGSLRKMLFSEIGA* |
| Ga0068863_1010151342 | 3300005841 | Switchgrass Rhizosphere | PQSVFALQKAIRDIPPKKRKLTVFGNLKRKLFTEIGA* |
| Ga0068863_1018270232 | 3300005841 | Switchgrass Rhizosphere | VFALQKAIRDIPPKKRKLSLIGNIKRVLFSEIGA* |
| Ga0066652_1002593993 | 3300006046 | Soil | RLDPLERPQSVFALQKAIRDIPPKKRKVGFLGNLKKKLFTEIA* |
| Ga0075024_1002107872 | 3300006047 | Watersheds | PQSVFALQKAIREIPPKKRKLTFFGSLKRKLFSEIGA* |
| Ga0075024_1008791131 | 3300006047 | Watersheds | RPQSVFALQKAIRDIPPKKRKLTVLGNLKRKLFTEIGA* |
| Ga0075028_1008268772 | 3300006050 | Watersheds | RPQSVFALQKAIREIPPKKRKLTFFGSLKRRLFTEIGA* |
| Ga0075014_1009939502 | 3300006174 | Watersheds | QSVFALQKAIREIPPKKRKLTFFGNLKRKLFTEIGA* |
| Ga0079222_112925922 | 3300006755 | Agricultural Soil | PLERPQSVFALQKAIRDIPPRKRKLTFFNTLKKKLFSEVV* |
| Ga0079221_102706381 | 3300006804 | Agricultural Soil | PQSVFALQRAIRDIAPVKRKLTFLGNLKRLLFSEIGA* |
| Ga0075425_1002457613 | 3300006854 | Populus Rhizosphere | LDPLERPQSVFALQRAIRDIPPRKRKLTLLGSIKRRLFSEISA* |
| Ga0079219_112005092 | 3300006954 | Agricultural Soil | PRSVFALQRAIRDIAPVTRKLTFFGNLKRVLFSEIGV* |
| Ga0075435_1007528191 | 3300007076 | Populus Rhizosphere | LDPLERPQSVFALQRAIRDIAPIKRKLTFFANLKRLLFSEIGV* |
| Ga0105095_102374891 | 3300009053 | Freshwater Sediment | VFALQKAIRDIPPKKRKLTFIAAVKRKLFSEIGA* |
| Ga0105098_103774522 | 3300009081 | Freshwater Sediment | RPQSVFALQKAIRDIPAKKRKLTFMGNLKRVLFSEIGA* |
| Ga0105107_101244103 | 3300009087 | Freshwater Sediment | QSVFALQKAIRDIPPKKRKLTFIAAVKRKLFSEIGA* |
| Ga0115027_114746212 | 3300009131 | Wetland | QSVFALQKAIRDIAPRKRKLTFMGNLKRVLFTEIGA* |
| Ga0114129_129294111 | 3300009147 | Populus Rhizosphere | RPQSVFALQRAIRDIAPIKRKLTFFGNLKRFLFSEIGA* |
| Ga0075423_117262271 | 3300009162 | Populus Rhizosphere | SVFALQKAIREIPPKKRKLTFFGSLKRKLFSEIGA* |
| Ga0113563_122161931 | 3300009167 | Freshwater Wetlands | PLERPQSVFALQKAIRDIAPRKRKLTFMGNLKRVLFTEIGA* |
| Ga0105249_112143722 | 3300009553 | Switchgrass Rhizosphere | LDPLERPQSVFALQRAIRDIPPKKRKLTLLASLRRKLGSESSA* |
| Ga0126312_113009471 | 3300010041 | Serpentine Soil | LERPQSVFALQKAIRDIPPKKRKVTFLGNLKRRLFSETAA* |
| Ga0134063_104041972 | 3300010335 | Grasslands Soil | CLRLDPLERPQSVFALQKAIRDIPPRKRKLTFLNTLKKKLFSEVV* |
| Ga0126378_112939331 | 3300010361 | Tropical Forest Soil | PLERPQSVFALQKTIRDIPPRKRKLTFLDSLKKKLFSEVM* |
| Ga0126378_126675932 | 3300010361 | Tropical Forest Soil | RLDPLERPQSVFALQKAIRDIPPRKRKLTFLDSLKKKLFSEVM* |
| Ga0126379_105434753 | 3300010366 | Tropical Forest Soil | PLERPQSVFALQKAIRDIPPRKRKLTFLDSLKKKLFSEVM* |
| Ga0136847_130168941 | 3300010391 | Freshwater Sediment | LRLDPLERPQSVFALQKAIRDIPPKKRKLTVLGNLKRKLFTEIGA* |
| Ga0134124_105249441 | 3300010397 | Terrestrial Soil | DPLERPQSVFALQRAIRDIAPNKRKLTFLGNLKRLLFSEIGA* |
| Ga0134123_103629532 | 3300010403 | Terrestrial Soil | PLERAQSVFALQKAIREIPQTRKKLTFLGSIKKMLFSEVGA* |
| Ga0151489_16245921 | 3300011106 | Soil | LDPLERPQSVFALQKAIRDIPQTKRKLTFMGNLKKMLFSQIGA* |
| Ga0137425_11779731 | 3300011422 | Soil | LDPLERPQSVFALQKAIRDIPPKKRKLTLLGSLKRRLFSEMSA* |
| Ga0136623_100249404 | 3300012045 | Polar Desert Sand | LRLDPLERPQSIFALQKAIRDIPPVKRKLSFFGSLKKLLFSEIGA* |
| Ga0137364_102549871 | 3300012198 | Vadose Zone Soil | QSVFALQKAIRDIAPRKRKLTFLDTIKKRLFSETT* |
| Ga0137376_105518531 | 3300012208 | Vadose Zone Soil | RPQSVFALQKAIRDIAPRKRKLTFLDTIKKRLFSETT* |
| Ga0137377_119500491 | 3300012211 | Vadose Zone Soil | PLERPQSVFALQKAIRDIPPRKRKLSFLDTLKKKLFSEVV* |
| Ga0137387_113059672 | 3300012349 | Vadose Zone Soil | PLERPQSVFALQKAIRDIPPRKRKLTFLNTLKKKLFSEVV* |
| Ga0157334_10104941 | 3300012509 | Soil | DPLERPQSVFALQRAIRDIAPVRRKLTFLGNLKRLLFSEIGA* |
| Ga0157334_10844042 | 3300012509 | Soil | QSVFALQRAIRDIAPNKRKLTFLGNLKRLLFSEIGA* |
| Ga0157352_10484301 | 3300012519 | Unplanted Soil | QSVFALQKAIREIPPKKRKVTFFGSLKRRLFSEIGA* |
| Ga0137358_106757392 | 3300012582 | Vadose Zone Soil | DPLERPQSVFALQKAIRDIPPKKRKLTFIDSIKKRLFTEVM* |
| Ga0157309_102899112 | 3300012895 | Soil | RPQSVFALQKAIREIPQVKRKLTLLGSLKKMLFSEVGA* |
| Ga0164298_107122131 | 3300012955 | Soil | QSVFALQRAIRDIAPNKRKLTFFGNLKRLLFSEIGA* |
| Ga0164298_115249101 | 3300012955 | Soil | LDPLERPQSVFALQKAIRDIPPRKRKLTFLDTLKKKLFSEVV* |
| Ga0164301_109562911 | 3300012960 | Soil | LRLDQLERPQSVFALQKSIRDITPKKRKVGFLGNLKKKLFTEIA* |
| Ga0126369_136713761 | 3300012971 | Tropical Forest Soil | SVFALQKAIRDIPQTKRKVTFLGSLKKMLFSEIGA* |
| Ga0134110_106213002 | 3300012975 | Grasslands Soil | LERPQSVFALQKAIRDIPPRKRKLTFLNTLKKKLFSEVV* |
| Ga0164309_113849171 | 3300012984 | Soil | QSVFALQKAIREIAPRKRKLTFLDNLKKRLFTEVM* |
| Ga0164306_104189671 | 3300012988 | Soil | SVFALQRAIRDIAPNKRKVTFLGSLKRLLFSEIGA* |
| Ga0157371_1000151222 | 3300013102 | Corn Rhizosphere | DPLERPQSVFALQRAIRDIAPNKRKVTFLGSLKRLLFSEIGA* |
| Ga0157370_101927423 | 3300013104 | Corn Rhizosphere | PQSVFALQRAIRDIAPIKRKLTFFGNLKRLLFSEIGV* |
| Ga0157378_104037393 | 3300013297 | Miscanthus Rhizosphere | RPQSVFALQRAIRDIAPNKRKLSFLGNLKRLLFSEIGA* |
| Ga0157375_113145831 | 3300013308 | Miscanthus Rhizosphere | LRLDPLERPQSVFALQKAIRDIPQTKRKVSFFGSLRKMLFSEIGA* |
| Ga0134079_106862562 | 3300014166 | Grasslands Soil | QSVFALQKAIRDIPPTKRKLTLFGSLKRKLMSEIGA* |
| Ga0157380_110977572 | 3300014326 | Switchgrass Rhizosphere | LERPQSVFALQKAIRDIPQTKRKVSFFGSLKKMLFSEIGA* |
| Ga0120104_11098131 | 3300014829 | Permafrost | LDPLERPQSVFALQKAIRDIAPRKRKLTFLDTIKKRLFSETT* |
| Ga0157379_110308432 | 3300014968 | Switchgrass Rhizosphere | QSVFALQKAIRDIPLKKRKLSFFGNLKRKLFTEIGA* |
| Ga0157379_111520412 | 3300014968 | Switchgrass Rhizosphere | RLDPLERPQSVFALQKAIRDIPPKKRKLTVFGNLKRKLFTEIGA* |
| Ga0157376_102225433 | 3300014969 | Miscanthus Rhizosphere | PQSVFALQKAIRDIPQTKRKVTFLGSLKKMLFSEIGA* |
| Ga0167631_10662832 | 3300015168 | Glacier Forefield Soil | CLRLDPLERPQSVFALQKAIRDIAPRKRKLTFLDTIKKRLFSETT* |
| Ga0173480_101414231 | 3300015200 | Soil | MPSATRPQSVFALQRAIRDIAPNKRKLTFLGNLKRLLFSEIGA* |
| Ga0134073_103158022 | 3300015356 | Grasslands Soil | LRLDPLERPQSVFALQKAIRDIPPRKRKLTFFNTLKKRLFSEVV* |
| Ga0132257_1014697621 | 3300015373 | Arabidopsis Rhizosphere | RLDPLERPQSVFALQKAIRDIPPKKRKLTVLGNLKRKLFTEIGA* |
| Ga0132257_1015798442 | 3300015373 | Arabidopsis Rhizosphere | LDPLERPQSVFALQRAIRDIAPVRRKLTFLGNLKRLLFSEIGA* |
| Ga0132257_1016530371 | 3300015373 | Arabidopsis Rhizosphere | PLERPQSVFALQKAIREIAPRKRKLTFLDNLKKRLFTEVM* |
| Ga0182038_114103432 | 3300016445 | Soil | DPLERPQSVFALQKAIRDIPPKKRKLTFLGKFKKRLFTEVM |
| Ga0187777_105549811 | 3300017974 | Tropical Peatland | PQSVFALQKAIRDIPQTKRKVTFFGSLKKMLFSEIGA |
| Ga0187766_111090501 | 3300018058 | Tropical Peatland | PLERPQSVFALQKAIREIPPRKRKLTFIDSIKKRLFSEVM |
| Ga0187765_110186461 | 3300018060 | Tropical Peatland | PLERPQSVFALQKAIREIPPKKRKLTFFGNLKRKLFTEIGA |
| Ga0190272_117519371 | 3300018429 | Soil | LRLDPLERPQSVFALQRAIRDITPNRRKLTFFGNLKRLLFSEIGT |
| Ga0066662_109636971 | 3300018468 | Grasslands Soil | LDPLERPQSVFALQRAIRDIPPKKRKLTFIGNLKRVLFSEIGA |
| Ga0190274_139713531 | 3300018476 | Soil | LERPQSVFALQKAIRDIPQTKRKVTFFGSIKKMLFSEIGA |
| Ga0190271_103303371 | 3300018481 | Soil | QSVFALQKAIRDIAPRKRKLTFMGNLKRVLFSEIGA |
| Ga0193751_12656701 | 3300019888 | Soil | PLERPQSVFALQKAIRDIAPRKRKLTFLDTIKKRLFSEMT |
| Ga0210379_103088241 | 3300021081 | Groundwater Sediment | QSVFALQKAIRDIAPKRRKLSFFDALKRKLFSEIGA |
| Ga0210380_102414962 | 3300021082 | Groundwater Sediment | PLERPQSVFALQKAIRDIPAKKRKSTFFGSLKRKLFSEIGA |
| Ga0210341_16323631 | 3300021337 | Estuarine | PLERPQSVFALQKAIRDIPPKKPKLTVFGNLKRRLFTEIGA |
| Ga0126371_106803793 | 3300021560 | Tropical Forest Soil | RLDPLERPQSVFALQKAIRDIPPRKRKLTFLDSLKKKLFSEVM |
| Ga0126371_115537151 | 3300021560 | Tropical Forest Soil | PQSVFALQRAIRDIAPIKRKLTFFGNLKRLLFSEIGV |
| Ga0207673_10267002 | 3300025290 | Corn, Switchgrass And Miscanthus Rhizosphere | LERPQSVFALQRAIRDIAPNKRKLTFLGNLKRLLFSEIGA |
| Ga0209584_101487861 | 3300025878 | Arctic Peat Soil | PQSVFALQKAIRDIAPKKRKLSFIDNLKKRLFTEVM |
| Ga0207682_103272481 | 3300025893 | Miscanthus Rhizosphere | PQSVFALQKAIRDIPPKKRKLTVLGSLKRKLFTEIGA |
| Ga0207660_113235892 | 3300025917 | Corn Rhizosphere | SVFALQRAIRDIAPNKRKLTFLGNLKRLLFSEIGA |
| Ga0207649_111804072 | 3300025920 | Corn Rhizosphere | CLRLDPLERPQSVFALQRAIRDIAPNKRKATFLGSLKRLLFSEIGA |
| Ga0207652_107741251 | 3300025921 | Corn Rhizosphere | PQSVFALQKAIRDIPTRKRKLSFLGNLKRVLFSEIGA |
| Ga0207681_109063992 | 3300025923 | Switchgrass Rhizosphere | ERPQSVFALQKAIRDIPPKKRKLTVLGNLKRKLFTEIGA |
| Ga0207706_109356452 | 3300025933 | Corn Rhizosphere | PLERPQSVFALQRAIRDIAPNKRKLTFLGNLKRLLFSEIGA |
| Ga0207711_115665342 | 3300025941 | Switchgrass Rhizosphere | ERPQSVFALQRAIRDIPQRKPKLTFIGNLKRMLFSEIGA |
| Ga0207679_112093281 | 3300025945 | Corn Rhizosphere | ERPQSVFALQRAIRDIAPVKRKLTFFGNLKRVLFSEIGV |
| Ga0210090_10581642 | 3300025965 | Natural And Restored Wetlands | QSVFALQKAIREIPPKKRKLTFFGNIKRKLFSEIGA |
| Ga0207639_108058051 | 3300026041 | Corn Rhizosphere | LERPQSVFALQKAIRDIPTRKRKLTLLGNLKRVLFSEIGA |
| Ga0208540_10196532 | 3300026059 | Natural And Restored Wetlands | LDPLERPQSVFALQKAIRDIAPRKRKLTFMGNLKRVLFTEIGA |
| Ga0209239_13621571 | 3300026310 | Grasslands Soil | QSVFALQKAIRDIPPRKRKLTFLDTLKKKLFSEVV |
| Ga0209472_11817752 | 3300026323 | Soil | DPLERPQSVFALQKAIRDIPPRKRKLSFLDTLKKKLFSEVV |
| Ga0209056_102615223 | 3300026538 | Soil | DPLERPQSVFALQKAIRDIAPRKRKLTFFDSLKKRLFSEVM |
| Ga0209805_12915342 | 3300026542 | Soil | DPLERPQSVFALQRAIRDIPPRKRKLTLLGSIKRRLFSEISAS |
| Ga0209999_10973982 | 3300027543 | Arabidopsis Thaliana Rhizosphere | DPLERPQSVFALQRAIRDITPNKRKLTFLGNLKRLLFLEIGA |
| Ga0209286_11454702 | 3300027713 | Freshwater Sediment | PQSVFALQKAIRDIAPRKRKLTFMGNLKRVLFTEIGA |
| Ga0209178_11032921 | 3300027725 | Agricultural Soil | SVFALQRAIRDIAPVKRKLTFLGNLKRLLFSEIGA |
| Ga0209261_101820221 | 3300027735 | Wetland Sediment | QSVFALQKAIRDFAPKRRRHTFFGNLKRKLFSEIGA |
| Ga0209288_100513131 | 3300027762 | Freshwater Sediment | PLERPQSIFALQKAIRDIPPKRRKLTFLDNLKRRLFTEIGA |
| Ga0209772_100462763 | 3300027768 | Bog Forest Soil | DPLERPQSVFALQKAIRDIPPRKRKLTFLDTLKKKLFSEVM |
| Ga0209177_101267152 | 3300027775 | Agricultural Soil | PQSIFALQKAIRDIAPRKRKLTFFGALKRRLFSEIGA |
| Ga0209262_103264711 | 3300027841 | Freshwater | DSLERPQSIFALQKAIRDIPPKKRKLTFFDNLKRRLFTEIGA |
| Ga0209579_100310794 | 3300027869 | Surface Soil | LERPQSVFALQKAIRDIAPRKRKLTFFDNLKKRLFTEVL |
| Ga0209293_103510701 | 3300027877 | Wetland | ERPQSVFALQKAIRDIPPRKRKLTLFGNVKRRLFSEIGAG |
| Ga0209450_101745063 | 3300027885 | Freshwater Lake Sediment | PQSIFALQKAIRDIPPKRRKLTFLDNLKRRLFTEIGA |
| Ga0209820_11122812 | 3300027956 | Freshwater Sediment | LDPLERPQSVFALQKAIRDIPAKKRKLTFMGNLKRVLFSEIGA |
| Ga0268266_104701891 | 3300028379 | Switchgrass Rhizosphere | RPQSVFALQKAIRDIPPKKRKLTVLGNLKRKLFTEIGA |
| Ga0268265_123451001 | 3300028380 | Switchgrass Rhizosphere | LRLDPLERPQSVFALQKAIRDIPPKKRKLTLLGSIKRRLFSEMNA |
| Ga0302160_101616412 | 3300028665 | Fen | RPQSVFALQKAIRDIPQAKRKLTLMGNLKKMLFSQIGA |
| Ga0302261_11016211 | 3300028733 | Fen | LERPQSVFALQKAIRDIPAKKRKTTFLGNLKRKLFSEIGA |
| Ga0302262_102060911 | 3300028743 | Fen | ERPQSVFALQKAIRDIPQTKRKLTFMGNLKKMLFSQIGA |
| Ga0307312_105550402 | 3300028828 | Soil | SVFALQRAIRDIPPRKRKLTLLGSIKRRLFSEISA |
| Ga0302298_102164012 | 3300029980 | Fen | RPQSVFALQKAIREIPPKKRKLTFFGSLKRRLFTEIGA |
| Ga0311337_120234521 | 3300030000 | Fen | RPQSVFALQKAIRDIPAKKRKLTFIDTIKKRLFTEVM |
| Ga0302286_100894141 | 3300030047 | Fen | PLERPQSVFALQKAIRDIPQAKRKLTLMGNLKKMLFSQIGA |
| Ga0311333_101437353 | 3300030114 | Fen | SVFALQKAIRDIPQTKRKLTFMGNLKKMLFSQIGA |
| Ga0247826_106643272 | 3300030336 | Soil | ERPQSVFALQKAIRDIPPKKRKLSLLGNIKRVLFSEIGA |
| Ga0170834_1095748702 | 3300031057 | Forest Soil | ERPQSVFALQKAIRDISPRKRKLTFLDTIKKRLFTEVM |
| Ga0307496_101123931 | 3300031200 | Soil | LDPLERPQSVFALQKAIREIPPKRRKLTFFGSLKRKLFSEIGA |
| Ga0318516_102398762 | 3300031543 | Soil | SVFALQRAIRDIPPKKRKLTFMGTIKRALFSEIGA |
| Ga0318516_105656011 | 3300031543 | Soil | LRLDPLERPQSVFALQRAIRDIPPKKRKLTFIGNLKRVLFSEIGA |
| Ga0310813_107218551 | 3300031716 | Soil | DPLERPQSVFALQRAIRDIAPNKRKLTFFGNLKRLLFSEIGV |
| Ga0307469_115768761 | 3300031720 | Hardwood Forest Soil | PLERPQSVFALQKAIREIPPKKRKLTFFGSLKRKLFSEIGA |
| Ga0307405_119370651 | 3300031731 | Rhizosphere | DPLERPQSVFALQKAIRDIAPRKRKLTFMGNLKRVLFSEIGA |
| Ga0318501_104043571 | 3300031736 | Soil | PQSVFALQKAIRDIPPRKRKLTFLDTLKKKLFSEVM |
| Ga0307468_1017735312 | 3300031740 | Hardwood Forest Soil | PLERPQSVFALQKAIRDIPPKKRKLTVLGSLKRKLFTEIGA |
| Ga0318492_108223472 | 3300031748 | Soil | PQSVFALQRAIRDIPPKKRKLTFIGNLKRVLFSEIGA |
| Ga0318565_103318531 | 3300031799 | Soil | LRLDPLERPQSVFALQKAIRDIPPRKRKLTFLDSLKKKLFSEVM |
| Ga0308175_1006252181 | 3300031938 | Soil | LERPQSVFALQRAIRDIAPIKRKLTFFASLKRLLFSEIGV |
| Ga0310884_109496231 | 3300031944 | Soil | CLRLDPLERPQSVFALQKAIRDIPPKKRKLTVLGSLKRKLFTEIGA |
| Ga0310897_102118061 | 3300032003 | Soil | SVFALQKAIRDIPPKKRKLSLLGNIKRVLFSEIGA |
| Ga0310897_102690122 | 3300032003 | Soil | QSVFALQRAIRDIAPNKRKLTFLGNLKRLLFSEIGA |
| Ga0315272_105155292 | 3300032018 | Sediment | CLRLDPLERPQSVFALQKAIRDIPPKKKKLTVLGNLKRKLFTEIGA |
| Ga0315272_107262061 | 3300032018 | Sediment | RPQSVFALQKAIRDIPPKKPKLTVFGNLKRRLFTEIGA |
| Ga0315284_110542592 | 3300032053 | Sediment | LDPLERPQSVFALQKAIRDIPPKKRKLTVFGNLKRRLFTEIGA |
| Ga0310895_102542502 | 3300032122 | Soil | PQSVFALQRAIRDIAPNKRKLTFLGNLKRLLFSEIGA |
| Ga0315292_110668942 | 3300032143 | Sediment | RLDPLERPQSVFALQKAIRDIPPKKRKLTVLGNLKRKLFTEIGA |
| Ga0315910_100502991 | 3300032144 | Soil | DPLERPQSVFALQKAIRDIPPRKRKLTLIGNLKRVLFSEIGA |
| Ga0315281_107958261 | 3300032163 | Sediment | ERPQSVFALQKAIRDIPPKKRKLTFFDAVKRKLFSELGA |
| Ga0310889_100345023 | 3300032179 | Soil | ERPQSVFALQRAIRDIAPNKRKLTFLGNLKRLLFSEIGA |
| Ga0315271_117449372 | 3300032256 | Sediment | LERPQSVFALQKAIRDIPPKKRKLSLFDTVKRKLFSEIGA |
| Ga0315286_103176473 | 3300032342 | Sediment | RLDPLERPQSVFALQKAIRDSPPKKRKIGLFGSLKRKLFTEIDA |
| Ga0315286_106391101 | 3300032342 | Sediment | QSVFALQKAIRDIPPKKKKLTVLGNLKRKLFTEIGA |
| Ga0335084_112547052 | 3300033004 | Soil | RLDPLERPQSVFALQRAIRDIPPKKRKLTFFGNLKRRLFSEIGA |
| Ga0316603_102236763 | 3300033413 | Soil | RPQSVFALQKAIRDIAPRKRKLTFMGNLKRVLFTEIGA |
| Ga0316603_108735572 | 3300033413 | Soil | RLDPLERPQSVFALQKAIREIPQTKRKVSFFGSLKKMFFSEIGA |
| Ga0316603_112651462 | 3300033413 | Soil | LRLDPLERPQSVFALQRAIRDIPPKKRKLTLLGSLKRRLGSESGA |
| Ga0316625_1025181711 | 3300033418 | Soil | PLERPQSIFALQKAIRDIPPKRRKLTFFDNLKRRLFTEIGA |
| Ga0316601_1020482692 | 3300033419 | Soil | LRLDPLERPQSVFALQKAIRDIAPKRRKATVFGALKRKLFTEIGT |
| Ga0316627_1027392902 | 3300033482 | Soil | SVFALQKAIRDIAPKRRKATVFGTLKRKLFTEIGT |
| Ga0316624_120430162 | 3300033486 | Soil | LERPQSIFALQRAIRDIPPPKRKLTFFGNLKRLLFSEIGA |
| Ga0316616_1002649913 | 3300033521 | Soil | CLRLDPLERPQSVFALQKAIRDLPPKKRKHTFLGNLKRKLWTEIGA |
| Ga0247830_103475261 | 3300033551 | Soil | RLDPLERPQSVFALQKAIREIPQVKRKLTLLGSLKKMLFSEVGA |
| Ga0316617_1025455492 | 3300033557 | Soil | LRLDPLERPQSVFALQKAIRDLPPRKRRLTVLGNVKRRLFSEIGAG |
| Ga0314867_162891_400_522 | 3300033808 | Peatland | PLERPQSVFALQKAIREIPPRKRKLTFFNNLKRKLFSEVV |
| Ga0314872_016051_1_123 | 3300033810 | Peatland | LERPQSVFALQKAIRDIPPKRRKPTFLGNLKRKLFTEIGA |
| Ga0370489_0211692_3_131 | 3300034127 | Untreated Peat Soil | DPLERPQSVFALQKAIRDIPQTKHKVSFFGSLKKMLFSEIGA |
| Ga0364931_0130384_1_111 | 3300034176 | Sediment | PQSVFALQKTIRDIPPRKRKLTFLDSLKKKLFSEVM |
| ⦗Top⦘ |