| Basic Information | |
|---|---|
| Family ID | F027266 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 195 |
| Average Sequence Length | 45 residues |
| Representative Sequence | LSEITDAHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQLQVV |
| Number of Associated Samples | 153 |
| Number of Associated Scaffolds | 195 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.51 % |
| % of genes near scaffold ends (potentially truncated) | 99.49 % |
| % of genes from short scaffolds (< 2000 bps) | 94.36 % |
| Associated GOLD sequencing projects | 146 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.462 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.718 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.282 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.744 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.84% β-sheet: 0.00% Coil/Unstructured: 51.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 195 Family Scaffolds |
|---|---|---|
| PF02563 | Poly_export | 44.10 |
| PF01370 | Epimerase | 6.67 |
| PF10531 | SLBB | 6.15 |
| PF13344 | Hydrolase_6 | 1.03 |
| PF04392 | ABC_sub_bind | 0.51 |
| PF09557 | DUF2382 | 0.51 |
| PF03372 | Exo_endo_phos | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 195 Family Scaffolds |
|---|---|---|---|
| COG1596 | Periplasmic protein Wza involved in polysaccharide export, contains SLBB domain of the beta-grasp fold | Cell wall/membrane/envelope biogenesis [M] | 44.10 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.46 % |
| Unclassified | root | N/A | 1.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_118559894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300001545|JGI12630J15595_10064999 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 720 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100010808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 7430 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100054735 | All Organisms → cellular organisms → Bacteria | 3640 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10106378 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1119 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10120825 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1050 | Open in IMG/M |
| 3300004080|Ga0062385_11021559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 556 | Open in IMG/M |
| 3300004082|Ga0062384_101073858 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
| 3300004091|Ga0062387_100478684 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 863 | Open in IMG/M |
| 3300004091|Ga0062387_101473913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 545 | Open in IMG/M |
| 3300004152|Ga0062386_101270460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 612 | Open in IMG/M |
| 3300004156|Ga0062589_102634340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300004463|Ga0063356_100502836 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1603 | Open in IMG/M |
| 3300004643|Ga0062591_102910663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300005171|Ga0066677_10473735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 718 | Open in IMG/M |
| 3300005184|Ga0066671_10263678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1066 | Open in IMG/M |
| 3300005335|Ga0070666_11028812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
| 3300005338|Ga0068868_100343580 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1277 | Open in IMG/M |
| 3300005534|Ga0070735_10604972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 650 | Open in IMG/M |
| 3300005542|Ga0070732_10429376 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 798 | Open in IMG/M |
| 3300005549|Ga0070704_101896964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300005575|Ga0066702_10809223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 558 | Open in IMG/M |
| 3300005598|Ga0066706_11431264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300005602|Ga0070762_10167521 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1326 | Open in IMG/M |
| 3300005614|Ga0068856_101527037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 681 | Open in IMG/M |
| 3300005713|Ga0066905_101803651 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 564 | Open in IMG/M |
| 3300005764|Ga0066903_100405011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2247 | Open in IMG/M |
| 3300005764|Ga0066903_103169151 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 890 | Open in IMG/M |
| 3300005764|Ga0066903_103658880 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 827 | Open in IMG/M |
| 3300005764|Ga0066903_106086669 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
| 3300006175|Ga0070712_100520129 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 999 | Open in IMG/M |
| 3300009038|Ga0099829_10671183 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 861 | Open in IMG/M |
| 3300009089|Ga0099828_11032771 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 732 | Open in IMG/M |
| 3300009090|Ga0099827_11856346 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
| 3300009137|Ga0066709_104237419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300009143|Ga0099792_10704030 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
| 3300009177|Ga0105248_11214313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 853 | Open in IMG/M |
| 3300009792|Ga0126374_10717504 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 754 | Open in IMG/M |
| 3300009792|Ga0126374_11463499 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
| 3300009792|Ga0126374_11888911 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 502 | Open in IMG/M |
| 3300010040|Ga0126308_10425233 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 889 | Open in IMG/M |
| 3300010040|Ga0126308_10495361 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 825 | Open in IMG/M |
| 3300010042|Ga0126314_11279304 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300010044|Ga0126310_10334058 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1056 | Open in IMG/M |
| 3300010046|Ga0126384_10021413 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4181 | Open in IMG/M |
| 3300010047|Ga0126382_10739134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 831 | Open in IMG/M |
| 3300010048|Ga0126373_10365913 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1458 | Open in IMG/M |
| 3300010048|Ga0126373_10638205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1120 | Open in IMG/M |
| 3300010048|Ga0126373_11322335 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 787 | Open in IMG/M |
| 3300010048|Ga0126373_11946393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 651 | Open in IMG/M |
| 3300010147|Ga0126319_1162172 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 642 | Open in IMG/M |
| 3300010359|Ga0126376_12576092 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 557 | Open in IMG/M |
| 3300010362|Ga0126377_11956468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 662 | Open in IMG/M |
| 3300010371|Ga0134125_12651150 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 545 | Open in IMG/M |
| 3300011332|Ga0126317_10608922 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 652 | Open in IMG/M |
| 3300011440|Ga0137433_1293924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300012096|Ga0137389_11391393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300012181|Ga0153922_1021017 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1481 | Open in IMG/M |
| 3300012212|Ga0150985_101594749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300012212|Ga0150985_107334611 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 865 | Open in IMG/M |
| 3300012212|Ga0150985_111058316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300012364|Ga0134027_1132624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300012469|Ga0150984_116719061 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 890 | Open in IMG/M |
| 3300012917|Ga0137395_10438071 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 938 | Open in IMG/M |
| 3300012917|Ga0137395_11253469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300012923|Ga0137359_10398249 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1221 | Open in IMG/M |
| 3300012925|Ga0137419_10036607 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3059 | Open in IMG/M |
| 3300012927|Ga0137416_11410793 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
| 3300012971|Ga0126369_10283027 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1650 | Open in IMG/M |
| 3300013308|Ga0157375_12399601 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 629 | Open in IMG/M |
| 3300013308|Ga0157375_13109185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300016270|Ga0182036_11571344 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 553 | Open in IMG/M |
| 3300016294|Ga0182041_11389708 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 644 | Open in IMG/M |
| 3300016319|Ga0182033_10221728 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1518 | Open in IMG/M |
| 3300016341|Ga0182035_11031601 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 730 | Open in IMG/M |
| 3300016371|Ga0182034_10007014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6098 | Open in IMG/M |
| 3300016371|Ga0182034_11012757 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 718 | Open in IMG/M |
| 3300016404|Ga0182037_10006942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6355 | Open in IMG/M |
| 3300016422|Ga0182039_10718746 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 882 | Open in IMG/M |
| 3300016422|Ga0182039_11713758 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
| 3300017970|Ga0187783_10136829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1806 | Open in IMG/M |
| 3300018466|Ga0190268_11945656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300018468|Ga0066662_11524378 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 696 | Open in IMG/M |
| 3300019377|Ga0190264_11489611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300020170|Ga0179594_10191809 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 764 | Open in IMG/M |
| 3300020579|Ga0210407_10078692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2482 | Open in IMG/M |
| 3300020580|Ga0210403_10191934 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1675 | Open in IMG/M |
| 3300020581|Ga0210399_10547691 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 960 | Open in IMG/M |
| 3300020583|Ga0210401_10497383 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1082 | Open in IMG/M |
| 3300021168|Ga0210406_10232630 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1518 | Open in IMG/M |
| 3300021178|Ga0210408_10517296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 948 | Open in IMG/M |
| 3300021180|Ga0210396_10971178 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 721 | Open in IMG/M |
| 3300021362|Ga0213882_10138987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 993 | Open in IMG/M |
| 3300021372|Ga0213877_10132984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 777 | Open in IMG/M |
| 3300021401|Ga0210393_11584143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300021404|Ga0210389_10873470 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 701 | Open in IMG/M |
| 3300021405|Ga0210387_11736621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300021406|Ga0210386_10554151 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 993 | Open in IMG/M |
| 3300021432|Ga0210384_10227899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1677 | Open in IMG/M |
| 3300021432|Ga0210384_11512919 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300021476|Ga0187846_10021380 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2995 | Open in IMG/M |
| 3300021478|Ga0210402_10448900 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1198 | Open in IMG/M |
| 3300021560|Ga0126371_12521934 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 622 | Open in IMG/M |
| 3300022506|Ga0242648_1003532 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1460 | Open in IMG/M |
| 3300022557|Ga0212123_10879330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300025916|Ga0207663_10160512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1586 | Open in IMG/M |
| 3300025916|Ga0207663_10991742 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
| 3300025929|Ga0207664_10232134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1604 | Open in IMG/M |
| 3300025929|Ga0207664_10469671 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1124 | Open in IMG/M |
| 3300025941|Ga0207711_10843614 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 853 | Open in IMG/M |
| 3300026095|Ga0207676_11488464 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
| 3300026547|Ga0209156_10131597 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1221 | Open in IMG/M |
| 3300026557|Ga0179587_10507152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 792 | Open in IMG/M |
| 3300026557|Ga0179587_11054669 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300026998|Ga0208369_1026054 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
| 3300027565|Ga0209219_1034983 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1251 | Open in IMG/M |
| 3300027576|Ga0209003_1059373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 691 | Open in IMG/M |
| 3300027669|Ga0208981_1015483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1937 | Open in IMG/M |
| 3300027680|Ga0207826_1138880 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 664 | Open in IMG/M |
| 3300027725|Ga0209178_1139478 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 831 | Open in IMG/M |
| 3300027815|Ga0209726_10117690 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1558 | Open in IMG/M |
| 3300027882|Ga0209590_10194709 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1279 | Open in IMG/M |
| 3300027894|Ga0209068_10677253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300027968|Ga0209061_1042457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1964 | Open in IMG/M |
| 3300028536|Ga0137415_10944787 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 673 | Open in IMG/M |
| 3300028906|Ga0308309_10741579 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 853 | Open in IMG/M |
| 3300030738|Ga0265462_11180915 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 681 | Open in IMG/M |
| 3300030740|Ga0265460_12790012 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
| 3300031057|Ga0170834_107424717 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 650 | Open in IMG/M |
| 3300031236|Ga0302324_101304619 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 958 | Open in IMG/M |
| 3300031545|Ga0318541_10053269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2083 | Open in IMG/M |
| 3300031546|Ga0318538_10735069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300031561|Ga0318528_10435731 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 704 | Open in IMG/M |
| 3300031561|Ga0318528_10475052 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 671 | Open in IMG/M |
| 3300031573|Ga0310915_10291535 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1152 | Open in IMG/M |
| 3300031573|Ga0310915_10978043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300031640|Ga0318555_10815187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300031670|Ga0307374_10246107 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1203 | Open in IMG/M |
| 3300031670|Ga0307374_10344069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 904 | Open in IMG/M |
| 3300031679|Ga0318561_10090583 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1596 | Open in IMG/M |
| 3300031681|Ga0318572_10094250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1681 | Open in IMG/M |
| 3300031708|Ga0310686_100614587 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 640 | Open in IMG/M |
| 3300031708|Ga0310686_106766714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300031715|Ga0307476_10886292 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 659 | Open in IMG/M |
| 3300031715|Ga0307476_11404758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300031744|Ga0306918_10177848 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1591 | Open in IMG/M |
| 3300031744|Ga0306918_10240134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1380 | Open in IMG/M |
| 3300031751|Ga0318494_10732102 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
| 3300031753|Ga0307477_10207334 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1363 | Open in IMG/M |
| 3300031753|Ga0307477_10935755 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 571 | Open in IMG/M |
| 3300031754|Ga0307475_11104050 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
| 3300031768|Ga0318509_10113021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1474 | Open in IMG/M |
| 3300031771|Ga0318546_10535031 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 823 | Open in IMG/M |
| 3300031771|Ga0318546_11103197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300031778|Ga0318498_10177546 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 968 | Open in IMG/M |
| 3300031781|Ga0318547_10453600 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 790 | Open in IMG/M |
| 3300031782|Ga0318552_10107922 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1379 | Open in IMG/M |
| 3300031819|Ga0318568_10319533 | Not Available | 965 | Open in IMG/M |
| 3300031833|Ga0310917_10113451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1757 | Open in IMG/M |
| 3300031846|Ga0318512_10265167 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 850 | Open in IMG/M |
| 3300031860|Ga0318495_10327852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 679 | Open in IMG/M |
| 3300031879|Ga0306919_10171141 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1598 | Open in IMG/M |
| 3300031879|Ga0306919_10566659 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 876 | Open in IMG/M |
| 3300031890|Ga0306925_10497533 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1299 | Open in IMG/M |
| 3300031890|Ga0306925_10916770 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 900 | Open in IMG/M |
| 3300031893|Ga0318536_10420011 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
| 3300031894|Ga0318522_10404056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300031896|Ga0318551_10095223 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1578 | Open in IMG/M |
| 3300031910|Ga0306923_10778457 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1058 | Open in IMG/M |
| 3300031910|Ga0306923_10915234 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 959 | Open in IMG/M |
| 3300031910|Ga0306923_11655493 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 663 | Open in IMG/M |
| 3300031941|Ga0310912_11541583 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
| 3300031942|Ga0310916_11655185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300031947|Ga0310909_10046814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3302 | Open in IMG/M |
| 3300031947|Ga0310909_10193745 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1687 | Open in IMG/M |
| 3300031947|Ga0310909_10539683 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 977 | Open in IMG/M |
| 3300031947|Ga0310909_11313195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 581 | Open in IMG/M |
| 3300031962|Ga0307479_10295113 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1602 | Open in IMG/M |
| 3300032035|Ga0310911_10379964 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 817 | Open in IMG/M |
| 3300032059|Ga0318533_11036122 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300032059|Ga0318533_11215878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300032063|Ga0318504_10060496 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1618 | Open in IMG/M |
| 3300032068|Ga0318553_10271022 | Not Available | 887 | Open in IMG/M |
| 3300032076|Ga0306924_10760490 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1083 | Open in IMG/M |
| 3300032076|Ga0306924_10868088 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1001 | Open in IMG/M |
| 3300032076|Ga0306924_12582350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300032094|Ga0318540_10122246 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1236 | Open in IMG/M |
| 3300032094|Ga0318540_10164023 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1066 | Open in IMG/M |
| 3300032174|Ga0307470_11719049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300032180|Ga0307471_101255504 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 904 | Open in IMG/M |
| 3300032261|Ga0306920_102287513 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 749 | Open in IMG/M |
| 3300033158|Ga0335077_10683668 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1059 | Open in IMG/M |
| 3300033289|Ga0310914_10353413 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1329 | Open in IMG/M |
| 3300033289|Ga0310914_10661183 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 939 | Open in IMG/M |
| 3300033290|Ga0318519_10414462 | Not Available | 803 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.28% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.62% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.10% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.08% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.05% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.05% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.05% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.54% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.54% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.03% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.03% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.03% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.03% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.03% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.03% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.03% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.51% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.51% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.51% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.51% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.51% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.51% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.51% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.51% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.51% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.51% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.51% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.51% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.51% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012181 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaG | Host-Associated | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026998 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF046 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027968 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1185598942 | 3300000956 | Soil | IRAIRPPRNEKGWLDPTGWMGVYAARMIATAVQVV* |
| JGI12630J15595_100649991 | 3300001545 | Forest Soil | EFDPPRPIGDLSEITDAHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQFQVV* |
| JGIcombinedJ26739_1000108081 | 3300002245 | Forest Soil | WSTEFDPPRPIGDLSEITDAHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQFQVV* |
| JGIcombinedJ26739_1000547355 | 3300002245 | Forest Soil | EITDAHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQFQVV* |
| JGIcombinedJ51221_101063781 | 3300003505 | Forest Soil | LSEITDAHIRAIRPPRNEQGWLDPTGWMGVYASRLIATQLQLV* |
| JGIcombinedJ51221_101208252 | 3300003505 | Forest Soil | TDAHIRAIRPPRNEKGWLDPSGWMGVYASRVIATQFQRV* |
| Ga0062385_110215592 | 3300004080 | Bog Forest Soil | PQLLNDLSEITDAHIRAIQPPRNEKGWLDPIGWMGVYAARMIATPVQVV* |
| Ga0062384_1010738581 | 3300004082 | Bog Forest Soil | GLSEITDAHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQLQVV* |
| Ga0062387_1004786842 | 3300004091 | Bog Forest Soil | SPRPIGGLAEITDAHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQLQVV* |
| Ga0062387_1014739132 | 3300004091 | Bog Forest Soil | TEVDPPRAIDDLCEITDAHIRAIQPPRNEKGWLDPTGWMGVYASRTISTELQVV* |
| Ga0062386_1012704602 | 3300004152 | Bog Forest Soil | PPRPINDLSEITDAHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQLQVV* |
| Ga0062589_1026343401 | 3300004156 | Soil | TIADLSEITDAHIRAIRPPRNEKGWLDPNGWMGVYAARMIATAVQVV* |
| Ga0063356_1005028361 | 3300004463 | Arabidopsis Thaliana Rhizosphere | PQVIGDLSEITDAHIRAIRPPRNEEGWLDPIGWMGVYTGRMIATAVQVV* |
| Ga0062591_1029106632 | 3300004643 | Soil | ITDAHIRAIRPPRNEKGWLDPIGWMGVYAGRMIATAVQVV* |
| Ga0066677_104737352 | 3300005171 | Soil | INDLSEITDAHIRAIQPPRNEKGWLDPIGWMGVYTARMIATAVQVV* |
| Ga0066671_102636783 | 3300005184 | Soil | NDLSEITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQFQLI* |
| Ga0070666_110288121 | 3300005335 | Switchgrass Rhizosphere | EVTDAHIRAIHPPRNEKGWLDPAGWMGVYASRMIATAMQVV* |
| Ga0068868_1003435802 | 3300005338 | Miscanthus Rhizosphere | ITDLSEITDAHIRAIRPPRNEKGWLDPVGWMGVYAARMIATAVQVV* |
| Ga0070735_106049721 | 3300005534 | Surface Soil | RPIDDLCEITDAHIRAIQPPRNEKGWLDPTGWMGVYTSRTIATELQVV* |
| Ga0070732_104293761 | 3300005542 | Surface Soil | ADLSEITDAHIRAIRPPRNEKGWLDPIGWMGVYATRMIATALQVV* |
| Ga0070704_1018969642 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | PRTITDLSEITDAHIRAIRPPRNEKGWLDPVGWMGVYAARMIATAVQVV* |
| Ga0066702_108092231 | 3300005575 | Soil | FWSTEGDPPRVINDLSEITDAHIRAIHPPRNEKGWLDPTGWMGVYTTRLIATAVQVV* |
| Ga0066706_114312641 | 3300005598 | Soil | EITDAHIRAIHPPRNEKGWLDPTGWMGVYTTRLIATAVQVV* |
| Ga0070762_101675211 | 3300005602 | Soil | SEITDAHIRAIRPPRNEKGWLDPSGWMGVYASRVIATQFQRV* |
| Ga0068856_1015270371 | 3300005614 | Corn Rhizosphere | RAIEPPRNEKGWLDPTGWMGVYATRLIATAVQVV* |
| Ga0066905_1018036512 | 3300005713 | Tropical Forest Soil | DAHIRAIRPPRNEKGWLDPTGWMGVYAARMIATAVQVV* |
| Ga0066903_1004050111 | 3300005764 | Tropical Forest Soil | IRAIRPPRDERGWLDPAGWMGVYAARLIATQLQVV* |
| Ga0066903_1031691511 | 3300005764 | Tropical Forest Soil | TEFDPPRSIRDLSEITDAHIRAIRPPRNEEGWLDPTGWMGVYASRLIATQFQLV* |
| Ga0066903_1036588801 | 3300005764 | Tropical Forest Soil | AHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQLQVI* |
| Ga0066903_1060866692 | 3300005764 | Tropical Forest Soil | HIRAIRPPRNEKGWLDPSGWMGVYASRLIATQLQVV* |
| Ga0070712_1005201292 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RPRPINDLSEITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQLQLV* |
| Ga0099829_106711831 | 3300009038 | Vadose Zone Soil | GSPQLINDLSEITDAHIRAIQPPRNEKGWLDPIGWMGVYAARMIATAVQVV* |
| Ga0099828_110327711 | 3300009089 | Vadose Zone Soil | TDAHIRAIQPPRNEKGWLDPIGWTGVYAARMIATAVQVV* |
| Ga0099827_118563461 | 3300009090 | Vadose Zone Soil | RAIQPPRNEKGWLDPIGWMGVYAARMIATAVQVV* |
| Ga0066709_1042374191 | 3300009137 | Grasslands Soil | RPINDLSEITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQFQLI* |
| Ga0099792_107040301 | 3300009143 | Vadose Zone Soil | INDLSEITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQLQLV* |
| Ga0105248_112143132 | 3300009177 | Switchgrass Rhizosphere | DAHIRAIHPPRNEKGWLDPAGWMGVYASRMIATAMQVV* |
| Ga0126374_107175042 | 3300009792 | Tropical Forest Soil | HIRAIRPPRNEKGWLDPTGWMGVYASRMIATPFQLV* |
| Ga0126374_114634991 | 3300009792 | Tropical Forest Soil | IRAIRPPRNEKGWLDPIGWMGVYATRLIATAVQVV* |
| Ga0126374_118889111 | 3300009792 | Tropical Forest Soil | RPIGGLSEITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATELQVV* |
| Ga0126308_104252332 | 3300010040 | Serpentine Soil | NELSEITDAHIRAIHPPRNEKGWLDPSGWMGVYASRMIATEVQVV* |
| Ga0126308_104953612 | 3300010040 | Serpentine Soil | EITDAHIRAIRPPRDEKGWLDPTGWMGVYAARMISTAVQVV* |
| Ga0126314_112793041 | 3300010042 | Serpentine Soil | LINELSEITDAHIRAIHPPRNEKGWLDPSGWMGVYASRMIATAVQVV* |
| Ga0126310_103340582 | 3300010044 | Serpentine Soil | IRAIHPPRNEKGWLDPSGWMGVYASRMIATAVQVV* |
| Ga0126384_100214135 | 3300010046 | Tropical Forest Soil | STEFDPPRQIGGLSEITDAHIRAIRPPRNEKGWLDPTGWMGVYTSRLIATQLQVV* |
| Ga0126382_107391342 | 3300010047 | Tropical Forest Soil | IKDLSEITDAHIRAIRPPRNEKGWLDPTGWMGVYASRMIATPFQLV* |
| Ga0126373_103659131 | 3300010048 | Tropical Forest Soil | TDAHIRAIRPPRNEEGWLDPTGWMGVYASRLIATQFQLV* |
| Ga0126373_106382053 | 3300010048 | Tropical Forest Soil | AHIRAIQPPRNEAGWLDPSGWSGVYAARTIATELQVV* |
| Ga0126373_113223351 | 3300010048 | Tropical Forest Soil | SEITDAHIRAIRPPRNEKGWLDPMGWMGVYASRLIATQLQVI* |
| Ga0126373_119463932 | 3300010048 | Tropical Forest Soil | SEITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQLQVL* |
| Ga0126319_11621722 | 3300010147 | Soil | SPRVINDLSEITDAHIRAIRPPRNEKGWLDPTGWMGVYTARLIATAVQVV* |
| Ga0126376_125760922 | 3300010359 | Tropical Forest Soil | AHIRAIRPPRNEKGWLDPNGWMGVYASRMIATQLQIV* |
| Ga0126377_119564682 | 3300010362 | Tropical Forest Soil | KDLSEITDAHIRAIQPPRNEKGWLDPAGWMGVYASRLIATQLQVV* |
| Ga0134125_126511502 | 3300010371 | Terrestrial Soil | LCEITDAHIRSIQPPRDEEGWLDPTGWMGVYAARMIATELQVV* |
| Ga0126317_106089221 | 3300011332 | Soil | LSEITDAHIRAIRPPRNEKGWLDPIGWMGIYAARMIATAVQVV* |
| Ga0137433_12939241 | 3300011440 | Soil | RAIQPPRNEKGWLDPIGWMGVYATRMIATAVQVV* |
| Ga0137389_113913932 | 3300012096 | Vadose Zone Soil | PRPIKDLSEITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQLQVV* |
| Ga0153922_10210172 | 3300012181 | Attine Ant Fungus Gardens | DPPRLIGELSEITDAHIRAIHPPRNEKGWLDPSGWMGVYASRMIATAVQVV* |
| Ga0150985_1015947492 | 3300012212 | Avena Fatua Rhizosphere | FWSTEGDPPRVINDLSEITDAHIRAICPPRNEKGWLDPIGWMGVYAARMIATAVQVV* |
| Ga0150985_1073346112 | 3300012212 | Avena Fatua Rhizosphere | EITDAHIRAIRPPRNEKGWLDPIGWMGVYAARMIATAVQVV* |
| Ga0150985_1110583161 | 3300012212 | Avena Fatua Rhizosphere | LSEITDAHIRAIRPPRNEKGWLDPIGWMGVYAARMIATAV* |
| Ga0134027_11326242 | 3300012364 | Grasslands Soil | DQPRPIGDLSEITDAHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQFRNAHG* |
| Ga0150984_1167190612 | 3300012469 | Avena Fatua Rhizosphere | PPRAINDLSEITDAHIRAIRPPRNEKGWLDPIGWMGVYAARMIATAVQVV* |
| Ga0137395_104380711 | 3300012917 | Vadose Zone Soil | TEFDPPRPINDLSEITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQFQRV* |
| Ga0137395_112534691 | 3300012917 | Vadose Zone Soil | IGDLSEITDAHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQFQVV* |
| Ga0137359_103982491 | 3300012923 | Vadose Zone Soil | TEGDPPRVINDLSEITDAHIRAIQPPRNEKGWLDPIGWMGVYTARMIATAVQVV* |
| Ga0137419_100366074 | 3300012925 | Vadose Zone Soil | AHIRAIRPPRNEKGWLDPTGWMGVYTTRLIATAVQVV* |
| Ga0137416_114107931 | 3300012927 | Vadose Zone Soil | PPQLINDLSEITDAHIRAIQPPLNEKGWLDPIGWMGVYAARMIATAVQVV* |
| Ga0126369_102830271 | 3300012971 | Tropical Forest Soil | TEFDPPRAIKDLSEITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQFQLV* |
| Ga0157375_123996011 | 3300013308 | Miscanthus Rhizosphere | DLSEITDAHIRAIRPPRNEKGWLDPIGWMGVYAARMIATAVQVV* |
| Ga0157375_131091851 | 3300013308 | Miscanthus Rhizosphere | PPRAIADLSEITDAHIRAIRPPRNEKGWLDPIGWMGVYAGRMIATAVQVV* |
| Ga0182036_115713441 | 3300016270 | Soil | AHIRAIRPPRNEKGWLDPNGWMGVYASRVIAPQFQRV |
| Ga0182041_113897082 | 3300016294 | Soil | SPRPIGGLSEITDAHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQLQVV |
| Ga0182033_102217281 | 3300016319 | Soil | DAHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQLQVV |
| Ga0182035_110316011 | 3300016341 | Soil | LIGGLAEITDAHIRAIRPPRDESGWLDPVGWRGVYTSRLIATQLQVV |
| Ga0182034_100070141 | 3300016371 | Soil | DSPRPIGGLAEITDAHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQLQVV |
| Ga0182034_110127572 | 3300016371 | Soil | LSEITDAHIRAIRPPRDEKGWLDPAGWMGVYASRLIATQLQVV |
| Ga0182037_100069421 | 3300016404 | Soil | EITDAHIRAIRPPRNEKGWLDPAGWMGVYAARLIATQLQVV |
| Ga0182039_107187462 | 3300016422 | Soil | TEFDPPRPIKDVSEITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQLQVI |
| Ga0182039_117137582 | 3300016422 | Soil | SEITDAHIRAIRPPRDEKGWLDPAGWMGVYASRLIATQLQVV |
| Ga0187783_101368291 | 3300017970 | Tropical Peatland | ITDAHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQLQVV |
| Ga0190268_119456561 | 3300018466 | Soil | HIRAIRPPRNEKGWLDPSGWMGVYAARMIATAVQVV |
| Ga0066662_115243781 | 3300018468 | Grasslands Soil | HIRAIRPPRNEKGWLDPTGWMGVYASRLIATQFQLI |
| Ga0190264_114896111 | 3300019377 | Soil | TEGDPPRAIGDLSEITDAHIRAIRPPRNEKGWLDPSGWMGVYAARMIATAVQVV |
| Ga0179594_101918092 | 3300020170 | Vadose Zone Soil | PIGDLSEITDAHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQFQVV |
| Ga0210407_100786924 | 3300020579 | Soil | RPINDLSEITDAHIRAIRPPRNEQGWLDPTGWMGVYASRLIATQLQLV |
| Ga0210403_101919341 | 3300020580 | Soil | FWSTEFDRPRPINDLSEITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQLQLV |
| Ga0210399_105476912 | 3300020581 | Soil | TEFDPPRPIGGLSEITDAHIRAIRPPRDEKGWLDRAGWMGVYASRLIATQLQVV |
| Ga0210401_104973832 | 3300020583 | Soil | AHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQFQVV |
| Ga0210406_102326302 | 3300021168 | Soil | ITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQFQLV |
| Ga0210408_105172962 | 3300021178 | Soil | EFDPPRQIKDLSEITDAHIRAISPPRNEKGWLDPTGWMGVYASRLIAMQLQVVSPYP |
| Ga0210396_109711782 | 3300021180 | Soil | NDLSEITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQFQRV |
| Ga0213882_101389872 | 3300021362 | Exposed Rock | PIDDLCEITDAHIRAIEPPGNEEGWLDPTGWMGVYASRTIATEMQVI |
| Ga0213877_101329842 | 3300021372 | Bulk Soil | RPINDLSEITDAHIRAIRPPRNEKGWLDPIGWMGVYASRLIATQFQLV |
| Ga0210393_115841431 | 3300021401 | Soil | PRAIDDLSEITDAHIRAIEPPHNEEGWLDPTGWMGVYASRTIATELQVV |
| Ga0210389_108734701 | 3300021404 | Soil | LSEITDAHIRAIRPPRNEKGWLDPNGWMGVYASRVIATQFQRV |
| Ga0210387_117366212 | 3300021405 | Soil | RPINDLAEITDAHIRAIRPPRNEKGWLDPNGWMGVYASRLIATQFQLV |
| Ga0210386_105541512 | 3300021406 | Soil | PNNDLAEITDAHIRAIRPPRNEKGWLDPNGWMGVYASRLIATQFQLV |
| Ga0210384_102278991 | 3300021432 | Soil | FDPPRQIKDLSEITDAHIRAIHPPRNEKGWLDPTGWMGVYASRLIATQFQLV |
| Ga0210384_115129192 | 3300021432 | Soil | HIRAIRPPRNEKGWLDPTGWMGVYASRLIATQLQLV |
| Ga0187846_100213801 | 3300021476 | Biofilm | TDAHIRAICPPRNEKGWLDPAGWMGVYASRLIATQLQVV |
| Ga0210402_104489001 | 3300021478 | Soil | RPPRNEKGWLDPTGWMGVYASRLIATQLQVVSPYP |
| Ga0126371_125219341 | 3300021560 | Tropical Forest Soil | RLIGGLAEITDAHIRAIRPPRDESGWLDPVGWRGVYASRLIATQLQVV |
| Ga0242648_10035322 | 3300022506 | Soil | DAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQLQLV |
| Ga0212123_108793301 | 3300022557 | Iron-Sulfur Acid Spring | TEGDPPQLLNDLSEITDAHIRAIQPPRNEKGWLDPIGWMGVYAARMIATAVQVV |
| Ga0207663_101605123 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | EITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQLQLV |
| Ga0207663_109917422 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | INDLSEIMDAHIRAIRPPRNEKGWLDPTGWMGVYASRMIATQFQLV |
| Ga0207664_102321341 | 3300025929 | Agricultural Soil | AHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQFQLV |
| Ga0207664_104696711 | 3300025929 | Agricultural Soil | FDRPRPINDLSEITDAHIRAIRPPRNEKGWLDPTGWMGVYASRMIATQFQLV |
| Ga0207711_108436142 | 3300025941 | Switchgrass Rhizosphere | DAHIRAIHPPRNEKGWLDPAGWMGVYASRMIATAMQVV |
| Ga0207676_114884642 | 3300026095 | Switchgrass Rhizosphere | IRAIRPPRNEKGWLDPIGWMGVYAARMIATAVQVV |
| Ga0209156_101315971 | 3300026547 | Soil | NEISEITDAHIRAIHPPSNEKGWLDPSGWMGVYASRMIATAVQVV |
| Ga0179587_105071521 | 3300026557 | Vadose Zone Soil | WSTEFDPPRPIGDLSEITDAHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQFQVV |
| Ga0179587_110546691 | 3300026557 | Vadose Zone Soil | IRAIQPPRNEKGWLDPIGWMGVYAARMIATAVQVV |
| Ga0208369_10260542 | 3300026998 | Forest Soil | INDLSEITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQLQLV |
| Ga0209219_10349831 | 3300027565 | Forest Soil | INDLSEITDAHIRAIQPPRNEKGWLDPIGWMGVYTARMIATAVQVV |
| Ga0209003_10593733 | 3300027576 | Forest Soil | LLDPPRPIGGLSEITDAHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQLQVV |
| Ga0208981_10154831 | 3300027669 | Forest Soil | PPRVINDLSEITDAHIRAIRPPRNEKGWLDPTGWMGVYTTRLIATAVQVV |
| Ga0207826_11388802 | 3300027680 | Tropical Forest Soil | PPRPISGLSEITDAHIRAIRPPRNEKGWLDPAGWMGVYTSRLIATQLQVV |
| Ga0209178_11394781 | 3300027725 | Agricultural Soil | HIRAIEPPRNEKGWLDPTGWMGVYATRLIATAVQVV |
| Ga0209726_101176901 | 3300027815 | Groundwater | EGDPPRLIGDISEITDAHIRAIHPPRNEKGWLDPAGWMGVYASRLIATAVQVV |
| Ga0209590_101947091 | 3300027882 | Vadose Zone Soil | ITDAHIRAIQPPRNEKGWLDPIGWMGVYAARMIATAVQVV |
| Ga0209068_106772531 | 3300027894 | Watersheds | FDPPRPIGDLAEITDAHIRAIRPPRNEKGWLDPIGWMGVYAARMIATAVQVV |
| Ga0209061_10424573 | 3300027968 | Surface Soil | LAEITNAHIRAIRPPRNEKGWLDPAGWWGIYASRVIATQLQVV |
| Ga0137415_109447872 | 3300028536 | Vadose Zone Soil | INDLSEITDAHIRAIQPPRNEKGWLDPAGWMGVYTARMIATAVQVV |
| Ga0308309_107415792 | 3300028906 | Soil | FWSTEGDPPRVINDLSEITDAHIRAIQPPRNEKGWLDPIGWMGVYTARMIATAVQVV |
| Ga0265462_111809151 | 3300030738 | Soil | TEFDPPHPIEDLSEITNAHIRAIRPPRNEKGWLDRAGWMGVYASRLIAAQLQIV |
| Ga0265460_127900121 | 3300030740 | Soil | HIRAIQPPRNEKGWLDPTGWMGVYASRTIATELQVV |
| Ga0170834_1074247172 | 3300031057 | Forest Soil | GDPPQLLNDLSEITDAHIRAIQPPRNEKGWLDPIGWMGVYAARMIATAVQVV |
| Ga0302324_1013046191 | 3300031236 | Palsa | CEITDAHIRAIQPPRNEKGWLDPTGWMGVYAARTIATELQVV |
| Ga0318541_100532691 | 3300031545 | Soil | IRAIRPPRNEKGWLDPAGWMGVYASRLIATQLQVV |
| Ga0318538_107350691 | 3300031546 | Soil | RPIKDVSEITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQLQVI |
| Ga0318528_104357311 | 3300031561 | Soil | EITDAHIRAIRPPRNEKGWLDPNGWMGVYASRLIATQLQVV |
| Ga0318528_104750522 | 3300031561 | Soil | NDLSEITDAHIRAIHPPRNEKGWLDPTGWMGVYASRLIASQLQLV |
| Ga0310915_102915352 | 3300031573 | Soil | ITDAHIRAIRPPRDEKGWLDPAGWMGVYASRLIATQLQVV |
| Ga0310915_109780432 | 3300031573 | Soil | EFDPPRPIKDVSEITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQLQVI |
| Ga0318555_108151871 | 3300031640 | Soil | EITDAHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQLQVV |
| Ga0307374_102461072 | 3300031670 | Soil | IRHLSEITDAHIRAIRPPRNEKGWLDPTGWMGVYAARMIATALQVV |
| Ga0307374_103440692 | 3300031670 | Soil | IRAIQPPRNEKGWLDPAGWMGIYASRLIATALQVV |
| Ga0318561_100905833 | 3300031679 | Soil | AHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQLQVV |
| Ga0318572_100942501 | 3300031681 | Soil | HIRAIRPPRNEKGWLDPAGWMGVYASRLIATQLQVV |
| Ga0310686_1006145871 | 3300031708 | Soil | DPPRPIGDLSEITDAHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQLQVV |
| Ga0310686_1067667142 | 3300031708 | Soil | PIEDLSEITNAHIRAIRPPRNEKGWLDRTGWMGVYASRLIAAQLQIV |
| Ga0307476_108862921 | 3300031715 | Hardwood Forest Soil | DDLREITDAHIRAIQPPRNEKGWLDPTGWMGVYASRTIATELQVV |
| Ga0307476_114047582 | 3300031715 | Hardwood Forest Soil | DPPRPINDLSEITDAHIRAIRPPRNEKGWLDPNGWMGVYASRVIATQFQRV |
| Ga0306918_101778483 | 3300031744 | Soil | LAEITDAHIRAIRPPRNEKGWLDPAGWMGVYAARLIATQLQVV |
| Ga0306918_102401342 | 3300031744 | Soil | SEITESHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQFQRV |
| Ga0318494_107321022 | 3300031751 | Soil | HIRAIRPPRNEKGWLDPTGWMGVYASRLIATQLQVV |
| Ga0307477_102073342 | 3300031753 | Hardwood Forest Soil | STEFDPPRPIGDLSEITDAHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQLQVV |
| Ga0307477_109357552 | 3300031753 | Hardwood Forest Soil | DPPRAIDDLCEITDAHIRAIQPPRNEKGWLDPTGWMGVYAARTIATELQVV |
| Ga0307475_111040501 | 3300031754 | Hardwood Forest Soil | LSEITDAHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQLQVV |
| Ga0318509_101130212 | 3300031768 | Soil | PRPIGGLCEITDAHIRAIRPPRDEKGWLDPAGWMGVYASRLIATQLQVV |
| Ga0318546_105350311 | 3300031771 | Soil | FWSTEFDPPRAIKDLSEITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQFQLV |
| Ga0318546_111031972 | 3300031771 | Soil | AHIRAIRPPRNEKGWLDPNGWMGVYASRMIAAQLQIV |
| Ga0318498_101775462 | 3300031778 | Soil | IKDVSEITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQLQVL |
| Ga0318547_104536001 | 3300031781 | Soil | IRAIRPPRNEKGWLDPTGWMGVYASRLIATQLQVV |
| Ga0318552_101079222 | 3300031782 | Soil | DLSEITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQFQLV |
| Ga0318568_103195331 | 3300031819 | Soil | IRDLSEITNAHIRAIRPPRNEEGWLDPAGWMGVYASRMIATQLQIV |
| Ga0310917_101134511 | 3300031833 | Soil | HIRAIRPPRDEKGWLDPAGWMGVYAARLIATQLQVV |
| Ga0318512_102651672 | 3300031846 | Soil | HIRAIRPPRNEKGWLDPTGWMGVYASRLIATELQVV |
| Ga0318495_103278521 | 3300031860 | Soil | AHIRAIRPPRNEKGWLDPTGWMGVYASRLIATELQVV |
| Ga0306919_101711411 | 3300031879 | Soil | PIGGLSEITDAHIRAIRPPRNEKGWLDPNGWMGVYASRLIATQLQVV |
| Ga0306919_105666591 | 3300031879 | Soil | DPPRAINDLSEITDAHIRAIHPPRNEKGWLDPTGWMGVYASRLIASQLQLV |
| Ga0306925_104975331 | 3300031890 | Soil | EITDAHIRAIRPPRDEKGWLDRAGWMGVYASRLIATQLQVV |
| Ga0306925_109167702 | 3300031890 | Soil | ITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQFQRV |
| Ga0318536_104200112 | 3300031893 | Soil | AEITDAHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQLQVV |
| Ga0318522_104040561 | 3300031894 | Soil | RPIKDLSEITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQLQVV |
| Ga0318551_100952233 | 3300031896 | Soil | KDLSEITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQLQVV |
| Ga0306923_107784571 | 3300031910 | Soil | EFDPPRPIGGLSEITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQLQVV |
| Ga0306923_109152341 | 3300031910 | Soil | DAHIRAIRPPRDEKGWLDPAGWMGVYASRLIATQLQVV |
| Ga0306923_116554931 | 3300031910 | Soil | TEFDSPRSIKDLSEITDAHIRAIRPPRNEEGWLDPTGWMGVYASRLIATQFQVV |
| Ga0310912_115415832 | 3300031941 | Soil | ITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQLQVV |
| Ga0310916_116551852 | 3300031942 | Soil | STEFDPPRPIGGLSEITDAHIRAIRPPRDEKGWLDPAGWMGVYASRLIATQLQVV |
| Ga0310909_100468144 | 3300031947 | Soil | LAEITDAHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQLQVV |
| Ga0310909_101937451 | 3300031947 | Soil | TDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQLQVI |
| Ga0310909_105396832 | 3300031947 | Soil | PRQIGDLAEITDAHIRAIRPPRNEKGWLDPAGWMGVYAARLIATQLQVV |
| Ga0310909_113131952 | 3300031947 | Soil | HIRAIRPPRDEKGWLDPAGWMGVYASRLIATQLQVV |
| Ga0307479_102951131 | 3300031962 | Hardwood Forest Soil | STEFDPPRPINDLSEITDAHIRAIRPPRNEKGWLDPNGWMGVYASRVIATQFQRV |
| Ga0310911_103799642 | 3300032035 | Soil | TEFDPPRPISDLSVITDAHIRAICPPRNEKGWLDPIGWMGVYASRLIAIQLQIV |
| Ga0318533_110361221 | 3300032059 | Soil | STEFDSPRPIGGLAEITDAHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQLQVV |
| Ga0318533_112158782 | 3300032059 | Soil | DPPRPIGGLSEITDAHIRAIRPPRDEKGWLDRAGWMGVYASRLIATQLQVV |
| Ga0318504_100604963 | 3300032063 | Soil | IGGLSEITDAHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQLQVV |
| Ga0318553_102710221 | 3300032068 | Soil | ITNAHIRAIRPPRNEGGWLDPAGWMGVYASRMIATQLQIV |
| Ga0306924_107604901 | 3300032076 | Soil | FDPPRPIGGLSEITDAHIRAIRPPRNEKGWLDPNGWMGVYASRLIATQLQVV |
| Ga0306924_108680881 | 3300032076 | Soil | PRLIGGLAEITDAHIRAIRPPRDESGWLDPVGWRGVYTSRLIATQLQVV |
| Ga0306924_125823501 | 3300032076 | Soil | WSTEFDPPRAINDLSEITDAHIRAIHPPRNEKGWLDPTGWMGVYASRLIASQLQLV |
| Ga0318540_101222462 | 3300032094 | Soil | SPRPIKDLSEITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQLQVV |
| Ga0318540_101640231 | 3300032094 | Soil | SEITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQLQVV |
| Ga0307470_117190492 | 3300032174 | Hardwood Forest Soil | ITEAHIRAIRPPRTEKGWLDPAGWMGVYASRLIATQFQVV |
| Ga0307471_1012555041 | 3300032180 | Hardwood Forest Soil | EFDPPRPIGDLSEITDAHIRAIRPPRNEKGWLDPAGWMGVYASRLIATQFQVV |
| Ga0306920_1022875132 | 3300032261 | Soil | PRAINDLSEITDAHIRAIHPPRNEKGWLDPTGWMGVYASRLIASQLQLV |
| Ga0335077_106836682 | 3300033158 | Soil | IRAIRPPRDEKGWLDPAGWMGVYASRLIATQLQVV |
| Ga0310914_103534132 | 3300033289 | Soil | RAINDLSEITDAHIRAIHPPRNEKGWLDPTGWMGVYASRLIASQLQLV |
| Ga0310914_106611832 | 3300033289 | Soil | PPRAIKDLSEITDAHIRAIRPPRNEKGWLDPTGWMGVYASRLIATQFQLV |
| Ga0318519_104144621 | 3300033290 | Soil | PHPIRDLSEITNAHIRAIRPPRNEGGWLDPAGWMGVYASRMIATQLQIV |
| ⦗Top⦘ |