| Basic Information | |
|---|---|
| Family ID | F027243 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 195 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MKKTKRSPVSTLTHTTREVAIHFLAWREKQKQKSMIGHNGGPK |
| Number of Associated Samples | 146 |
| Number of Associated Scaffolds | 195 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 71.79 % |
| % of genes near scaffold ends (potentially truncated) | 25.13 % |
| % of genes from short scaffolds (< 2000 bps) | 65.13 % |
| Associated GOLD sequencing projects | 137 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (44.103 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (17.436 % of family members) |
| Environment Ontology (ENVO) | Unclassified (62.051 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.769 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.76% β-sheet: 0.00% Coil/Unstructured: 73.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 195 Family Scaffolds |
|---|---|---|
| PF07486 | Hydrolase_2 | 7.69 |
| PF03721 | UDPG_MGDP_dh_N | 4.10 |
| PF00462 | Glutaredoxin | 3.08 |
| PF08804 | gp32 | 2.56 |
| PF05226 | CHASE2 | 2.05 |
| PF00578 | AhpC-TSA | 2.05 |
| PF14743 | DNA_ligase_OB_2 | 2.05 |
| PF03767 | Acid_phosphat_B | 1.54 |
| PF06714 | Gp5_OB | 1.03 |
| PF01592 | NifU_N | 1.03 |
| PF13640 | 2OG-FeII_Oxy_3 | 1.03 |
| PF03567 | Sulfotransfer_2 | 1.03 |
| PF04055 | Radical_SAM | 1.03 |
| PF04965 | GPW_gp25 | 1.03 |
| PF09293 | RNaseH_C | 0.51 |
| PF00011 | HSP20 | 0.51 |
| PF08994 | T4_Gp59_C | 0.51 |
| PF00211 | Guanylate_cyc | 0.51 |
| PF16075 | DUF4815 | 0.51 |
| PF01370 | Epimerase | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 195 Family Scaffolds |
|---|---|---|---|
| COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 7.69 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 4.10 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 4.10 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 4.10 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 4.10 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 4.10 |
| COG4252 | Extracytoplasmic sensor domain CHASE2 (specificity unknown) | Signal transduction mechanisms [T] | 2.05 |
| COG2503 | Predicted secreted acid phosphatase | General function prediction only [R] | 1.54 |
| COG3700 | Acid phosphatase, class B | Inorganic ion transport and metabolism [P] | 1.54 |
| COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 1.03 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.51 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.90 % |
| Unclassified | root | N/A | 44.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10025184 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED181 | 3007 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10119747 | Not Available | 923 | Open in IMG/M |
| 3300000159|LPaug08P2610mDRAFT_c1001319 | All Organisms → Viruses → Predicted Viral | 4664 | Open in IMG/M |
| 3300000254|SI34jun09_100mDRAFT_1036046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 915 | Open in IMG/M |
| 3300000265|LP_A_09_P04_10DRAFT_1036306 | Not Available | 791 | Open in IMG/M |
| 3300000929|NpDRAFT_10040600 | All Organisms → cellular organisms → Bacteria | 7405 | Open in IMG/M |
| 3300000947|BBAY92_10042266 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1243 | Open in IMG/M |
| 3300001346|JGI20151J14362_10029490 | All Organisms → Viruses → Predicted Viral | 2692 | Open in IMG/M |
| 3300001450|JGI24006J15134_10000295 | All Organisms → cellular organisms → Bacteria | 32944 | Open in IMG/M |
| 3300001450|JGI24006J15134_10060611 | Not Available | 1497 | Open in IMG/M |
| 3300001460|JGI24003J15210_10002374 | Not Available | 8280 | Open in IMG/M |
| 3300001954|GOS2235_1048691 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 1495 | Open in IMG/M |
| 3300003478|JGI26238J51125_1067210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 706 | Open in IMG/M |
| 3300004097|Ga0055584_100902433 | Not Available | 925 | Open in IMG/M |
| 3300004097|Ga0055584_102454946 | Not Available | 527 | Open in IMG/M |
| 3300004457|Ga0066224_1017610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1598 | Open in IMG/M |
| 3300004457|Ga0066224_1118797 | Not Available | 575 | Open in IMG/M |
| 3300004460|Ga0066222_1350571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1174 | Open in IMG/M |
| 3300004460|Ga0066222_1433909 | Not Available | 506 | Open in IMG/M |
| 3300005510|Ga0066825_10111701 | Not Available | 997 | Open in IMG/M |
| 3300005738|Ga0076926_114566 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4308 | Open in IMG/M |
| 3300005837|Ga0078893_10176473 | Not Available | 510 | Open in IMG/M |
| 3300005837|Ga0078893_10301004 | All Organisms → Viruses → Predicted Viral | 1622 | Open in IMG/M |
| 3300005837|Ga0078893_11470570 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 715 | Open in IMG/M |
| 3300005941|Ga0070743_10000371 | All Organisms → cellular organisms → Bacteria | 17887 | Open in IMG/M |
| 3300005941|Ga0070743_10051869 | All Organisms → Viruses → Predicted Viral | 1397 | Open in IMG/M |
| 3300006191|Ga0075447_10011847 | All Organisms → Viruses → Predicted Viral | 3593 | Open in IMG/M |
| 3300006403|Ga0075514_1783901 | Not Available | 820 | Open in IMG/M |
| 3300006737|Ga0098037_1090117 | Not Available | 1069 | Open in IMG/M |
| 3300006737|Ga0098037_1108413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Mammaliicoccus → Mammaliicoccus sciuri | 957 | Open in IMG/M |
| 3300006749|Ga0098042_1115752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 671 | Open in IMG/M |
| 3300006752|Ga0098048_1008563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 3731 | Open in IMG/M |
| 3300006789|Ga0098054_1013920 | All Organisms → cellular organisms → Bacteria | 3277 | Open in IMG/M |
| 3300006874|Ga0075475_10268781 | Not Available | 711 | Open in IMG/M |
| 3300006916|Ga0070750_10182523 | Not Available | 937 | Open in IMG/M |
| 3300006922|Ga0098045_1007791 | Not Available | 3143 | Open in IMG/M |
| 3300006924|Ga0098051_1110929 | Not Available | 733 | Open in IMG/M |
| 3300006990|Ga0098046_1128279 | Not Available | 551 | Open in IMG/M |
| 3300007623|Ga0102948_1218191 | Not Available | 580 | Open in IMG/M |
| 3300007647|Ga0102855_1010924 | All Organisms → Viruses → Predicted Viral | 2527 | Open in IMG/M |
| 3300007647|Ga0102855_1029558 | Not Available | 1506 | Open in IMG/M |
| 3300007725|Ga0102951_1020570 | All Organisms → Viruses → Predicted Viral | 2089 | Open in IMG/M |
| 3300007778|Ga0102954_1002942 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10 | 4993 | Open in IMG/M |
| 3300008012|Ga0075480_10192212 | Not Available | 1084 | Open in IMG/M |
| 3300008964|Ga0102889_1141243 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300009001|Ga0102963_1040292 | Not Available | 1941 | Open in IMG/M |
| 3300009024|Ga0102811_1248840 | Not Available | 664 | Open in IMG/M |
| 3300009071|Ga0115566_10131986 | All Organisms → Viruses → Predicted Viral | 1576 | Open in IMG/M |
| 3300009071|Ga0115566_10362980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 841 | Open in IMG/M |
| 3300009077|Ga0115552_1385251 | Not Available | 554 | Open in IMG/M |
| 3300009172|Ga0114995_10538063 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED181 | 638 | Open in IMG/M |
| 3300009420|Ga0114994_10017251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 5102 | Open in IMG/M |
| 3300009422|Ga0114998_10375858 | Not Available | 664 | Open in IMG/M |
| 3300009423|Ga0115548_1115404 | Not Available | 865 | Open in IMG/M |
| 3300009428|Ga0114915_1048027 | All Organisms → Viruses → Predicted Viral | 1387 | Open in IMG/M |
| 3300009449|Ga0115558_1391211 | Not Available | 544 | Open in IMG/M |
| 3300009497|Ga0115569_10376706 | Not Available | 614 | Open in IMG/M |
| 3300009505|Ga0115564_10465148 | Not Available | 612 | Open in IMG/M |
| 3300009507|Ga0115572_10683296 | Not Available | 560 | Open in IMG/M |
| 3300009550|Ga0115013_10000284 | All Organisms → cellular organisms → Bacteria | 32382 | Open in IMG/M |
| 3300009593|Ga0115011_10008396 | All Organisms → Viruses | 6899 | Open in IMG/M |
| 3300009593|Ga0115011_10022445 | All Organisms → Viruses → Predicted Viral | 4217 | Open in IMG/M |
| 3300009677|Ga0115104_10773428 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED181 | 897 | Open in IMG/M |
| 3300009677|Ga0115104_10821290 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300009785|Ga0115001_10016956 | All Organisms → Viruses → Predicted Viral | 4898 | Open in IMG/M |
| 3300009785|Ga0115001_10332465 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED181 | 959 | Open in IMG/M |
| 3300010149|Ga0098049_1014610 | All Organisms → cellular organisms → Bacteria | 2625 | Open in IMG/M |
| 3300010150|Ga0098056_1178729 | Not Available | 712 | Open in IMG/M |
| 3300012919|Ga0160422_10305830 | Not Available | 979 | Open in IMG/M |
| 3300012920|Ga0160423_10006085 | All Organisms → cellular organisms → Bacteria | 9797 | Open in IMG/M |
| 3300012920|Ga0160423_10342731 | All Organisms → Viruses → Predicted Viral | 1026 | Open in IMG/M |
| 3300012920|Ga0160423_10866467 | Not Available | 606 | Open in IMG/M |
| 3300012928|Ga0163110_10646121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 821 | Open in IMG/M |
| 3300012936|Ga0163109_10017987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5239 | Open in IMG/M |
| 3300012953|Ga0163179_11291583 | Not Available | 649 | Open in IMG/M |
| 3300012954|Ga0163111_10550323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1071 | Open in IMG/M |
| 3300012954|Ga0163111_11384857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 692 | Open in IMG/M |
| 3300016776|Ga0182046_1183642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Megasphaera → Megasphaera massiliensis | 571 | Open in IMG/M |
| 3300017706|Ga0181377_1001061 | All Organisms → cellular organisms → Bacteria | 9255 | Open in IMG/M |
| 3300017706|Ga0181377_1004619 | All Organisms → Viruses → Predicted Viral | 3761 | Open in IMG/M |
| 3300017706|Ga0181377_1024240 | Not Available | 1303 | Open in IMG/M |
| 3300017720|Ga0181383_1215450 | Not Available | 508 | Open in IMG/M |
| 3300017727|Ga0181401_1017031 | All Organisms → Viruses → Predicted Viral | 2215 | Open in IMG/M |
| 3300017730|Ga0181417_1163693 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED181 | 536 | Open in IMG/M |
| 3300017735|Ga0181431_1012522 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 2017 | Open in IMG/M |
| 3300017768|Ga0187220_1087007 | Not Available | 943 | Open in IMG/M |
| 3300017771|Ga0181425_1243197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED247 | 557 | Open in IMG/M |
| 3300017776|Ga0181394_1078520 | Not Available | 1074 | Open in IMG/M |
| 3300017776|Ga0181394_1116558 | Not Available | 845 | Open in IMG/M |
| 3300017779|Ga0181395_1245588 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED181 | 548 | Open in IMG/M |
| 3300017782|Ga0181380_1000524 | Not Available | 17130 | Open in IMG/M |
| 3300017786|Ga0181424_10029867 | All Organisms → Viruses → Predicted Viral | 2365 | Open in IMG/M |
| 3300017818|Ga0181565_10390602 | Not Available | 920 | Open in IMG/M |
| 3300017818|Ga0181565_10410205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 892 | Open in IMG/M |
| 3300017818|Ga0181565_10458612 | Not Available | 833 | Open in IMG/M |
| 3300017824|Ga0181552_10001172 | All Organisms → cellular organisms → Bacteria | 19922 | Open in IMG/M |
| 3300017824|Ga0181552_10555499 | Not Available | 537 | Open in IMG/M |
| 3300017967|Ga0181590_10400559 | Not Available | 975 | Open in IMG/M |
| 3300017968|Ga0181587_10664210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Paracoccus → Paracoccus versutus | 661 | Open in IMG/M |
| 3300017985|Ga0181576_10892658 | Not Available | 521 | Open in IMG/M |
| 3300018048|Ga0181606_10245155 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 1016 | Open in IMG/M |
| 3300018410|Ga0181561_10373947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 651 | Open in IMG/M |
| 3300018413|Ga0181560_10013200 | All Organisms → cellular organisms → Bacteria | 6456 | Open in IMG/M |
| 3300018413|Ga0181560_10309586 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 738 | Open in IMG/M |
| 3300018417|Ga0181558_10446881 | Not Available | 679 | Open in IMG/M |
| 3300019751|Ga0194029_1039452 | Not Available | 762 | Open in IMG/M |
| 3300020051|Ga0181555_1326576 | Not Available | 524 | Open in IMG/M |
| 3300020052|Ga0181554_1352273 | Not Available | 533 | Open in IMG/M |
| 3300020185|Ga0206131_10017431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194 | 6110 | Open in IMG/M |
| 3300020185|Ga0206131_10019643 | All Organisms → cellular organisms → Bacteria | 5614 | Open in IMG/M |
| 3300020185|Ga0206131_10035134 | All Organisms → Viruses → Predicted Viral | 3667 | Open in IMG/M |
| 3300020245|Ga0211711_1010822 | Not Available | 1595 | Open in IMG/M |
| 3300020266|Ga0211519_1038578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 982 | Open in IMG/M |
| 3300020282|Ga0211667_1025315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1544 | Open in IMG/M |
| 3300020336|Ga0211510_1011802 | All Organisms → Viruses → Predicted Viral | 2359 | Open in IMG/M |
| 3300020385|Ga0211677_10397624 | Not Available | 535 | Open in IMG/M |
| 3300020394|Ga0211497_10187751 | Not Available | 794 | Open in IMG/M |
| 3300020400|Ga0211636_10092015 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1234 | Open in IMG/M |
| 3300020404|Ga0211659_10033671 | Not Available | 2470 | Open in IMG/M |
| 3300020411|Ga0211587_10050231 | Not Available | 1906 | Open in IMG/M |
| 3300020420|Ga0211580_10407494 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 553 | Open in IMG/M |
| 3300020437|Ga0211539_10204885 | Not Available | 810 | Open in IMG/M |
| 3300020438|Ga0211576_10000236 | All Organisms → cellular organisms → Bacteria | 48763 | Open in IMG/M |
| 3300020438|Ga0211576_10004035 | All Organisms → cellular organisms → Bacteria | 10123 | Open in IMG/M |
| 3300020438|Ga0211576_10016838 | All Organisms → Viruses → Predicted Viral | 4493 | Open in IMG/M |
| 3300020438|Ga0211576_10046396 | All Organisms → Viruses → Predicted Viral | 2500 | Open in IMG/M |
| 3300020438|Ga0211576_10117854 | All Organisms → Viruses → Predicted Viral | 1455 | Open in IMG/M |
| 3300020438|Ga0211576_10334384 | Not Available | 782 | Open in IMG/M |
| 3300020442|Ga0211559_10023940 | Not Available | 3074 | Open in IMG/M |
| 3300020448|Ga0211638_10561336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED247 | 537 | Open in IMG/M |
| 3300020450|Ga0211641_10214579 | Not Available | 955 | Open in IMG/M |
| 3300020452|Ga0211545_10200723 | Not Available | 921 | Open in IMG/M |
| 3300020463|Ga0211676_10040704 | Not Available | 3393 | Open in IMG/M |
| 3300020463|Ga0211676_10061400 | All Organisms → cellular organisms → Bacteria | 2612 | Open in IMG/M |
| 3300020463|Ga0211676_10530477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED247 | 617 | Open in IMG/M |
| 3300020469|Ga0211577_10052545 | All Organisms → Viruses → Predicted Viral | 2965 | Open in IMG/M |
| 3300020469|Ga0211577_10689188 | Not Available | 600 | Open in IMG/M |
| 3300021085|Ga0206677_10006008 | All Organisms → cellular organisms → Bacteria | 9391 | Open in IMG/M |
| 3300021085|Ga0206677_10042901 | Not Available | 2413 | Open in IMG/M |
| 3300021185|Ga0206682_10000019 | All Organisms → cellular organisms → Bacteria | 128059 | Open in IMG/M |
| 3300021185|Ga0206682_10013839 | Not Available | 5484 | Open in IMG/M |
| 3300021335|Ga0213867_1218708 | Not Available | 626 | Open in IMG/M |
| 3300021356|Ga0213858_10211870 | Not Available | 939 | Open in IMG/M |
| 3300021364|Ga0213859_10143668 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1123 | Open in IMG/M |
| 3300021364|Ga0213859_10403292 | Not Available | 605 | Open in IMG/M |
| 3300021371|Ga0213863_10047603 | Not Available | 2245 | Open in IMG/M |
| 3300021373|Ga0213865_10008725 | All Organisms → cellular organisms → Bacteria | 5878 | Open in IMG/M |
| 3300021375|Ga0213869_10003151 | All Organisms → cellular organisms → Bacteria | 11066 | Open in IMG/M |
| 3300021375|Ga0213869_10010062 | Not Available | 5694 | Open in IMG/M |
| 3300021375|Ga0213869_10322847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 652 | Open in IMG/M |
| 3300021378|Ga0213861_10208948 | All Organisms → Viruses → Predicted Viral | 1058 | Open in IMG/M |
| 3300021957|Ga0222717_10005918 | All Organisms → cellular organisms → Bacteria | 8810 | Open in IMG/M |
| 3300021957|Ga0222717_10102864 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 1784 | Open in IMG/M |
| 3300021957|Ga0222717_10289168 | Not Available | 939 | Open in IMG/M |
| 3300021958|Ga0222718_10000585 | All Organisms → cellular organisms → Bacteria | 37307 | Open in IMG/M |
| 3300021958|Ga0222718_10054484 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED181 | 2520 | Open in IMG/M |
| 3300021958|Ga0222718_10397612 | Not Available | 689 | Open in IMG/M |
| 3300022921|Ga0255765_1161522 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 1045 | Open in IMG/M |
| 3300022934|Ga0255781_10282767 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 761 | Open in IMG/M |
| 3300024248|Ga0228676_1010800 | All Organisms → Viruses → Predicted Viral | 2101 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10103261 | All Organisms → Viruses → Predicted Viral | 1297 | Open in IMG/M |
| 3300024346|Ga0244775_10260388 | All Organisms → Viruses → Predicted Viral | 1444 | Open in IMG/M |
| 3300024346|Ga0244775_10974429 | Not Available | 670 | Open in IMG/M |
| 3300024348|Ga0244776_10063189 | All Organisms → cellular organisms → Bacteria | 2846 | Open in IMG/M |
| 3300025070|Ga0208667_1001470 | All Organisms → cellular organisms → Bacteria | 8584 | Open in IMG/M |
| 3300025070|Ga0208667_1008582 | All Organisms → cellular organisms → Bacteria | 2461 | Open in IMG/M |
| 3300025101|Ga0208159_1104391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 500 | Open in IMG/M |
| 3300025137|Ga0209336_10002325 | All Organisms → cellular organisms → Bacteria | 9044 | Open in IMG/M |
| 3300025137|Ga0209336_10041144 | Not Available | 1485 | Open in IMG/M |
| 3300025138|Ga0209634_1000532 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 29591 | Open in IMG/M |
| 3300025151|Ga0209645_1046225 | Not Available | 1544 | Open in IMG/M |
| 3300025276|Ga0208814_1000695 | Not Available | 18524 | Open in IMG/M |
| 3300025626|Ga0209716_1084749 | Not Available | 936 | Open in IMG/M |
| 3300025658|Ga0209659_1194019 | Not Available | 574 | Open in IMG/M |
| 3300025699|Ga0209715_1058558 | All Organisms → Viruses → Predicted Viral | 1600 | Open in IMG/M |
| 3300025699|Ga0209715_1083817 | All Organisms → Viruses → Predicted Viral | 1226 | Open in IMG/M |
| 3300025767|Ga0209137_1125763 | All Organisms → Viruses | 974 | Open in IMG/M |
| 3300025870|Ga0209666_1161582 | Not Available | 1004 | Open in IMG/M |
| 3300026138|Ga0209951_1077716 | Not Available | 693 | Open in IMG/M |
| 3300026187|Ga0209929_1122585 | Not Available | 655 | Open in IMG/M |
| 3300027686|Ga0209071_1017903 | Not Available | 2271 | Open in IMG/M |
| 3300027751|Ga0208304_10056291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194 | 1522 | Open in IMG/M |
| 3300027813|Ga0209090_10135395 | All Organisms → Viruses → Predicted Viral | 1311 | Open in IMG/M |
| 3300027906|Ga0209404_10011882 | All Organisms → cellular organisms → Bacteria | 4765 | Open in IMG/M |
| 3300028189|Ga0257127_1004261 | Not Available | 7655 | Open in IMG/M |
| 3300028189|Ga0257127_1057492 | All Organisms → Viruses → Predicted Viral | 1256 | Open in IMG/M |
| 3300031141|Ga0308021_10132299 | Not Available | 988 | Open in IMG/M |
| 3300031519|Ga0307488_10109062 | All Organisms → Viruses → Predicted Viral | 2004 | Open in IMG/M |
| 3300031519|Ga0307488_10838092 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300031599|Ga0308007_10289511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 546 | Open in IMG/M |
| 3300031608|Ga0307999_1000001 | Not Available | 66662 | Open in IMG/M |
| 3300031630|Ga0308004_10359636 | Not Available | 548 | Open in IMG/M |
| 3300031687|Ga0308008_1000459 | Not Available | 16514 | Open in IMG/M |
| 3300031694|Ga0308015_10354644 | Not Available | 591 | Open in IMG/M |
| 3300031785|Ga0310343_10792165 | Not Available | 712 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 17.44% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 15.38% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 9.23% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 5.64% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 5.64% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.64% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 3.59% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.59% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 3.08% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.08% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.08% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.05% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.05% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.05% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.05% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 1.54% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.54% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.54% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.54% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 1.54% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.03% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.03% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 1.03% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.03% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.03% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.51% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.51% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.51% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.51% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.51% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.51% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000159 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2008 P26 10m | Environmental | Open in IMG/M |
| 3300000254 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 100m | Environmental | Open in IMG/M |
| 3300000265 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10 | Environmental | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001954 | Marine microbial communities from Colon, Panama - GS019 | Environmental | Open in IMG/M |
| 3300003478 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005510 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45 | Environmental | Open in IMG/M |
| 3300005738 | Seawater microbial communities from Vineyard Sound, MA, USA - sterilised with crude oil T0 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006403 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007623 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008964 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300016776 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300020051 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020052 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011503CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020245 | Marine microbial communities from Tara Oceans - TARA_B100000459 (ERX556111-ERR599135) | Environmental | Open in IMG/M |
| 3300020266 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX556082-ERR598951) | Environmental | Open in IMG/M |
| 3300020282 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX556074-ERR599169) | Environmental | Open in IMG/M |
| 3300020336 | Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289008-ERR315860) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020394 | Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026) | Environmental | Open in IMG/M |
| 3300020400 | Marine microbial communities from Tara Oceans - TARA_B100001115 (ERX555947-ERR598992) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
| 3300020420 | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) | Environmental | Open in IMG/M |
| 3300020437 | Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020448 | Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954) | Environmental | Open in IMG/M |
| 3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
| 3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300022921 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG | Environmental | Open in IMG/M |
| 3300022934 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG | Environmental | Open in IMG/M |
| 3300024248 | Seawater microbial communities from Monterey Bay, California, United States - 48D_r | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025658 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025699 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes) | Environmental | Open in IMG/M |
| 3300025767 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027686 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028189 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_135m | Environmental | Open in IMG/M |
| 3300031141 | Marine microbial communities from water near the shore, Antarctic Ocean - #351 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031599 | Marine microbial communities from water near the shore, Antarctic Ocean - #71 | Environmental | Open in IMG/M |
| 3300031608 | Marine microbial communities from water near the shore, Antarctic Ocean - #1 | Environmental | Open in IMG/M |
| 3300031630 | Marine microbial communities from water near the shore, Antarctic Ocean - #38 | Environmental | Open in IMG/M |
| 3300031687 | Marine microbial communities from water near the shore, Antarctic Ocean - #125 | Environmental | Open in IMG/M |
| 3300031694 | Marine microbial communities from water near the shore, Antarctic Ocean - #231 | Environmental | Open in IMG/M |
| 3300031785 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_100251842 | 3300000117 | Marine | MKKIKRSPVSTLTHSTREVAIHFLAWREAQKNKSMIGHNGGPK* |
| DelMOWin2010_101197472 | 3300000117 | Marine | MKKIKRSPVSTLTHSTREVAIHFLAWREKQKQKSMIGHNGGPK* |
| LPaug08P2610mDRAFT_10013196 | 3300000159 | Marine | MKVKIKKPVSTLTHTTKEVALHFLKWREQQKKNSLIGHNGGPK* |
| SI34jun09_100mDRAFT_10360461 | 3300000254 | Marine | MDGVQVMKKTKRNPVSTLTHTTKEVAIHFLAWREAQKNKSMIGHNGGPKS* |
| LP_A_09_P04_10DRAFT_10363062 | 3300000265 | Marine | MKKSKRSPVSTLTHTTREVAIHFLAWREKQNLKSSMIGHNGGPK* |
| NpDRAFT_1004060013 | 3300000929 | Freshwater And Marine | MKKTIRRPVSTLTHTSREVAIHFLAWREKQKEKTMIGHNGGPK* |
| BBAY92_100422662 | 3300000947 | Macroalgal Surface | MKNKKRRPVSTLTHTSREVAIDFLRWREEQKKKSMIGHNGGPK* |
| JGI20151J14362_100294909 | 3300001346 | Pelagic Marine | MKKTKRQSVSTLTHTTREVAIHFLAWREKQKQKSMIGHNGGPK* |
| JGI24006J15134_1000029526 | 3300001450 | Marine | MKKTKRSPVSTLTHTTREVAIHFLAWREKQKAKTMIGHNGGPK* |
| JGI24006J15134_100606115 | 3300001450 | Marine | MKKTKRSPVSTLTHSTKEVAIHFLAWREKLKDQSMIGHNGGPK* |
| JGI24003J15210_100023745 | 3300001460 | Marine | MKKVKIKKPVSTLTHTTREVAEHFLKWREQQKLNSLIGHNGGPK* |
| GOS2235_10486911 | 3300001954 | Marine | MKKAKIKRPVSTLTHTTKEVALDFLRWREEQKKKSLIGHNGGPSL* |
| JGI26238J51125_10672103 | 3300003478 | Marine | MKKTKRNPVSTLTHTTKEVAIHFLAWREAQKNKSMIGHNGGPKS* |
| Ga0055584_1009024332 | 3300004097 | Pelagic Marine | MKKLKSPVSTLTHTTREVALHFLKWREQQKKNSLIGHNGGPKI* |
| Ga0055584_1024549462 | 3300004097 | Pelagic Marine | MKKTKRSPVSTLTHSTREVAIHFLAWREKLRNQSMIGHNGGPK* |
| Ga0066224_10176104 | 3300004457 | Marine | MKVKFKKPVSTLTHTTREVALHFLKWREQQKKNSLIGHNGGPKI* |
| Ga0066224_11187971 | 3300004457 | Marine | MKVKFKKPVSTLTHTTREVAIHFLAWREKQKQKTMIGHNGGPK* |
| Ga0066222_13505712 | 3300004460 | Marine | MWSINMKVKFKKPVSTLTHTTREVALHFLKWREQQKKNSLIGHNGGPKI* |
| Ga0066222_14339092 | 3300004460 | Marine | MKKTKRSPVSTLTHTTREVAIHFLAWREAQKNHSMIGHNGGP |
| Ga0066825_101117012 | 3300005510 | Marine | MKIRKMKRPVSTLTHTTREVAEHFLKWREQQKKKSLIGHNGGPSL* |
| Ga0076926_1145668 | 3300005738 | Marine | MKNKKRRPVSTLTHTTREVALDFLRWKKEQQEKSMIGHNGGPK* |
| Ga0078893_101764731 | 3300005837 | Marine Surface Water | MKIKKMKRPVSTLTHTTREVAEHFLKWREQQKKKSLIGHNGGPSL* |
| Ga0078893_103010044 | 3300005837 | Marine Surface Water | MKNQKRRPVSTLTHTTREVAIHFLAWREKQKQKSMIGHNGGPK* |
| Ga0078893_114705703 | 3300005837 | Marine Surface Water | MKKVKIKSPVSTLTHTTREVAEHFLKWREQQKKNSLIGHNGGPSL* |
| Ga0070743_100003717 | 3300005941 | Estuarine | MKKSKRSPVSTLTHTTREVAIHFLAWREKQNAKSSMIGHNGGPK* |
| Ga0070743_100518695 | 3300005941 | Estuarine | MKVKKPVSTLTHTTKEVALHFLKWREQQKKNSLIGHNGGPK* |
| Ga0075447_100118475 | 3300006191 | Marine | MVTQGINMKKVKVKTPVSTLTHSTREVALDFLRWRESKKKKSLIGHNGGPSL* |
| Ga0075514_17839013 | 3300006403 | Aqueous | MKKTKRSPVSTLTHSSREVAIHFLAWREKLRNQSMIGHNGGPK* |
| Ga0098037_10901175 | 3300006737 | Marine | MNRVKRHPVSTLTHTTREVALDFLRWKKEQKQKSMIGHNGGPK* |
| Ga0098037_11084133 | 3300006737 | Marine | MKKVKIKRPVSTLTHTTREVAEHFLKWREQQKKNSLIGHNGGPSI* |
| Ga0098042_11157522 | 3300006749 | Marine | MKQNKKRRPVSTLTHTTREVAIDFLRWREEQKQKSLIGHNGGPK* |
| Ga0098048_10085631 | 3300006752 | Marine | MKKTKRSPVSTLTHSTREVAIHFLAWREKLRNQSLIGHNGGPK* |
| Ga0098054_10139204 | 3300006789 | Marine | LGTKKIKRPVSTLTHSTKEVALHFLKWREQQKKNSLIGHNGGPSL* |
| Ga0075475_102687811 | 3300006874 | Aqueous | MIRIYYEKTKRSPVSTLTHSSREVAIHFLAWREKLRNQSMIGHNGGPK* |
| Ga0070750_101825233 | 3300006916 | Aqueous | VKKLKSPVSTLTHTTREVALHFLKWREQQKKNSLIGHNGGPKI* |
| Ga0098045_10077914 | 3300006922 | Marine | MKKTKRSPVSTLTHSTREVAIHFLAWREKQKQKTMIGHNGGPK* |
| Ga0098051_11109293 | 3300006924 | Marine | MKIKTRKPVSTLTHTTKEVALHFLKWREQQKKNSLIGHNGGPK* |
| Ga0098046_11282791 | 3300006990 | Marine | RQSVSTLTHTTREVAIHFLAWREKQKQKTMIGHNGGPK* |
| Ga0102948_12181912 | 3300007623 | Water | MKKSNRRPVSTLTHTTREVAIHFLAWREKQKQKSMIGHNGGPK* |
| Ga0102855_10109247 | 3300007647 | Estuarine | MKKTKRQSVSTLTHTTREVAIHFLAWREALKNKSMIGHNGGPK* |
| Ga0102855_10295585 | 3300007647 | Estuarine | MKKTKRSPVSTLTHSTKEVAIHFLAWREKLKEQSMIGHNGGPK* |
| Ga0102951_10205705 | 3300007725 | Water | MKKLKRSPVSTLTHSTREVAIHFLAWREKQKQKSMIGHNGGPK* |
| Ga0102954_10029429 | 3300007778 | Water | MKKTKRSPVSTLTHTTREVAIHFLAWREKLRNQSMIGHNGGPK* |
| Ga0075480_101922121 | 3300008012 | Aqueous | MKKTKRQSVSTLTHTTREVAIHFLAWREAQKNKSMIGHNGGPK* |
| Ga0102889_11412431 | 3300008964 | Estuarine | VSTLTHTTKEVAIHFLAWREAQKNKSMIGHNGGPKS* |
| Ga0102963_10402923 | 3300009001 | Pond Water | MNRSKKKPVSTLTHTTREVAIHFLAWREALKNKSMIGHNGGPK* |
| Ga0102811_12488402 | 3300009024 | Estuarine | MKKTKRSPVSTLTHSTKEVAIHFLAWREKLRNQSLIGHNGGPK* |
| Ga0115566_101319864 | 3300009071 | Pelagic Marine | MKNKKRKVKERVSTLTHTTREVAIDFLRWREEQKQKNSLIGHNGCPF* |
| Ga0115566_103629801 | 3300009071 | Pelagic Marine | MKKTKRSPVSTLTHTTREVAIDFLRWRKEQKEKSMIGHNGGPK* |
| Ga0115552_13852512 | 3300009077 | Pelagic Marine | STLTHTTREVAIHFLAWREKQKQKSMIGHNGGPK* |
| Ga0114995_105380634 | 3300009172 | Marine | MKKTKRSPVSTLTHTTKEVAIHFLAWREAQKNQSMIG |
| Ga0114994_100172511 | 3300009420 | Marine | MKKTKRSPVSTLTHSTREVAIHFLAWREAQKNHSMIGHNGGPK* |
| Ga0114998_103758582 | 3300009422 | Marine | MKKTKRSPVSTLTHTTKEVAIHFLAWREAQKNHSMIGHNGGPKS* |
| Ga0115548_11154041 | 3300009423 | Pelagic Marine | MKKTKRSPVSTLTHTTREVAIDFLRWRKEQQEKSMIGHNGGPK* |
| Ga0114915_10480273 | 3300009428 | Deep Ocean | MKKVKVKTPVSTLTHSTREVALDFLRWKESKKKKSLIGHNGGPSL* |
| Ga0115558_13912111 | 3300009449 | Pelagic Marine | MKREMVSTLTHTTREVAIDFLRWREEQKNKSMIGHNGC |
| Ga0115569_103767061 | 3300009497 | Pelagic Marine | QFIKTNLQIMKKTKRSPVSTLTHTTREVAIDFLRWRKEQKEKSMIGHNGGPK* |
| Ga0115564_104651481 | 3300009505 | Pelagic Marine | SVSTLTHTTREVAIHFLAWREKQKQKSMIGHNGGPK* |
| Ga0115572_106832961 | 3300009507 | Pelagic Marine | MNKVKRRPVSTLTHTTREVALDFLRWKKEQREKSMIGHNGGPK* |
| Ga0115013_1000028430 | 3300009550 | Marine | MKNKTKRPVSTLTHTTREVAIDFLRWRKEQKEKSMIGHNGGPK* |
| Ga0115011_100083962 | 3300009593 | Marine | MANALKRPVSTLTHSTREVALDFLRWRKELKEKSMIGHNGGPKISDRDFK* |
| Ga0115011_1002244513 | 3300009593 | Marine | MKNKKKRPVSTLTHTTREVALDFLRWREEQKQKSMIGHNGGPK* |
| Ga0115104_107734282 | 3300009677 | Marine | MKNKTKRPVSTLTHTTREVAIHFLAWREKQKQKTMIGHNGGPK* |
| Ga0115104_108212902 | 3300009677 | Marine | MKNKKRRPVSTLTHTTREVAIDFLRWRKEQKEKSMIGHNGGPK* |
| Ga0115001_100169562 | 3300009785 | Marine | MKKTKRSPVSTLTHSTREVAIHFLAWREAQKNQSMIGHNGGPK* |
| Ga0115001_103324654 | 3300009785 | Marine | MKKTKRSPVSTLTHTTKEVAIHFLAWREAQKNQSMIGHNGGPKS* |
| Ga0098049_10146104 | 3300010149 | Marine | MKKTKRIPVSTLTHSTREVAIHFLAWREKQKQKTMIGHNGGPK* |
| Ga0098056_11787292 | 3300010150 | Marine | MKKTKRQSVSTLTHTTREVAIHFLAWREKQKQKTMIGHNGGPK* |
| Ga0160422_103058302 | 3300012919 | Seawater | MKQNKKRRPVSTLTHTTREVALDFLRWREEQKQKSMIGHNGGPK* |
| Ga0160423_100060856 | 3300012920 | Surface Seawater | MTKIKIKRPVSTLTHTTREVAEHFLKWREQQKKNSLIGHNGGPSI* |
| Ga0160423_103427312 | 3300012920 | Surface Seawater | MKKAKTKRPVSTLTHTTREVAEHFLKWREQLNKNSLIGHNGGPSL* |
| Ga0160423_108664671 | 3300012920 | Surface Seawater | KSPVSTLTHTTREVAIHFLAWREKQKQKSLIGHNGGPK* |
| Ga0163110_106461213 | 3300012928 | Surface Seawater | MKKIKRSPVSTLTHTTREVAIDFLRWRKEQQEKSMLGHNGGPK* |
| Ga0163109_100179874 | 3300012936 | Surface Seawater | MKKVKIKKPVSTLTHSTREVAEHFLKWREQQKKNSLIGHNGGPKI* |
| Ga0163179_112915832 | 3300012953 | Seawater | MKNKIKRPVSTLTHTTREVALDFLRWREEQKQKSMIGHNGGPK* |
| Ga0163111_105503233 | 3300012954 | Surface Seawater | MKQNKKRRPVSTLTHTTKEVAIDFLRWREEQKQKSLIGHNGGPK* |
| Ga0163111_113848571 | 3300012954 | Surface Seawater | MKNKKRRPVSTLTHTSREVAMDFLRWREEQKKKSMIGHNGGPK* |
| Ga0182046_11836422 | 3300016776 | Salt Marsh | MKKIKRSPVSTLTHSTREVAIHFLAWREAQKNKSLIGHNGGPK |
| Ga0181377_10010612 | 3300017706 | Marine | MKKTKRSPVSTLTHTTREVAIHFLAWREKQKQKTMIGHNGGPK |
| Ga0181377_10046195 | 3300017706 | Marine | MKIKNKKPVSTLTHTTKEVALHFLKWREQQKKNSLIGHNGGPK |
| Ga0181377_10242403 | 3300017706 | Marine | MKKVKIKKPVSTLTHTTKEVALHFLKWREQQKKNSLIGHNGGPK |
| Ga0181383_12154501 | 3300017720 | Seawater | MKKEKVSTLTHTTREVAIDFLRWREEQKKKSMIGHNGCP |
| Ga0181401_10170313 | 3300017727 | Seawater | MWSINMKVKIKKPVSTLTHTTKEVALHFLKWREQQKKNSLIGHNGGPK |
| Ga0181417_11636932 | 3300017730 | Seawater | MKNKTKRPVSTLTHTTREVAIHFLAWREKQKQKSMIGHNGGPK |
| Ga0181431_10125225 | 3300017735 | Seawater | MNKVKRRPVSTLTHTTREVAIDFLRWRKEQQEKSMIGHNGGPK |
| Ga0187220_10870071 | 3300017768 | Seawater | MKKVKFKGPVSTLTHTTREVALHFLKWREQQKKNSLIGHNGGPK |
| Ga0181425_12431972 | 3300017771 | Seawater | MKNKKRRPVSTLTHTTREVAIDFLRWRKKQKKKSMIGHNGGPK |
| Ga0181394_10785204 | 3300017776 | Seawater | MKKEKVSTLTHTTREVAIDFLRWREEQKNKSMIGHNGCP |
| Ga0181394_11165581 | 3300017776 | Seawater | MKKTKRQSVSTLTHTTREVAIHFLAWREALKKKSMIGHNGGPK |
| Ga0181395_12455883 | 3300017779 | Seawater | MKNKKRRPVSTLTHTTREVAIDFLRWRKEQKEKSMIGHN |
| Ga0181380_100052428 | 3300017782 | Seawater | MKKTKRSPVSTLTHTTREVAIHFLAWREKLRNQSMIGHNGGPR |
| Ga0181424_100298671 | 3300017786 | Seawater | IMKKTKRSPVSTLTHSTKEVAIHFLAWREKLRNQSLIGHNGGPK |
| Ga0181565_103906024 | 3300017818 | Salt Marsh | MKKTKRSPVSTLTHSSREVAIHFLAWREKLKNQSMIGHNGGPK |
| Ga0181565_104102051 | 3300017818 | Salt Marsh | KRPVSTLTHSTMEVALHFLKWREQQKKNSLIGHNGGPSL |
| Ga0181565_104586123 | 3300017818 | Salt Marsh | MKNKKRRPVSTLTHTSREVAIDFLRWREEQKQKSMIGHNGGPK |
| Ga0181552_1000117216 | 3300017824 | Salt Marsh | MKKIKRSPVSTLTHSTREVAIHFLAWREAQKNKSMIGHNGGPK |
| Ga0181552_105554991 | 3300017824 | Salt Marsh | MKQTKRKPVSTLTHSRAYVVKHFLAWREALKDRSMLGHNGGPRL |
| Ga0181590_104005593 | 3300017967 | Salt Marsh | MKKTKRSPVSTLTHTSREVAIDFLRWREEQKQKSMIGHNGGPK |
| Ga0181587_106642102 | 3300017968 | Salt Marsh | MKNKKRRPVSTLTHTSREVAIDFLRWREEQKQKSMIGHNRGPK |
| Ga0181576_108926581 | 3300017985 | Salt Marsh | YIMKKTKRCPVSTLTHSSREVAIHFLAWREKLKNQSMIGHNGGPK |
| Ga0181606_102451553 | 3300018048 | Salt Marsh | MKKTKRQSVSTLTHTTREVAIHFLAWREKQKQKSMIGHNGGPK |
| Ga0181561_103739471 | 3300018410 | Salt Marsh | IKRPVSTLTHSTMEVALHFLKWREQQKKNSLIGHNGGPKI |
| Ga0181560_100132005 | 3300018413 | Salt Marsh | MKKIKRSPMSTLTHSTREVAIHFLAWREAQKNKSMIGHNGGPK |
| Ga0181560_103095861 | 3300018413 | Salt Marsh | CGIIYIMKKTKRSPVSTLTHTSREVAIDFLRWREEQKQKSMIGHNGGPK |
| Ga0181558_104468812 | 3300018417 | Salt Marsh | MKQTKRKPVSTLTHSRAYVVKHFLAWREALKDRSMLG |
| Ga0194029_10394523 | 3300019751 | Freshwater | MKKLKSPVSTLTHTTREVALHFLKWREQQKKNSLIGHNGGPKI |
| Ga0181555_13265762 | 3300020051 | Salt Marsh | LGTKKIKRPVSTLTHSTKEVALHFLKWREQQKKNSL |
| Ga0181554_13522732 | 3300020052 | Salt Marsh | PMSTLTHSTREVAIHFLAWREAQKNKSMIGHNGGPK |
| Ga0206131_100174315 | 3300020185 | Seawater | MKKSKRSPVSTLTHTTREVAIHFLAWREKQNAKSSMIGHNGGPK |
| Ga0206131_100196436 | 3300020185 | Seawater | MKVKFKKPVSTLTHTTREVALHFLKWREQQKKNSLIGHNGGPKI |
| Ga0206131_1003513412 | 3300020185 | Seawater | MKKTKRSPVSTLTHTTREVAIDFLRWRKEQKEKSMIGHNGGPK |
| Ga0211711_10108224 | 3300020245 | Marine | MKQNKKRRPVSTLTHTTREVALDFLRWREEQKQKSMIGHNGGPK |
| Ga0211519_10385782 | 3300020266 | Marine | MNKAKRRPVSTLTHTTREVAIDFLRWREEQKQKSMIGHNGGPK |
| Ga0211667_10253152 | 3300020282 | Marine | MKKTIKSPVSTLTHTTREVAIHFLAWREKQKQKSLIGHNGGPK |
| Ga0211510_10118028 | 3300020336 | Marine | MKNKTKRPVSTLTHTTREVAIDFLRWRKEQKEKSMIGHNGGPK |
| Ga0211677_103976241 | 3300020385 | Marine | MKKTKRQSVSTLTHTTREVAIHFLAWREKQKQKTMIGHNGGPK |
| Ga0211497_101877512 | 3300020394 | Marine | MKKAKIKRPVSTLTHTTREVAEHFLKWREQQKKNSLIGHNGGPSL |
| Ga0211636_100920153 | 3300020400 | Marine | MTKIKIKRPVSTLTHTTREVAEHFLKWREQQKKNSLIGHNGGPSI |
| Ga0211659_100336714 | 3300020404 | Marine | KRPVSTLTHTTREVAEHFLKWREQQKKNSLIGHNGGPSI |
| Ga0211587_100502312 | 3300020411 | Marine | MANALKRPVSTLTHSTREVALDFLRWRKELKEKSMIGHNGGPKISDRDFK |
| Ga0211580_104074941 | 3300020420 | Marine | KRPVSTLTHTIREVALDFLRWREEQKQKSMIGHNGGPK |
| Ga0211539_102048852 | 3300020437 | Marine | MKKIKIKRPVSTLTHTTREVAEHFLKWREQQKKNSLIGHNGGPSL |
| Ga0211576_1000023668 | 3300020438 | Marine | MKKTKRQSVSTLTHTTREVAIHFLAWREALKNKSMIGHNGGPK |
| Ga0211576_1000403511 | 3300020438 | Marine | MKKTKRSPVSTLTHSTKEVAIHFLAWREKLKEQSMIGHNGGPK |
| Ga0211576_100168386 | 3300020438 | Marine | MKVKIKKPVSTLTHTTKEVALHFLKWREQQKKNSLIGHNGGPK |
| Ga0211576_100463964 | 3300020438 | Marine | MKNKTKRPVSTLTHTTREVAIHFLAWREKQKQKTMIGHNGGPK |
| Ga0211576_101178545 | 3300020438 | Marine | MKNKKRRPVSTLTHTTREVAIDFLRWRKEQKEKSMIGHNGGPK |
| Ga0211576_103343843 | 3300020438 | Marine | MKVKKPVSTLTHTTKEVALHFLKWREQQKKNSLIGHNGGPK |
| Ga0211559_100239402 | 3300020442 | Marine | MKKVKIKKPVSTLTHTTREVAEHFLKWREQQKKNSLIGHNGGPSL |
| Ga0211638_105613361 | 3300020448 | Marine | MARRRTPVSTLTHTTMEVALDFLRWREEQQILSLIGHNGCPF |
| Ga0211641_102145794 | 3300020450 | Marine | MKKVKIKGPVSTLTHTTREVAEHFLKWREQQKKNSLIGHNGGPTI |
| Ga0211545_102007235 | 3300020452 | Marine | MKKTKRSPVSTLTHTTREVAIDFLRWKKEQQEKSMIGH |
| Ga0211676_1004070411 | 3300020463 | Marine | MKKKIKRPVSTLTHTSREVAIDFLRWREEQKQKSMIGHNGGPK |
| Ga0211676_100614004 | 3300020463 | Marine | MKKIKIKRPVSTLTHTTREVAEHFLKWREHQKRNSLIGHNGGPAL |
| Ga0211676_105304772 | 3300020463 | Marine | MKKTKRSPVSTLTHTTREVAIDFLRWKKEQQEKSMIGHNGGPK |
| Ga0211577_100525455 | 3300020469 | Marine | MKKVKIKKPVSTLTHTTREVAEHFLKWREQQKLNSLIGHNGGPK |
| Ga0211577_106891881 | 3300020469 | Marine | RNILKKSKRRPVSTLTHTTREVAIHFLAWREKQNSKSSMIGHNGGPK |
| Ga0206677_1000600811 | 3300021085 | Seawater | MKKTKRSPVSTLTHTTREVAIDFLRWRKEQQEKSMIGHNGGPK |
| Ga0206677_100429015 | 3300021085 | Seawater | MKKVKIKRPVSTLTHTTREVALHFLKWREQQKKNSLIGHNGGPSI |
| Ga0206682_10000019133 | 3300021185 | Seawater | MKKTIRRPVSTLTHTSREVAIHFLAWREKQKEKTMIGHNGGPK |
| Ga0206682_1001383912 | 3300021185 | Seawater | MNKVKRRPVSTLTHTTREVALDFLRWKKEQREKSMIGHNGGPK |
| Ga0213867_12187081 | 3300021335 | Seawater | LGTKKIKRPVSTLTHSTKEVALHFLKWREQQKKNSLIGHNGGPK |
| Ga0213858_102118703 | 3300021356 | Seawater | MKIRKMKRPVSTLTHTTREVAEHFLKWREQQKKKSLIGHNGGPSL |
| Ga0213859_101436681 | 3300021364 | Seawater | IIKENTTTMKNKKRRPVSTLTHTSREVAIDFLRWREEQKQKSMIGHNGGPK |
| Ga0213859_104032921 | 3300021364 | Seawater | MKKVKIKKPVSTLTHSTREVAEHFLKWREQQKKNSLIGHNGGPKI |
| Ga0213863_100476035 | 3300021371 | Seawater | MKKTKRSPVSTLTHTTREVALDFLRWRKEQQEKSMIGHNGGPK |
| Ga0213865_1000872510 | 3300021373 | Seawater | MKKIKKSPVSTLTHSTREVAIHFLAWREAQKNKSMIGHNGGPK |
| Ga0213869_1000315117 | 3300021375 | Seawater | MKKNKRSPVSTLTHTTREVAIDFLRWRKEQKEKSMIGHNGGPK |
| Ga0213869_100100624 | 3300021375 | Seawater | MKKVKFKGPVSTLTHTTREVALHFLKWREQQKKNSLIGHNGGPKI |
| Ga0213869_103228473 | 3300021375 | Seawater | VSTLTHTSREVAIHFLAWREKQKQKTMIGHNGGPK |
| Ga0213861_102089482 | 3300021378 | Seawater | MKNKKRSPVSTLTHTSREVAIHFLAWREKQKQKTMIGHNGGPK |
| Ga0222717_1000591810 | 3300021957 | Estuarine Water | MKKTKRSPVSTLTHTTREVAIHFLAWREKLRNQSMIGHNGGPK |
| Ga0222717_101028644 | 3300021957 | Estuarine Water | RRPVSTLTHTSREVAIHFLAWREKQKEKTMIGHNGGPK |
| Ga0222717_102891684 | 3300021957 | Estuarine Water | MKKTKRSPVSTLTHSTREVAIHFLAWREKQKQKSMIGHNGGPK |
| Ga0222718_1000058526 | 3300021958 | Estuarine Water | MKNKKRRPVSTLTHTTREVALDFLRWKKEQQEKSMIGHNGGPK |
| Ga0222718_100544848 | 3300021958 | Estuarine Water | MKKLKRSPVSTLTHSTREVAIHFLAWREKQKQKSMIGHNGGPK |
| Ga0222718_103976122 | 3300021958 | Estuarine Water | MKKLKRSPVSTLTHSTREVAIHFLAWREAQKNKSMIGHNGGPK |
| Ga0255765_11615224 | 3300022921 | Salt Marsh | MKKTKRSPVSTLTHTTREVAIHFLAWREKQKQKSMIGHNGGPK |
| Ga0255781_102827671 | 3300022934 | Salt Marsh | TMKNKKRRPVSTLTHTSREVAIDFLRWREEQKQKSMIGHNGGPK |
| Ga0228676_10108001 | 3300024248 | Seawater | MKKQKVSTLTHTTREVAIDFLRWREEQKNKSMIGHN |
| (restricted) Ga0233438_101032611 | 3300024255 | Seawater | MKKTKRNPVSTLTHTTKEVAIHFLAWREAQKNKSMIGHNGGPKS |
| Ga0244775_102603882 | 3300024346 | Estuarine | MDGVQVMKKTKRNPVSTLTHTTKEVAIHFLAWREAQKNKSMIGHNGGPKS |
| Ga0244775_109744292 | 3300024346 | Estuarine | MKKTKRSPVSTLTHSTKEVAIHFLAWREKLRNQSLIGHNGGPK |
| Ga0244776_100631895 | 3300024348 | Estuarine | MKKSKRSPVSTLTHTTREVAIHFLAWREKQNLKSSMIGHNGGPK |
| Ga0208667_10014706 | 3300025070 | Marine | MKKTKRSPVSTLTHSTREVAIHFLAWREKQKQKTMIGHNGGPK |
| Ga0208667_10085826 | 3300025070 | Marine | MKKTKRSPVSTLTHSTREVAIHFLAWREKLRNQSLIGHNGGPK |
| Ga0208159_11043911 | 3300025101 | Marine | MKQNKKRRPVSTLTHTTREVAIDFLRWREEQKQKSLIGHNGGPK |
| Ga0209336_100023259 | 3300025137 | Marine | MKKTKRSPVSTLTHTTREVAIHFLAWREKQKAKTMIGHNGGPK |
| Ga0209336_100411443 | 3300025137 | Marine | MKKTKRSPVSTLTHSTKEVAIHFLAWREKLKDQSMIGHNGGPK |
| Ga0209634_10005321 | 3300025138 | Marine | KVKIKKPVSTLTHTTKEVALHFLKWREQQKKNSLIGHNGGPK |
| Ga0209645_10462253 | 3300025151 | Marine | MKKAKIKKPVSTLTHSTREVAEHFLKWREQQKKNSLIGHNGGPNL |
| Ga0208814_100069516 | 3300025276 | Deep Ocean | MVTQGINMKKVKVKTPVSTLTHSTREVALDFLRWRESKKKKSLIGHNGGPSL |
| Ga0209716_10847493 | 3300025626 | Pelagic Marine | MKREMVSTLTHTTREVAIDFLRWREEQKNKSMIGHNG |
| Ga0209659_11940191 | 3300025658 | Marine | PVSTLTHTTKEVAIHFLAWREAQKNKSMIGHNGGPKS |
| Ga0209715_10585581 | 3300025699 | Pelagic Marine | RQSVSTLTHTTREVAIHFLAWREKQKQKSMIGHNGGPK |
| Ga0209715_10838174 | 3300025699 | Pelagic Marine | MKNKKRKVKERVSTLTHTTREVAIDFLRWREEQKQKN |
| Ga0209137_11257633 | 3300025767 | Marine | MKVKKPVSTLTHTTKEVAIHFLAWREAQKNKSMIGHNGGPKS |
| Ga0209666_11615821 | 3300025870 | Marine | KKSKRSPVSTLTHTTREVAIHFLAWREKQNAKSSMIGHNGGPK |
| Ga0209951_10777163 | 3300026138 | Pond Water | MKNKKRRPVSTLTHTTREVALDFLRWKKEQQEKSMIGHN |
| Ga0209929_11225853 | 3300026187 | Pond Water | MNRSKKKPVSTLTHTTREVAIHFLAWREALKNKSMIGHNGGPK |
| Ga0209071_10179035 | 3300027686 | Marine | INMKKVKVKTPVSTLTHSTREVALDFLRWRESKKKKSLIGHNGGPSL |
| Ga0208304_100562915 | 3300027751 | Estuarine | MKKSKRSPVSTLTHTTREVAIHFLAWREKQNAKSSMIGH |
| Ga0209090_101353952 | 3300027813 | Marine | MDGVQVMKKTKRNPVSTLTHTTKEVAIHFLAWREAQKNQSMIGHNGGPKS |
| Ga0209404_1001188213 | 3300027906 | Marine | MKNKKKRPVSTLTHTTREVALDFLRWREEQKQKSMIGHNGGPK |
| Ga0257127_10042617 | 3300028189 | Marine | MKKTKRNPVSTLTHTAKEVAIHFLAWREAQKNKSMIGHNGGPKS |
| Ga0257127_10574924 | 3300028189 | Marine | PVSTLTHTAKEVAIHFLAWREAQKNKSMIGHNGGPKS |
| Ga0308021_101322994 | 3300031141 | Marine | MVTQGINMKKVKVKTPVSTLTHSTREVALDFLRWRESKKKKSLIGHNGGPS |
| Ga0307488_101090626 | 3300031519 | Sackhole Brine | MKKTKRNPVSTLTHTTKEVAIHFLAWREAQKNQSMIGHNGGPKS |
| Ga0307488_108380922 | 3300031519 | Sackhole Brine | MKKTKRSPVSTLTHSTREVAIHFLAWREKQKAKTMIGHNGGPK |
| Ga0308007_102895112 | 3300031599 | Marine | MKKTKISPVSTLTHSTREVAIHFLAWRERQKPTSLIGHNGGPK |
| Ga0307999_10000011 | 3300031608 | Marine | MVTQGINMKKVKVKTPVSTLTHSTREVALDFLRWRESKKKKSLIGHN |
| Ga0308004_103596362 | 3300031630 | Marine | DRKFMKKTKRSQVSTLTHTTREVAIHFLAWREKQKAKTMIGHNGGPK |
| Ga0308008_10004598 | 3300031687 | Marine | MKKVKVKTPVSTLTHSTREVALDFLRWRESKKKKSLIGHNGGPSL |
| Ga0308015_103546441 | 3300031694 | Marine | MVTQGINMKKVKVKTPVSTLTHSTREVALDFLRWRESKKKKSL |
| Ga0310343_107921653 | 3300031785 | Seawater | MKKIKIKRPVSTLTHTTKEVALDFLRWREEQKKKSLIGHNGGPSL |
| ⦗Top⦘ |