| Basic Information | |
|---|---|
| Family ID | F027208 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 195 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MSDSKETDIVRIDLTAEQKEQVKAATDKSADAIELTVQELEARIAPIVHM |
| Number of Associated Samples | 133 |
| Number of Associated Scaffolds | 187 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 82.05 % |
| % of genes near scaffold ends (potentially truncated) | 36.41 % |
| % of genes from short scaffolds (< 2000 bps) | 87.69 % |
| Associated GOLD sequencing projects | 116 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.462 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (12.821 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.641 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (59.487 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.36% β-sheet: 12.82% Coil/Unstructured: 62.82% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 187 Family Scaffolds |
|---|---|---|
| PF13191 | AAA_16 | 6.42 |
| PF13492 | GAF_3 | 4.81 |
| PF00486 | Trans_reg_C | 4.28 |
| PF03704 | BTAD | 3.74 |
| PF16576 | HlyD_D23 | 2.67 |
| PF13424 | TPR_12 | 1.60 |
| PF13847 | Methyltransf_31 | 1.07 |
| PF05175 | MTS | 1.07 |
| PF01370 | Epimerase | 0.53 |
| PF13533 | Biotin_lipoyl_2 | 0.53 |
| PF00903 | Glyoxalase | 0.53 |
| PF00722 | Glyco_hydro_16 | 0.53 |
| COG ID | Name | Functional Category | % Frequency in 187 Family Scaffolds |
|---|---|---|---|
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 3.74 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 3.74 |
| COG2273 | Beta-glucanase, GH16 family | Carbohydrate transport and metabolism [G] | 0.53 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.46 % |
| Unclassified | root | N/A | 41.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps_contig58307.35993 | Not Available | 1719 | Open in IMG/M |
| 3300003321|soilH1_10227448 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2404 | Open in IMG/M |
| 3300003572|Ga0007424J51698_1088405 | Not Available | 573 | Open in IMG/M |
| 3300004114|Ga0062593_101802747 | Not Available | 672 | Open in IMG/M |
| 3300004114|Ga0062593_102446536 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 590 | Open in IMG/M |
| 3300004157|Ga0062590_103013263 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 505 | Open in IMG/M |
| 3300004643|Ga0062591_101160318 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 749 | Open in IMG/M |
| 3300004643|Ga0062591_102958832 | Not Available | 504 | Open in IMG/M |
| 3300004798|Ga0058859_11767011 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 711 | Open in IMG/M |
| 3300004798|Ga0058859_11767011 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 711 | Open in IMG/M |
| 3300005093|Ga0062594_101024221 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 797 | Open in IMG/M |
| 3300005093|Ga0062594_101132246 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 768 | Open in IMG/M |
| 3300005293|Ga0065715_10437575 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 818 | Open in IMG/M |
| 3300005327|Ga0070658_11363234 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 616 | Open in IMG/M |
| 3300005328|Ga0070676_10434350 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 920 | Open in IMG/M |
| 3300005329|Ga0070683_100019728 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 5991 | Open in IMG/M |
| 3300005329|Ga0070683_100645003 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1014 | Open in IMG/M |
| 3300005329|Ga0070683_101690247 | Not Available | 609 | Open in IMG/M |
| 3300005331|Ga0070670_101389844 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 643 | Open in IMG/M |
| 3300005335|Ga0070666_10449720 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 930 | Open in IMG/M |
| 3300005336|Ga0070680_101427431 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 599 | Open in IMG/M |
| 3300005337|Ga0070682_101939246 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 517 | Open in IMG/M |
| 3300005338|Ga0068868_101247573 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 689 | Open in IMG/M |
| 3300005339|Ga0070660_100216170 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1557 | Open in IMG/M |
| 3300005339|Ga0070660_101280973 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 622 | Open in IMG/M |
| 3300005339|Ga0070660_101787334 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 524 | Open in IMG/M |
| 3300005347|Ga0070668_100122255 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 2082 | Open in IMG/M |
| 3300005353|Ga0070669_100554078 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 959 | Open in IMG/M |
| 3300005354|Ga0070675_101557920 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 610 | Open in IMG/M |
| 3300005355|Ga0070671_100594861 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 956 | Open in IMG/M |
| 3300005364|Ga0070673_100144724 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 2008 | Open in IMG/M |
| 3300005364|Ga0070673_100149276 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1978 | Open in IMG/M |
| 3300005364|Ga0070673_100353610 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1304 | Open in IMG/M |
| 3300005364|Ga0070673_102172846 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 527 | Open in IMG/M |
| 3300005366|Ga0070659_100855232 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300005367|Ga0070667_101491342 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 635 | Open in IMG/M |
| 3300005434|Ga0070709_10091883 | All Organisms → cellular organisms → Bacteria | 2004 | Open in IMG/M |
| 3300005441|Ga0070700_101902894 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 514 | Open in IMG/M |
| 3300005441|Ga0070700_101902894 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 514 | Open in IMG/M |
| 3300005454|Ga0066687_10526580 | Not Available | 700 | Open in IMG/M |
| 3300005456|Ga0070678_100224194 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1564 | Open in IMG/M |
| 3300005459|Ga0068867_100424661 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1127 | Open in IMG/M |
| 3300005535|Ga0070684_100302940 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1467 | Open in IMG/M |
| 3300005535|Ga0070684_100660917 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 973 | Open in IMG/M |
| 3300005539|Ga0068853_100533205 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1111 | Open in IMG/M |
| 3300005548|Ga0070665_100446396 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1303 | Open in IMG/M |
| 3300005564|Ga0070664_100052169 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 3463 | Open in IMG/M |
| 3300005564|Ga0070664_100912897 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 824 | Open in IMG/M |
| 3300005578|Ga0068854_101504936 | Not Available | 611 | Open in IMG/M |
| 3300005614|Ga0068856_100154619 | All Organisms → cellular organisms → Bacteria | 2304 | Open in IMG/M |
| 3300005616|Ga0068852_102210489 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 572 | Open in IMG/M |
| 3300005719|Ga0068861_100548377 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1053 | Open in IMG/M |
| 3300006031|Ga0066651_10015178 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 3211 | Open in IMG/M |
| 3300006237|Ga0097621_102107614 | Not Available | 539 | Open in IMG/M |
| 3300006358|Ga0068871_101023474 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 770 | Open in IMG/M |
| 3300006804|Ga0079221_11117314 | Not Available | 605 | Open in IMG/M |
| 3300006881|Ga0068865_101783040 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 556 | Open in IMG/M |
| 3300006894|Ga0079215_11358569 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 552 | Open in IMG/M |
| 3300006918|Ga0079216_10049782 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1806 | Open in IMG/M |
| 3300006918|Ga0079216_11968675 | Not Available | 506 | Open in IMG/M |
| 3300007004|Ga0079218_10849772 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 887 | Open in IMG/M |
| 3300009094|Ga0111539_10422197 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1553 | Open in IMG/M |
| 3300009098|Ga0105245_12623295 | Not Available | 557 | Open in IMG/M |
| 3300009137|Ga0066709_102250087 | Not Available | 750 | Open in IMG/M |
| 3300009156|Ga0111538_10925002 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1104 | Open in IMG/M |
| 3300009177|Ga0105248_10066251 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4055 | Open in IMG/M |
| 3300009553|Ga0105249_11860442 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 675 | Open in IMG/M |
| 3300009553|Ga0105249_13008557 | Not Available | 541 | Open in IMG/M |
| 3300009840|Ga0126313_10068255 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2551 | Open in IMG/M |
| 3300009840|Ga0126313_11389165 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 582 | Open in IMG/M |
| 3300010036|Ga0126305_10299768 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1043 | Open in IMG/M |
| 3300010037|Ga0126304_10780457 | Not Available | 647 | Open in IMG/M |
| 3300010041|Ga0126312_10229613 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1301 | Open in IMG/M |
| 3300010146|Ga0126320_1028427 | Not Available | 779 | Open in IMG/M |
| 3300010146|Ga0126320_1489990 | Not Available | 514 | Open in IMG/M |
| 3300010147|Ga0126319_1448645 | Not Available | 847 | Open in IMG/M |
| 3300010147|Ga0126319_1448645 | Not Available | 847 | Open in IMG/M |
| 3300010166|Ga0126306_10031256 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3600 | Open in IMG/M |
| 3300010375|Ga0105239_12889027 | Not Available | 560 | Open in IMG/M |
| 3300010375|Ga0105239_13185472 | Not Available | 534 | Open in IMG/M |
| 3300010399|Ga0134127_12598280 | Not Available | 586 | Open in IMG/M |
| 3300011332|Ga0126317_11090053 | Not Available | 527 | Open in IMG/M |
| 3300011333|Ga0127502_10662339 | Not Available | 508 | Open in IMG/M |
| 3300012199|Ga0137383_11052735 | Not Available | 591 | Open in IMG/M |
| 3300012208|Ga0137376_10661088 | Not Available | 902 | Open in IMG/M |
| 3300012212|Ga0150985_102085535 | Not Available | 803 | Open in IMG/M |
| 3300012212|Ga0150985_102085535 | Not Available | 803 | Open in IMG/M |
| 3300012212|Ga0150985_103011457 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1046 | Open in IMG/M |
| 3300012212|Ga0150985_103014146 | Not Available | 512 | Open in IMG/M |
| 3300012212|Ga0150985_103250628 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300012212|Ga0150985_114961500 | Not Available | 501 | Open in IMG/M |
| 3300012212|Ga0150985_115913089 | Not Available | 784 | Open in IMG/M |
| 3300012212|Ga0150985_120189505 | Not Available | 515 | Open in IMG/M |
| 3300012469|Ga0150984_103865283 | Not Available | 524 | Open in IMG/M |
| 3300012469|Ga0150984_114736666 | Not Available | 834 | Open in IMG/M |
| 3300012951|Ga0164300_11114438 | Not Available | 517 | Open in IMG/M |
| 3300012955|Ga0164298_10096174 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1557 | Open in IMG/M |
| 3300012957|Ga0164303_11170010 | Not Available | 560 | Open in IMG/M |
| 3300012958|Ga0164299_10227877 | Not Available | 1098 | Open in IMG/M |
| 3300012960|Ga0164301_10217611 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1231 | Open in IMG/M |
| 3300012985|Ga0164308_10218216 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1466 | Open in IMG/M |
| 3300013100|Ga0157373_11520132 | Not Available | 511 | Open in IMG/M |
| 3300013100|Ga0157373_11520132 | Not Available | 511 | Open in IMG/M |
| 3300013102|Ga0157371_10469143 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 927 | Open in IMG/M |
| 3300013307|Ga0157372_12789908 | Not Available | 560 | Open in IMG/M |
| 3300015262|Ga0182007_10113808 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 902 | Open in IMG/M |
| 3300015371|Ga0132258_11801890 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1542 | Open in IMG/M |
| 3300015371|Ga0132258_13423807 | Not Available | 1089 | Open in IMG/M |
| 3300018476|Ga0190274_11535237 | Not Available | 758 | Open in IMG/M |
| 3300018476|Ga0190274_12329790 | Not Available | 632 | Open in IMG/M |
| 3300019232|Ga0180114_1381789 | Not Available | 567 | Open in IMG/M |
| 3300019361|Ga0173482_10469708 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 603 | Open in IMG/M |
| 3300020078|Ga0206352_10683687 | Not Available | 550 | Open in IMG/M |
| 3300020082|Ga0206353_11004128 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1146 | Open in IMG/M |
| 3300021280|Ga0213900_106861 | Not Available | 518 | Open in IMG/M |
| 3300021445|Ga0182009_10096330 | Not Available | 1342 | Open in IMG/M |
| 3300021445|Ga0182009_10216887 | Not Available | 937 | Open in IMG/M |
| 3300021445|Ga0182009_10248394 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 882 | Open in IMG/M |
| 3300021445|Ga0182009_10343939 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 760 | Open in IMG/M |
| 3300021445|Ga0182009_10389728 | Not Available | 718 | Open in IMG/M |
| 3300022756|Ga0222622_10016510 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3664 | Open in IMG/M |
| 3300025315|Ga0207697_10024929 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2446 | Open in IMG/M |
| 3300025893|Ga0207682_10014161 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3108 | Open in IMG/M |
| 3300025899|Ga0207642_10567494 | Not Available | 703 | Open in IMG/M |
| 3300025907|Ga0207645_10344987 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 996 | Open in IMG/M |
| 3300025907|Ga0207645_10981811 | Not Available | 572 | Open in IMG/M |
| 3300025908|Ga0207643_11008783 | Not Available | 538 | Open in IMG/M |
| 3300025908|Ga0207643_11008783 | Not Available | 538 | Open in IMG/M |
| 3300025909|Ga0207705_10420543 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1035 | Open in IMG/M |
| 3300025909|Ga0207705_10613042 | Not Available | 846 | Open in IMG/M |
| 3300025919|Ga0207657_10046065 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3821 | Open in IMG/M |
| 3300025919|Ga0207657_10982859 | Not Available | 648 | Open in IMG/M |
| 3300025921|Ga0207652_10339934 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1355 | Open in IMG/M |
| 3300025925|Ga0207650_10877986 | Not Available | 761 | Open in IMG/M |
| 3300025926|Ga0207659_10308659 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1302 | Open in IMG/M |
| 3300025931|Ga0207644_10140680 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1858 | Open in IMG/M |
| 3300025931|Ga0207644_11467923 | Not Available | 573 | Open in IMG/M |
| 3300025932|Ga0207690_10996524 | Not Available | 697 | Open in IMG/M |
| 3300025933|Ga0207706_10197181 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1766 | Open in IMG/M |
| 3300025933|Ga0207706_10570378 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 973 | Open in IMG/M |
| 3300025940|Ga0207691_10103310 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2541 | Open in IMG/M |
| 3300025940|Ga0207691_10191369 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1784 | Open in IMG/M |
| 3300025940|Ga0207691_10222829 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1635 | Open in IMG/M |
| 3300025940|Ga0207691_10354230 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1255 | Open in IMG/M |
| 3300025941|Ga0207711_10685551 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 956 | Open in IMG/M |
| 3300025942|Ga0207689_11357720 | Not Available | 596 | Open in IMG/M |
| 3300025944|Ga0207661_11166595 | Not Available | 709 | Open in IMG/M |
| 3300025945|Ga0207679_10636961 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 963 | Open in IMG/M |
| 3300025960|Ga0207651_10375435 | Not Available | 1204 | Open in IMG/M |
| 3300026041|Ga0207639_11320677 | Not Available | 677 | Open in IMG/M |
| 3300026067|Ga0207678_11651546 | Not Available | 563 | Open in IMG/M |
| 3300026075|Ga0207708_11231974 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 655 | Open in IMG/M |
| 3300026075|Ga0207708_11866694 | Not Available | 527 | Open in IMG/M |
| 3300026089|Ga0207648_10107545 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2448 | Open in IMG/M |
| 3300026121|Ga0207683_10260166 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1584 | Open in IMG/M |
| 3300026142|Ga0207698_12274578 | Not Available | 554 | Open in IMG/M |
| 3300028587|Ga0247828_10530621 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 705 | Open in IMG/M |
| 3300028597|Ga0247820_11044934 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 585 | Open in IMG/M |
| 3300028768|Ga0307280_10125130 | Not Available | 872 | Open in IMG/M |
| 3300028889|Ga0247827_10281173 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 962 | Open in IMG/M |
| 3300030336|Ga0247826_10484772 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 931 | Open in IMG/M |
| 3300030496|Ga0268240_10001561 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2742 | Open in IMG/M |
| 3300030496|Ga0268240_10011682 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1512 | Open in IMG/M |
| 3300030988|Ga0308183_1163153 | Not Available | 557 | Open in IMG/M |
| 3300031099|Ga0308181_1101408 | Not Available | 623 | Open in IMG/M |
| 3300031114|Ga0308187_10275667 | Not Available | 621 | Open in IMG/M |
| 3300031366|Ga0307506_10414668 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 554 | Open in IMG/M |
| 3300031548|Ga0307408_100406697 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1170 | Open in IMG/M |
| 3300031824|Ga0307413_10115516 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1806 | Open in IMG/M |
| 3300031824|Ga0307413_11945319 | Not Available | 529 | Open in IMG/M |
| 3300031852|Ga0307410_10441383 | Not Available | 1060 | Open in IMG/M |
| 3300031938|Ga0308175_100026865 | All Organisms → cellular organisms → Bacteria | 4696 | Open in IMG/M |
| 3300031938|Ga0308175_100026865 | All Organisms → cellular organisms → Bacteria | 4696 | Open in IMG/M |
| 3300031938|Ga0308175_100120587 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2459 | Open in IMG/M |
| 3300031938|Ga0308175_100396744 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1440 | Open in IMG/M |
| 3300031938|Ga0308175_100951417 | Not Available | 947 | Open in IMG/M |
| 3300031938|Ga0308175_101012614 | Not Available | 918 | Open in IMG/M |
| 3300031938|Ga0308175_102169586 | Not Available | 623 | Open in IMG/M |
| 3300031938|Ga0308175_102931913 | Not Available | 532 | Open in IMG/M |
| 3300031939|Ga0308174_10086726 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2214 | Open in IMG/M |
| 3300031939|Ga0308174_10293193 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1279 | Open in IMG/M |
| 3300031939|Ga0308174_11191129 | Not Available | 650 | Open in IMG/M |
| 3300031939|Ga0308174_11659285 | Not Available | 549 | Open in IMG/M |
| 3300031996|Ga0308176_10080813 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2789 | Open in IMG/M |
| 3300031996|Ga0308176_10233655 | All Organisms → cellular organisms → Bacteria | 1752 | Open in IMG/M |
| 3300031996|Ga0308176_10244774 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1716 | Open in IMG/M |
| 3300031996|Ga0308176_10512104 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1220 | Open in IMG/M |
| 3300031996|Ga0308176_11272473 | Not Available | 781 | Open in IMG/M |
| 3300032005|Ga0307411_10302385 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1283 | Open in IMG/M |
| 3300033412|Ga0310810_10031885 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas phototrophica | 6426 | Open in IMG/M |
| 3300033475|Ga0310811_10670481 | Not Available | 1014 | Open in IMG/M |
| 3300033550|Ga0247829_10543482 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 964 | Open in IMG/M |
| 3300034659|Ga0314780_162696 | Not Available | 559 | Open in IMG/M |
| 3300034659|Ga0314780_162696 | Not Available | 559 | Open in IMG/M |
| 3300034666|Ga0314788_185380 | Not Available | 528 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 12.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 8.21% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 7.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 5.13% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.62% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 4.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.10% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.59% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 3.08% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.08% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.08% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.56% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.05% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.05% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.03% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.03% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.03% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.03% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.03% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.03% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.03% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.03% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.51% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.51% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.51% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.51% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003572 | Grassland soil microbial communities from Hopland, California, USA - Sample H3_Bulk_40 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019232 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT530_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021280 | Switchgrass-associated microbial communities from reclaimed mine lands soil in West Virginia, United States ? Hamp_Shaw_3 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034666 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_00298350 | 2199352024 | Soil | MSTKNENDIIRIDLTQEQKDKVKTVTDKSAEAIELTVKELEARITPYRF |
| soilH1_102274481 | 3300003321 | Sugarcane Root And Bulk Soil | MPEINNNDKGIVRIELTTEQKEQVKEITKQSAEAIELTVEELEQRI |
| Ga0007424J51698_10884052 | 3300003572 | Avena Fatua Rhizosphere | MSEHKETDIVRIDLTPAQKEQVKEATEKNADAIELTVQELE |
| Ga0062593_1018027471 | 3300004114 | Soil | MSTKNENDIIRIDLTQEQKDKVKTVTDKSAEAIELTVKELEARITPYRF* |
| Ga0062593_1024465362 | 3300004114 | Soil | MSDNKQSEIVRIDLTTEQKEKVKTATDQNVEAIELTVQELEARIAPLMLS* |
| Ga0062590_1030132631 | 3300004157 | Soil | MSDASEKDIVRIDLTNEQKDQIKAATEKSAEAIELTVQEL |
| Ga0062591_1011603183 | 3300004643 | Soil | MSDNKQSEIVRIDLTTEQKEKVKTATDQNVEAIELTVQELEARIAPLMLS |
| Ga0062591_1029588322 | 3300004643 | Soil | MADNKESHVVRIDLTTEQKEQVKAATEKSVDAIELTVQELEARIAPIAFIE* |
| Ga0058859_117670111 | 3300004798 | Host-Associated | MSDNKETDIIRIDLTAEQKEQVKAATEKSAEAIELTVQELEA |
| Ga0058859_117670112 | 3300004798 | Host-Associated | MSDNKESSVVRIDLTPEQKEQVKAATEKTVDSIELTIQELEARIAPIALIE* |
| Ga0062594_1010242212 | 3300005093 | Soil | MSDSKETDIVRIDLTNEQKEQVKAATDKSVDAIELTVQELEARIAPVRFT* |
| Ga0062594_1011322463 | 3300005093 | Soil | MSDKKENEVVRIDLTAEQKEQVKAATEKNADAIELTVQELEARIAPLHLT* |
| Ga0065715_104375751 | 3300005293 | Miscanthus Rhizosphere | MSDNKESSVVRIDLTPEQKEQVKAATEKTVDSIELTIQELEA |
| Ga0070658_113632342 | 3300005327 | Corn Rhizosphere | MSSQNENEIIRIDLTADQKAKLKDSTNKSVEAIELTVQELEARIAPLRVY* |
| Ga0070676_104343501 | 3300005328 | Miscanthus Rhizosphere | MSDKNQNEVVRIDLTAEQKEQVKAATEKSAEAIELTVQELEARIAPLHLS* |
| Ga0070683_1000197281 | 3300005329 | Corn Rhizosphere | MSTKKEDQIVRIDLTQEQKDQVKTITDQNAEAIELTVKELEARITPIRVW* |
| Ga0070683_1006450033 | 3300005329 | Corn Rhizosphere | MSDNKETDIVRIDLTAEQKEQVKAATDKSAEAIELTVQELEARIAPLRI* |
| Ga0070683_1016902472 | 3300005329 | Corn Rhizosphere | PATPTSDLSRITMSNPNQNEKTIVRIDLTPEQKEKVKAATDKSAEAIELTVQELEARIAPVVLG* |
| Ga0070670_1013898441 | 3300005331 | Switchgrass Rhizosphere | VVRIDLTPEQKEQVKAATEKTVDSIELTIQELEARIAPIALIE* |
| Ga0070666_104497202 | 3300005335 | Switchgrass Rhizosphere | FRDHMSDNRETDIVRIDLTAEQKEQVKAATEKSAEAIELTVQELEARIAPRFI* |
| Ga0070680_1014274311 | 3300005336 | Corn Rhizosphere | GTTPLRGARRMSIKNEKEIVRIDLTQDQKEKVKSVTDKNAEAIEMTVQELEARITPLTLG |
| Ga0070682_1019392462 | 3300005337 | Corn Rhizosphere | MTEKKENDVIRIDLTAEQKEQVKAATEKSAEAIELTVQELEARIAPLRVY |
| Ga0068868_1012475731 | 3300005338 | Miscanthus Rhizosphere | MSDSKQNDVIRIDLTTEQKEQVKAATEKSANAIELTVQELEARIAPRIYY* |
| Ga0070660_1002161703 | 3300005339 | Corn Rhizosphere | MTEHKKSDVIRIDLTNEQKEQVKEATEKNADAIELTVQEL |
| Ga0070660_1012809732 | 3300005339 | Corn Rhizosphere | MSDSKQNDVIRIDLTAEQKEQVKAATEKSVDALELTVQELEARIAPMMHF* |
| Ga0070660_1017873342 | 3300005339 | Corn Rhizosphere | MTEKKENDVIRIDLTAEQKEQVKAVTEKNADAIELTVQELEARIAPLHLT* |
| Ga0070668_1001222552 | 3300005347 | Switchgrass Rhizosphere | MSNQNENEIVRIDLTADQKAKLKDATNKSVDAIELTVQELESRIAPMRIG* |
| Ga0070669_1005540781 | 3300005353 | Switchgrass Rhizosphere | MSDSKETDIVRIDLTNEQKEQVKAATDKSVDAIELTVQELEARIAPIRFT* |
| Ga0070675_1015579202 | 3300005354 | Miscanthus Rhizosphere | DSKETDIVRIDLTNEQKEQVKAATDKSVDAIELTVQELEARIAPVKFY* |
| Ga0070671_1005948611 | 3300005355 | Switchgrass Rhizosphere | MSDHKKTDIVRIDLTAEQKEQVKEATEKSADAIELTVQELE |
| Ga0070673_1001447241 | 3300005364 | Switchgrass Rhizosphere | MSDNKESSVVRIDLTPEQKEQVKAATEKTVDSIELTIQELEARIAPI |
| Ga0070673_1001492761 | 3300005364 | Switchgrass Rhizosphere | EIMSDNKETDIIRIDLTAEQKEQVKAATEKSAEAIELTVQELEARIAPRFI* |
| Ga0070673_1003536101 | 3300005364 | Switchgrass Rhizosphere | MSDPKESHVVRIDLTPEQKEQVKAATEKTVDSIELTIQELEARIAPI |
| Ga0070673_1021728462 | 3300005364 | Switchgrass Rhizosphere | MSKQNEKSIVRIDLTPDQKAKIKAATDQSAEAIELTVQELEARIAPRVILD* |
| Ga0070659_1008552321 | 3300005366 | Corn Rhizosphere | IMSDKKENEVVRIDLTAEQKEQVKAATEKNADAIELTVQELEARIAPLHLT* |
| Ga0070667_1014913422 | 3300005367 | Switchgrass Rhizosphere | MSDNKETDIIRIDLTAEQKEQVKAATEKSAEAIELTVQEL |
| Ga0070709_100918832 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSIKNEKEIVRIDLTQDQKEKVKSVTDKNAEAIEMTVQELEARITPLTLG* |
| Ga0070700_1019028941 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | KESSVVRIDLTPEQKEQVKAATEKTVDSIELTIQELEARIAPIALIE* |
| Ga0070700_1019028942 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDNKETDIIRIDLTAEQKEQVKAATEKSAEAIELTVQELEARIAPRFI* |
| Ga0066687_105265801 | 3300005454 | Soil | MSTQNEKEIVRIDLTQEQKDKVKAVTDRNAEAIEMTVQELEARITPVRVF* |
| Ga0070678_1002241942 | 3300005456 | Miscanthus Rhizosphere | MSDSKETDIVRIDLTNEQKEQVKAATDKSVDAIELTVQELEARIAPVKFY* |
| Ga0068867_1004246613 | 3300005459 | Miscanthus Rhizosphere | MSDKKENEVVRIDLTAEQKEQVKAATEKNADAIELTVQELEARIAPPHL |
| Ga0070684_1003029403 | 3300005535 | Corn Rhizosphere | MSDSKQNDVIRIDLTAEQKEQVKAATEKSVDALELTVQELEARIAPMVQF* |
| Ga0070684_1006609172 | 3300005535 | Corn Rhizosphere | MSNPNQNEKTIVRIDLTPEQKEKVKAATDKSAEAIELTVQELEARIAPVVLG* |
| Ga0068853_1005332053 | 3300005539 | Corn Rhizosphere | MTEKKENDVIRIDLTAEQKEKVKAATEKNADAIELTVQELEARIAPLRF* |
| Ga0070665_1004463962 | 3300005548 | Switchgrass Rhizosphere | QVTSSFREIMSDNKETDIIRIDLTAEQKEQVKAATEKSAEAIELTVQELEARIAPRFI* |
| Ga0070664_1000521693 | 3300005564 | Corn Rhizosphere | MSDPKESHVVRIDLTPEQKEQVKAATEKSVDSIELTIQELEARIAPIALIE* |
| Ga0070664_1009128971 | 3300005564 | Corn Rhizosphere | MSNREKEMVRIDLTEEQKEQVKAATDKRVDSIELTIQELEARIAPIALIE* |
| Ga0068854_1015049361 | 3300005578 | Corn Rhizosphere | HRATQSTEITMSDKNQSEVVRIDLTAEQKEQVKAATEKNADAIELTVQELEARIAPLHLT |
| Ga0068856_1001546192 | 3300005614 | Corn Rhizosphere | MSTKNEKEIVRIDLTQDQKEKVKSVTDKNAEAIEMTVQELEARITPLTLG* |
| Ga0068852_1022104891 | 3300005616 | Corn Rhizosphere | AQVTSSFREIMSDNKETDIIRIDLTAEQKEQVKAATEKSAEAIELTVQELEARIAPRFI* |
| Ga0068861_1005483771 | 3300005719 | Switchgrass Rhizosphere | KENEVVRIDLTAEQKEQVKAATEKNADAIELTVQELEARIAPLHLT* |
| Ga0066651_100151782 | 3300006031 | Soil | MSDSKPTDIIRIDLTTEQKEQVKAATEKSADAIELTVQELEARIAPKVFV* |
| Ga0097621_1021076142 | 3300006237 | Miscanthus Rhizosphere | MSDSKQNDVIRIDLTPEQKEQVKAATEKSVDALELTVQELEARIAPMMHF* |
| Ga0068871_1010234741 | 3300006358 | Miscanthus Rhizosphere | MSDHKKTDVVRIDLTAEQKEQVKEATDKSADAIELTVQELE |
| Ga0079221_111173142 | 3300006804 | Agricultural Soil | MSDKKDNDVIRIDLTAEQKEQIKEATEKSADAIELTVQELEAR |
| Ga0068865_1017830402 | 3300006881 | Miscanthus Rhizosphere | MSDPKESHVVRIDLTPEQKEQVKAATEKTVDSIELTIQELEARIAPIALIE* |
| Ga0079215_113585692 | 3300006894 | Agricultural Soil | HLSLENKKMSDNKETQIVRIDLTNEQKEQVKAVTDQNVQAIELTVQELEARIAPAILM* |
| Ga0079216_100497823 | 3300006918 | Agricultural Soil | MSDNKETEIVRIDLTTEQKEQVKAATDQNVEAIELTVQELEARIAPA |
| Ga0079216_119686752 | 3300006918 | Agricultural Soil | MSDSKETEIVRIDLTNEQKEQVKAATDKSVDAIELTVQELEARIAPVKFY* |
| Ga0079218_108497722 | 3300007004 | Agricultural Soil | MSDNKETEIVRIDLTNEQKEKVKAATDQNVEAIELTVQELEARIAPAILM* |
| Ga0111539_104221972 | 3300009094 | Populus Rhizosphere | MSDNKETDIVRIDLTTEQKEQVKAATDKSADAIELTVQELEARIAPIVYR* |
| Ga0105245_126232952 | 3300009098 | Miscanthus Rhizosphere | RSHMSSQNENEIIRIDLTADQKAKLKDATNKSVEAIELTVQELEARIAPLHLT* |
| Ga0066709_1022500872 | 3300009137 | Grasslands Soil | MSDASEKEIVRIDLTNEQKDQIKAATEQNADAIELTVQELEARIAPLRF* |
| Ga0111538_109250022 | 3300009156 | Populus Rhizosphere | MSDSKETDIVRIDLTAEQKEQVKAATEKSAEAIELTVQELEARIAPIVHM* |
| Ga0105248_100662512 | 3300009177 | Switchgrass Rhizosphere | MSDKKENEVVRIDLTAEQKEQVKAATEKNADAIELTVQELEARIAPLHLS* |
| Ga0105249_118604423 | 3300009553 | Switchgrass Rhizosphere | MSDKKENEVVRIDLTAEQKEQVKAATEKNADAIELTVQE |
| Ga0105249_130085572 | 3300009553 | Switchgrass Rhizosphere | MSDSKENDIVRIDLTNEQKEQVKAATDKSVDAIELTVQELEARIAPIRFT* |
| Ga0126313_100682552 | 3300009840 | Serpentine Soil | MSDSKETDIVRIDLTAEQKEQVKAATDKSADAIELTVQELEARIAPIMYS* |
| Ga0126313_113891651 | 3300009840 | Serpentine Soil | MSSPSEKDIVRIDLTSEQKEQVKNATEKSAEAIELTVQEREA |
| Ga0126305_102997682 | 3300010036 | Serpentine Soil | MSDNKETQIVRIDLTSEQKEQVKAATDQNADAIELTVQELEARIAPIMHI* |
| Ga0126304_107804572 | 3300010037 | Serpentine Soil | MSDSKETEIVRIDLTNEQKEQVKAATEKSAEAIELTVQDLEARIAPIVRW* |
| Ga0126312_102296132 | 3300010041 | Serpentine Soil | MSDNKETKFVRIDLTNEQKEQVKAQTEKNVDAIELTVQELEARIAPAVFGG* |
| Ga0126320_10284272 | 3300010146 | Soil | MSESKESNVVRIDLTSEQKEQVKAATEKSVDAIELTVQELEARIAPIALME* |
| Ga0126320_14899902 | 3300010146 | Soil | MSDSKETDIVRIDLTAEQKEQVKAATDKTADAIELTVQELEARIAPLMHM* |
| Ga0126319_14486452 | 3300010147 | Soil | MMTDKKETDVVRIDLTAEQKAQVKEATEKNADAIEMTVQELEARIAPIHF* |
| Ga0126319_14486453 | 3300010147 | Soil | MTDKKETDVIRIDLTSEQKVQVKEATEKNADAIEMTVQELEARIAPRSLY* |
| Ga0126306_100312562 | 3300010166 | Serpentine Soil | MSDKKETEIVRIDLTTDQKEKVKAATDQNVEAIELTVQELEARIAPVMIR* |
| Ga0105239_128890272 | 3300010375 | Corn Rhizosphere | MTEKKENDVIRIDLTAEQKEQVKAVTEKNADAIELTVQELEARI |
| Ga0105239_131854721 | 3300010375 | Corn Rhizosphere | MSDNKESSIVRIDLTPEQKEQVKAATEKTVDSIELTIQELEARIAPIALIE* |
| Ga0134127_125982801 | 3300010399 | Terrestrial Soil | MSDSKETDIVRIDLTAEQKEQVKAATEKSAEAIELTVQELEARI |
| Ga0126317_110900531 | 3300011332 | Soil | MSDSKETDIVRIDLTTEQKEQVKAATEKSADAIELTVQELEARIAPMMHL* |
| Ga0127502_106623391 | 3300011333 | Soil | MSDSKETDIVRIDLTNEQKEQVKAATDKSADAIELTVQELEARIAPVSFR* |
| Ga0137383_110527352 | 3300012199 | Vadose Zone Soil | MSSHNEKEIVRIDLTQQQKDKVKSVTDKNAEAIEMTVQELEARITPTIAL* |
| Ga0137376_106610881 | 3300012208 | Vadose Zone Soil | MSPHNEKEIVRIDLTQQQKDKVKSVTDKNAEAIEMTVQELEARITPTIAL* |
| Ga0150985_1020855352 | 3300012212 | Avena Fatua Rhizosphere | MSDIKPTDIIRIDLTTEQKEQVKAATEKSADAIELTVQELEARIAPVAPFSADE* |
| Ga0150985_1020855353 | 3300012212 | Avena Fatua Rhizosphere | MSDSKETDIIRIDLTNEQKEQVKAATDKSADAIELTVQELEARIAPLYIR* |
| Ga0150985_1030114572 | 3300012212 | Avena Fatua Rhizosphere | MSDSKETEIVRIDLTAEQKEQVKAATDMTADAIELTVQELEARIAPVMHM* |
| Ga0150985_1030141461 | 3300012212 | Avena Fatua Rhizosphere | MSDSKETDIIRIDLTAEQKEQVKAATDKTADAIELTVQELEARIAPVMHM* |
| Ga0150985_1032506282 | 3300012212 | Avena Fatua Rhizosphere | MSNQNEKAIVRIDLTPDQKAKIKAATDKSAEAIELTVQELEARIAPRMVV* |
| Ga0150985_1149615002 | 3300012212 | Avena Fatua Rhizosphere | MSDSKETEIVRIDLTAEQKEQVKAATDKSADAIELTVQELEARIAPIMHM* |
| Ga0150985_1159130893 | 3300012212 | Avena Fatua Rhizosphere | MSDSKETDIVRIDLTAEQKEQVKAATDKSADAIELTVQELEARIAPIVHM* |
| Ga0150985_1201895051 | 3300012212 | Avena Fatua Rhizosphere | MSNQNENEIVRIDLTADQKAKLKDATNKSVDAIELTVQELESRIAPLRVY* |
| Ga0150984_1038652831 | 3300012469 | Avena Fatua Rhizosphere | MSDSKETEIVRIDLTAEQKEQVKAATDKTADAIELTVQELEARIAPLMHM* |
| Ga0150984_1147366661 | 3300012469 | Avena Fatua Rhizosphere | MSDSKETDIIRIDLTNEQKEQVKAATDKSADAIELTVQELEARIAPVSPFSAHE* |
| Ga0164300_111144382 | 3300012951 | Soil | MSDKKENEVVRIDLTAEQKEQVKAATEKNADAIELTGQELEARIAPLHPSSAVQ |
| Ga0164298_100961741 | 3300012955 | Soil | LNEKDIVRIVLTYYFIVKNTATTEKSVEAIELTVQELEARIAPRALFSDE* |
| Ga0164303_111700101 | 3300012957 | Soil | DKKENEVVRIDLTAEQKEQVKAATEKNADAIELTVQELEARIAPLHLS* |
| Ga0164299_102278772 | 3300012958 | Soil | MSDKKENEVVRIDLTAEQKEQVKAATEKNADAIELTVQELEARIAPLPLS* |
| Ga0164301_102176113 | 3300012960 | Soil | MSDKKENEVVRIDLTAEQKEQVKAATEKNADAIELTVQELE |
| Ga0164308_102182162 | 3300012985 | Soil | MSDSEKDIVRSALTDEYNDQIKAATEKSVEAIELTVQELEARIAPRALFSDE* |
| Ga0157373_115201321 | 3300013100 | Corn Rhizosphere | MSDASEKDIVRIDLTAEQKDQIKAATEKSAEAIELTVQELEARIARRAISSE* |
| Ga0157373_115201322 | 3300013100 | Corn Rhizosphere | MTEHKKSDVIRIDLTNEQKEQVKEATEKNADAIELTVQELEA |
| Ga0157371_104691431 | 3300013102 | Corn Rhizosphere | MTEKKENDVIRIDLTAKQKEQVKAVTEKNADAIELTVQELEARIAPIVHM* |
| Ga0157372_127899082 | 3300013307 | Corn Rhizosphere | MSDSKQNDVIRIDLTTEQKEQVKAATEKSAEAIELTVQELESRIAPFAPIVSDE* |
| Ga0182007_101138082 | 3300015262 | Rhizosphere | MSDNKETDIVRIDLTAEQKEQVKAATEKSAEAIELTVQELEARIAPRIYY* |
| Ga0132258_118018902 | 3300015371 | Arabidopsis Rhizosphere | MSNQNENEIVRIDLTADQKAKLKDATNKSVEAIELTVQELEARIAPKMII* |
| Ga0132258_134238073 | 3300015371 | Arabidopsis Rhizosphere | MSDPSEKDIVRIDLTQEQKDQIKAATEKSVEAIEFTVQELESRIAPRALFIDE* |
| Ga0190274_115352372 | 3300018476 | Soil | MSDSKETDIVRIDLTNEQKEQVKAATDKSVDAIELTVQELEARIAPVRFT |
| Ga0190274_123297901 | 3300018476 | Soil | NEAEVVRIDLTKEQKEQVKAATDKNVDSIELTVQELEARIAPVAHF |
| Ga0180114_13817891 | 3300019232 | Groundwater Sediment | MSDSKETDIVRIDLTNEQKEQVKAATDQSADAIELTVQELEARIAPRYFA |
| Ga0173482_104697081 | 3300019361 | Soil | MSKQNEKSIVRIDLTPDQKAKIKAATDQSAEAIELTVQELEARIA |
| Ga0206352_106836872 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTKKEDQIVRIDLTQEQKDQVKTITDQNAEAIELTVKELEARITPLRVY |
| Ga0206353_110041281 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTKKEDQIVRIDLTQEQKDQVKTITDQNAEAIELTVKELEARITPIRVW |
| Ga0213900_1068612 | 3300021280 | Soil | MSDNKESEIVRIDLTNEQKEQVKAATDKSVDAIELTVQELEARIAPVKFY |
| Ga0182009_100963301 | 3300021445 | Soil | GARRMSTKNEKEIVRIDLTQDQKEKVKSVTDKNAEAIEMTVQELEARITPLTLG |
| Ga0182009_102168872 | 3300021445 | Soil | MSIKNEKEIVRIDLTQDQKEKVKSVTDKNAEAIEMTVQELEARI |
| Ga0182009_102483941 | 3300021445 | Soil | MSENKEAHVVRIDLTPQQKEQVKAATEKSVDSIELTVQELEARIAPIALIE |
| Ga0182009_103439391 | 3300021445 | Soil | TMSDNKETDIVRIDLTAEQKEQVKAATEKSAEAIELTVQELEARIAPRIYY |
| Ga0182009_103897282 | 3300021445 | Soil | MSEKKESNVVRIDLTPEQKEQVKAATDKTVDSLELTVQELEARIAPIALMD |
| Ga0222622_100165101 | 3300022756 | Groundwater Sediment | MSDSKQNDVIRIDLTAEQKEQVKAATEKSVDALELTVQELEARIAPMVQF |
| Ga0207697_100249293 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDNKESSVVRIDLTPEQKEQVKAATEKTVDSIELTIQELEARIAPIALIE |
| Ga0207682_100141613 | 3300025893 | Miscanthus Rhizosphere | MSDSKETDIVRIDLTAEQKEQVKAATEKSAEAIELTVQELEARIAPVKFY |
| Ga0207642_105674941 | 3300025899 | Miscanthus Rhizosphere | MSDKKENEVVRIDLTAEQKEQVKAATEKNADAIELTVQELEARIAPLHLT |
| Ga0207645_103449871 | 3300025907 | Miscanthus Rhizosphere | MSDKNQNEVVRIDLTAEQKEQVKAATEKSAEAIELTVQELEARIAPLHLS |
| Ga0207645_109818111 | 3300025907 | Miscanthus Rhizosphere | MSDKKENEVVRIDLTAEQKEQVKAATEKNADAIELTVQELEARI |
| Ga0207643_110087831 | 3300025908 | Miscanthus Rhizosphere | MSDNKETDIVRIDLTAEQKEQVKAATDKSAEAIELTVQELEARIAPLRI |
| Ga0207643_110087832 | 3300025908 | Miscanthus Rhizosphere | DPKESHVVRIDLTPEQKEQVKAATEKSVDSIELTIQELEARIAPIALIE |
| Ga0207705_104205435 | 3300025909 | Corn Rhizosphere | MSDSKQNDVIRIDLTTEQKEQVKAATEKSADAIELTVQELEARIA |
| Ga0207705_106130421 | 3300025909 | Corn Rhizosphere | VTMSSQNENEIIRIDLTADQKAKLKDSTNKSVEAIELTVQELEARIAPLRVY |
| Ga0207657_100460652 | 3300025919 | Corn Rhizosphere | MTEKKENDVIRIDLTAEQKEKVKAATEKNADAIELTVQELEARIAPLRF |
| Ga0207657_109828591 | 3300025919 | Corn Rhizosphere | MSDNKETDIIRIDLTAEQKEQVKAATEKSAEAIELTVQELEARIAPRFI |
| Ga0207652_103399343 | 3300025921 | Corn Rhizosphere | MSDNKDSSVVRIDLTPEQKEQVKAATEKTVDSIELTIQELEARIAPIKL |
| Ga0207650_108779862 | 3300025925 | Switchgrass Rhizosphere | MSDPKESHVVRIDLTPEQKEQVKAATEKTVDSIELTIQELEARIAPIALIE |
| Ga0207659_103086592 | 3300025926 | Miscanthus Rhizosphere | MSKQNEKSIVRIDLTPDQKAKIKAATDQSAEAIELTVQELEARIAPRVILD |
| Ga0207644_101406802 | 3300025931 | Switchgrass Rhizosphere | MSEKNQNEVVRIDLTAEQKEQVKAATEKSAEAIELTVQELEARIAPLHLS |
| Ga0207644_114679232 | 3300025931 | Switchgrass Rhizosphere | MSSQNENEIIRIDLTADQKAKLKDATNKSVEAIELTVQEL |
| Ga0207690_109965242 | 3300025932 | Corn Rhizosphere | TTMTEKKENDVIRIDLTAEQKEKVKAATEKNADAIELTVQELEARIAPLRF |
| Ga0207706_101971813 | 3300025933 | Corn Rhizosphere | MSDSKETDIVRIDLTNEQKEQVKAATDKSVDAIELTVQELEARIAPVYFH |
| Ga0207706_105703781 | 3300025933 | Corn Rhizosphere | MSDKKENEVVRIDLTAEQIEQVKAATEKNADAIELTVQELEARIAPLHLT |
| Ga0207691_101033104 | 3300025940 | Miscanthus Rhizosphere | VVRIDLTPEQKEQVKAATEKTVDSIELTIQELEARIAPIALIE |
| Ga0207691_101913693 | 3300025940 | Miscanthus Rhizosphere | MSDNKESSVVRIDLTPEQKEQVKAATEKTVDSIELTIQEL |
| Ga0207691_102228291 | 3300025940 | Miscanthus Rhizosphere | MSNQNENEIVRIDLTADQKAKLKDATNKSVDAIELTVQELESRIAPMRIG |
| Ga0207691_103542301 | 3300025940 | Miscanthus Rhizosphere | MSDPKESHVVRIDLTPEQKEQVKAATEKTVDSIELTIQEL |
| Ga0207711_106855511 | 3300025941 | Switchgrass Rhizosphere | MSDKNQNEVVRIDLTAEQKEQVKAATEKSAEAIELTVQELE |
| Ga0207689_113577201 | 3300025942 | Miscanthus Rhizosphere | MSDNKETDIVRIDLTAEQKEQVKAATDKSAEAIELTVQELEARI |
| Ga0207661_111665951 | 3300025944 | Corn Rhizosphere | LSRITMSNPNQNEKTIVRIDLTPEQKEKVKAATDKSAEAIELTVQELEARIAPVVLG |
| Ga0207679_106369611 | 3300025945 | Corn Rhizosphere | MSDPKESHVVRIDLTPEQKEQVKAATEKSVDSIELTIQELEARIAPIALIE |
| Ga0207651_103754352 | 3300025960 | Switchgrass Rhizosphere | MSDKKENEVVRIDLTAEQKEQVKAATEKSAEAIELTVQELEARIAPLRLS |
| Ga0207639_113206772 | 3300026041 | Corn Rhizosphere | MSDNKESNLVRIDLTPEQKEQVKAATDKSVDSIELTVQELEARIAPIALIE |
| Ga0207678_116515461 | 3300026067 | Corn Rhizosphere | MSDSKQNDVIRIDLTAEQKEQVKAATEKSVDALELAVQELEARIA |
| Ga0207708_112319742 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNSEKEIVRIDLTSDQKEQVKAATEKSADAIELTVQELEARIA |
| Ga0207708_118666942 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | KESSVVRIDLTPEQKEQVKAATEKTVDSIELTIQELEARIAPIALIE |
| Ga0207648_101075452 | 3300026089 | Miscanthus Rhizosphere | MSDKKENEVVRIDLTAEQKEQVKAATEKNADAIELTVQELEARIAPPHLT |
| Ga0207683_102601663 | 3300026121 | Miscanthus Rhizosphere | MSDNKDSSVVRIDLTPEQKEQVKAATEKTVDSIELTIQELEARIAPIKLID |
| Ga0207698_122745781 | 3300026142 | Corn Rhizosphere | MSDKNQNEVVRIDLTAEQKEQVKAATEKSAEAIELTVQELEARI |
| Ga0247828_105306212 | 3300028587 | Soil | TMSDNKETDIVRIDLTNEQKEQVKAATDKSADAIELTVQELEARIAPIMYS |
| Ga0247820_110449342 | 3300028597 | Soil | TYPFSRPTMSDNKETDIVRIDLTNEQKEQVKAATDKSADAIELTVQELEARIAPIMYS |
| Ga0307280_101251302 | 3300028768 | Soil | MSDSKETEIVRIDLTAEQKEQVKAATDKSADAIELTVQELEARIAPMMHI |
| Ga0247827_102811732 | 3300028889 | Soil | MSDNKETDIVRIDLTNEQKEQVKAATDKSADAIELTVQELEARIAPIMYS |
| Ga0247826_104847723 | 3300030336 | Soil | MSDNKESEIVRIDLTSEQKEQVKAATDQNVEAIELTVQELEARIAPRVMLD |
| Ga0268240_100015613 | 3300030496 | Soil | MSEKKEANIVRIDLTPEQKEQVKAATEKSVDSIELTIQELEARIAPIALIE |
| Ga0268240_100116823 | 3300030496 | Soil | MSDNKESNVVRIDLTPEQKEQVKAATDKTVDSIELTIQELEARIAPIAFIE |
| Ga0308183_11631532 | 3300030988 | Soil | MSDSKETDIVRIDLTNEQKDQVKAATDKSVEAIELTVQELEARIAPRKTF |
| Ga0308181_11014082 | 3300031099 | Soil | MSDSKETDIVRIDLTSEQKEQVKAATDKSVDAIELTVQELEARIAPVRFT |
| Ga0308187_102756671 | 3300031114 | Soil | SSSPTMSDSKQNDVIRIDLTAEQKEQVKAATEKSVDALELTVQELEARIAPMVQF |
| Ga0307506_104146682 | 3300031366 | Soil | MSDASEKDFVRIDLTSEQKDQIKAATEKSAEALELTVQELEARIAPRTLLTDD |
| Ga0307408_1004066973 | 3300031548 | Rhizosphere | MSDNKETDIVRIDLTADQKEQVKAVTDQNVEAIELTVQELEARIAPVKVY |
| Ga0307413_101155162 | 3300031824 | Rhizosphere | MSDNKETEIVRIDLTNDQKEKVKAATDQNVEAIELTVQELEARIAPVKVY |
| Ga0307413_119453192 | 3300031824 | Rhizosphere | MSDSKDTYIIRIDLTNEQKEQVKAATDKSADAIELTVQELEARIAPIMHL |
| Ga0307410_104413831 | 3300031852 | Rhizosphere | MSDSKDTNIIRIDLTNEQKEQVKAATDKSADAIELTVQELEA |
| Ga0308175_1000268653 | 3300031938 | Soil | MSDNKDANIVRIDLTTEQKEQVKAATEKSAEAIELTVQELEARIAPKVAF |
| Ga0308175_1000268654 | 3300031938 | Soil | MSEKKESNVVRIDLTPEQKEQVKAATDKTVDSLELTVQELEARIAPVAFIE |
| Ga0308175_1001205874 | 3300031938 | Soil | MTTKNEKNEIVRIDLTPEQKQQVKDVTDKSAEAIEMTVQELEARIAPLFMQ |
| Ga0308175_1003967442 | 3300031938 | Soil | MSTKNEDQIVRIDLTQQQKDQVKTVIDKNAEAIELTVKELEARITPMRVV |
| Ga0308175_1009514172 | 3300031938 | Soil | MSKKEKEIVRIDLTIEQKEKVKNATDKSAEAIELTIEELEAKIAPKIVL |
| Ga0308175_1010126142 | 3300031938 | Soil | MSTKKEDQIVRIDLTQQQKDQVKTITDQNAEAIELTVKELEARITPYRMY |
| Ga0308175_1021695862 | 3300031938 | Soil | MSNQNENEIVRIDLTVDQKAKLKEATDKTVDAIELTVSELESRIAPLRVLG |
| Ga0308175_1029319131 | 3300031938 | Soil | MSDHKKTDVVRIDLTAEQKEQVKAATDKSADAIELTVQELEARIAPIVYR |
| Ga0308174_100867263 | 3300031939 | Soil | MSDSKETEIVRIDLTAEQKEQVKAATDKTADAIELTVQELEARIAPLMYR |
| Ga0308174_102931933 | 3300031939 | Soil | MSNQNENEKTIVRIDLTPEQKEQVKAATEKSAEAIELTVQELEARIAPMIVG |
| Ga0308174_111911292 | 3300031939 | Soil | MSDSKETDIVRIDLTAEQKEQVKAATDKTADAIELTVQELEARIAPVMHM |
| Ga0308174_116592852 | 3300031939 | Soil | MSSDNDNEIVRIDLTTEQKAQVKNATEKSAEAIELTVQELEARIAPRVLFDE |
| Ga0308176_100808133 | 3300031996 | Soil | MSDSKETDIVRIDLTTEQKQQVKAATDKTADAIELTVQELEARIAPLRF |
| Ga0308176_102336554 | 3300031996 | Soil | MSTKNENDIVRIDLTQEQKEKVKTVTDKNAEAIELTVKELEAR |
| Ga0308176_102447744 | 3300031996 | Soil | MSDNKETDIVRIDLTAEQKEQVKAATEKSAEAIELTVQELEARIAPIVHM |
| Ga0308176_105121043 | 3300031996 | Soil | MSSQNNDQIVRIDLTEQQKTQVKNVTEKSADAIELTVQELEARIAP |
| Ga0308176_112724731 | 3300031996 | Soil | MSNQNENEIVRIDLTIDQKAKLKEATDKTVDAIELTVSELESRIAPLRVLG |
| Ga0307411_103023851 | 3300032005 | Rhizosphere | MSDNKETEIVRIDLTNDQKEKVKAATDQNVEAIELTVQELEARI |
| Ga0310810_100318856 | 3300033412 | Soil | MSDNKETEIVRIDLTEEQKEQVKAVTERSAEAIELTVQELESRIAPKMLY |
| Ga0310811_106704814 | 3300033475 | Soil | MEASRANEVVRIDLSPTQVQVVKAATGREAEALELTVQEL |
| Ga0247829_105434821 | 3300033550 | Soil | MSDNKETDIVRIDLTNEQKEQVKAATDKSADAIELTVQELEA |
| Ga0314780_162696_387_539 | 3300034659 | Soil | MSDSKETDIVRIDLTPEQQEKVKAVTDQSAEAIELTVQELEARIAPMRYT |
| Ga0314780_162696_89_253 | 3300034659 | Soil | MSDNKQNEIVRIDLTSEQKEQVKTATDQNVEAIELTVQELEARIAPFVGLNPEE |
| Ga0314788_185380_379_528 | 3300034666 | Soil | MSDSKETDIVRIDLTNEQKEQVKAATDKSADAIELTVQELEARIAPVYFH |
| ⦗Top⦘ |