Basic Information | |
---|---|
Family ID | F027180 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 195 |
Average Sequence Length | 43 residues |
Representative Sequence | MAMKLFNRKPEVIEEDTFTKLDRLMGEMASIDIYIEYLREREGM |
Number of Associated Samples | 106 |
Number of Associated Scaffolds | 195 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 88.21 % |
% of genes near scaffold ends (potentially truncated) | 14.36 % |
% of genes from short scaffolds (< 2000 bps) | 70.77 % |
Associated GOLD sequencing projects | 96 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (52.821 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (20.513 % of family members) |
Environment Ontology (ENVO) | Unclassified (57.436 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (50.769 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.72% β-sheet: 0.00% Coil/Unstructured: 65.28% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 195 Family Scaffolds |
---|---|---|
PF06067 | DUF932 | 6.67 |
PF02467 | Whib | 6.15 |
PF04760 | IF2_N | 4.10 |
PF00011 | HSP20 | 0.51 |
PF01551 | Peptidase_M23 | 0.51 |
PF09572 | RE_XamI | 0.51 |
PF12705 | PDDEXK_1 | 0.51 |
COG ID | Name | Functional Category | % Frequency in 195 Family Scaffolds |
---|---|---|---|
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.51 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.77 % |
Unclassified | root | N/A | 9.23 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000756|JGI12421J11937_10020462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2442 | Open in IMG/M |
3300000756|JGI12421J11937_10150287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300001282|B570J14230_10019208 | All Organisms → Viruses → Predicted Viral | 2516 | Open in IMG/M |
3300001282|B570J14230_10169809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
3300002408|B570J29032_109199620 | Not Available | 632 | Open in IMG/M |
3300002835|B570J40625_100016269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12958 | Open in IMG/M |
3300002835|B570J40625_100089597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3893 | Open in IMG/M |
3300002835|B570J40625_100092372 | All Organisms → Viruses → Predicted Viral | 3805 | Open in IMG/M |
3300002835|B570J40625_100222947 | All Organisms → Viruses → Predicted Viral | 2007 | Open in IMG/M |
3300002835|B570J40625_100913861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
3300002835|B570J40625_101029806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
3300002835|B570J40625_101216137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
3300003412|JGI25912J50252_10133467 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
3300003490|JGI25926J51410_1002535 | All Organisms → Viruses → Predicted Viral | 3719 | Open in IMG/M |
3300004112|Ga0065166_10147062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 897 | Open in IMG/M |
3300004240|Ga0007787_10172934 | All Organisms → Viruses → Predicted Viral | 1044 | Open in IMG/M |
3300005527|Ga0068876_10134079 | All Organisms → Viruses → Predicted Viral | 1463 | Open in IMG/M |
3300005527|Ga0068876_10202682 | All Organisms → Viruses → Predicted Viral | 1151 | Open in IMG/M |
3300005527|Ga0068876_10588049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
3300005581|Ga0049081_10022916 | All Organisms → Viruses → Predicted Viral | 2370 | Open in IMG/M |
3300005581|Ga0049081_10042134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1732 | Open in IMG/M |
3300005581|Ga0049081_10130785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 926 | Open in IMG/M |
3300005662|Ga0078894_10567513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1013 | Open in IMG/M |
3300005805|Ga0079957_1174264 | All Organisms → Viruses → Predicted Viral | 1066 | Open in IMG/M |
3300005941|Ga0070743_10141279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
3300006484|Ga0070744_10003014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5078 | Open in IMG/M |
3300006484|Ga0070744_10036199 | All Organisms → Viruses → Predicted Viral | 1457 | Open in IMG/M |
3300006484|Ga0070744_10060546 | All Organisms → Viruses → Predicted Viral | 1104 | Open in IMG/M |
3300006484|Ga0070744_10066752 | All Organisms → Viruses → Predicted Viral | 1046 | Open in IMG/M |
3300006484|Ga0070744_10133559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
3300006484|Ga0070744_10137036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
3300006639|Ga0079301_1017843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2518 | Open in IMG/M |
3300007538|Ga0099851_1087285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1197 | Open in IMG/M |
3300008107|Ga0114340_1261067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300008108|Ga0114341_10048634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6291 | Open in IMG/M |
3300008108|Ga0114341_10100373 | All Organisms → Viruses → Predicted Viral | 1760 | Open in IMG/M |
3300008108|Ga0114341_10105979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2538 | Open in IMG/M |
3300008108|Ga0114341_10195923 | All Organisms → Viruses → Predicted Viral | 1755 | Open in IMG/M |
3300008110|Ga0114343_1065469 | All Organisms → Viruses → Predicted Viral | 1351 | Open in IMG/M |
3300008111|Ga0114344_1006370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12672 | Open in IMG/M |
3300008113|Ga0114346_1112389 | All Organisms → Viruses → Predicted Viral | 1227 | Open in IMG/M |
3300008114|Ga0114347_1054363 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1691 | Open in IMG/M |
3300008116|Ga0114350_1073742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1155 | Open in IMG/M |
3300008116|Ga0114350_1128924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
3300008116|Ga0114350_1182475 | Not Available | 537 | Open in IMG/M |
3300008117|Ga0114351_1090691 | All Organisms → Viruses → Predicted Viral | 1803 | Open in IMG/M |
3300008262|Ga0114337_1350026 | Not Available | 503 | Open in IMG/M |
3300008450|Ga0114880_1035166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2212 | Open in IMG/M |
3300008450|Ga0114880_1044683 | All Organisms → Viruses → Predicted Viral | 1902 | Open in IMG/M |
3300008450|Ga0114880_1104946 | All Organisms → Viruses → Predicted Viral | 1086 | Open in IMG/M |
3300008962|Ga0104242_1004548 | All Organisms → Viruses → Predicted Viral | 2571 | Open in IMG/M |
3300009059|Ga0102830_1088981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 918 | Open in IMG/M |
3300009068|Ga0114973_10511514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
3300009152|Ga0114980_10001751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15433 | Open in IMG/M |
3300009155|Ga0114968_10177296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1248 | Open in IMG/M |
3300009163|Ga0114970_10741503 | Not Available | 520 | Open in IMG/M |
3300009165|Ga0105102_10583713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
3300009184|Ga0114976_10029892 | All Organisms → Viruses → Predicted Viral | 3281 | Open in IMG/M |
3300009419|Ga0114982_1012794 | All Organisms → Viruses → Predicted Viral | 2920 | Open in IMG/M |
3300010354|Ga0129333_10411888 | All Organisms → Viruses → Predicted Viral | 1195 | Open in IMG/M |
3300011268|Ga0151620_1038061 | All Organisms → Viruses → Predicted Viral | 1617 | Open in IMG/M |
3300011268|Ga0151620_1071072 | All Organisms → Viruses → Predicted Viral | 1121 | Open in IMG/M |
3300012663|Ga0157203_1011899 | All Organisms → Viruses → Predicted Viral | 1405 | Open in IMG/M |
3300012663|Ga0157203_1012288 | All Organisms → Viruses → Predicted Viral | 1375 | Open in IMG/M |
3300012665|Ga0157210_1002653 | All Organisms → Viruses → Predicted Viral | 4479 | Open in IMG/M |
3300013004|Ga0164293_10098537 | All Organisms → Viruses → Predicted Viral | 2248 | Open in IMG/M |
3300013004|Ga0164293_10566912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
3300013005|Ga0164292_10139864 | All Organisms → Viruses → Predicted Viral | 1781 | Open in IMG/M |
3300013005|Ga0164292_10535429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
3300013372|Ga0177922_10513265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1232 | Open in IMG/M |
3300017736|Ga0181365_1021859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1612 | Open in IMG/M |
3300019784|Ga0181359_1024379 | All Organisms → Viruses → Predicted Viral | 2308 | Open in IMG/M |
3300020141|Ga0211732_1151451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
3300020141|Ga0211732_1247897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
3300020141|Ga0211732_1330720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 985 | Open in IMG/M |
3300020141|Ga0211732_1373359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8113 | Open in IMG/M |
3300020151|Ga0211736_10916286 | All Organisms → Viruses → Predicted Viral | 1078 | Open in IMG/M |
3300020151|Ga0211736_10992384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 866 | Open in IMG/M |
3300020159|Ga0211734_10702849 | Not Available | 732 | Open in IMG/M |
3300020160|Ga0211733_10721782 | All Organisms → Viruses → Predicted Viral | 1269 | Open in IMG/M |
3300020160|Ga0211733_10919714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
3300020161|Ga0211726_10138163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
3300020161|Ga0211726_11033275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
3300020162|Ga0211735_10541621 | All Organisms → Viruses → Predicted Viral | 1881 | Open in IMG/M |
3300020162|Ga0211735_10947069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
3300020205|Ga0211731_10505697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1359 | Open in IMG/M |
3300020205|Ga0211731_11026457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 927 | Open in IMG/M |
3300020506|Ga0208091_1013938 | Not Available | 970 | Open in IMG/M |
3300020515|Ga0208234_1002981 | All Organisms → Viruses → Predicted Viral | 2510 | Open in IMG/M |
3300020515|Ga0208234_1022364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 734 | Open in IMG/M |
3300020527|Ga0208232_1013620 | All Organisms → Viruses → Predicted Viral | 1224 | Open in IMG/M |
3300020527|Ga0208232_1038676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
3300020530|Ga0208235_1012403 | All Organisms → Viruses → Predicted Viral | 1081 | Open in IMG/M |
3300020560|Ga0208852_1000766 | Not Available | 8662 | Open in IMG/M |
3300020562|Ga0208597_1003173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5509 | Open in IMG/M |
3300020562|Ga0208597_1014585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1942 | Open in IMG/M |
3300021961|Ga0222714_10035101 | All Organisms → Viruses → Predicted Viral | 3670 | Open in IMG/M |
3300021961|Ga0222714_10042275 | All Organisms → Viruses → Predicted Viral | 3250 | Open in IMG/M |
3300021961|Ga0222714_10064880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2447 | Open in IMG/M |
3300021961|Ga0222714_10112006 | All Organisms → Viruses → Predicted Viral | 1702 | Open in IMG/M |
3300021963|Ga0222712_10054477 | All Organisms → Viruses → Predicted Viral | 2966 | Open in IMG/M |
3300021963|Ga0222712_10078444 | All Organisms → Viruses → Predicted Viral | 2367 | Open in IMG/M |
3300021963|Ga0222712_10079482 | All Organisms → Viruses → Predicted Viral | 2347 | Open in IMG/M |
3300021963|Ga0222712_10134378 | All Organisms → Viruses → Predicted Viral | 1688 | Open in IMG/M |
3300021963|Ga0222712_10671452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
3300022407|Ga0181351_1049512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1757 | Open in IMG/M |
3300023174|Ga0214921_10048962 | All Organisms → Viruses → Predicted Viral | 3752 | Open in IMG/M |
3300024346|Ga0244775_10262176 | All Organisms → Viruses → Predicted Viral | 1438 | Open in IMG/M |
3300024346|Ga0244775_10274268 | All Organisms → Viruses → Predicted Viral | 1402 | Open in IMG/M |
3300024346|Ga0244775_10369779 | All Organisms → Viruses → Predicted Viral | 1181 | Open in IMG/M |
3300024346|Ga0244775_10903455 | Not Available | 701 | Open in IMG/M |
3300024346|Ga0244775_11019826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
3300024346|Ga0244775_11073652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
3300024346|Ga0244775_11419043 | Not Available | 533 | Open in IMG/M |
3300027114|Ga0208009_1011058 | All Organisms → Viruses → Predicted Viral | 2215 | Open in IMG/M |
3300027608|Ga0208974_1005724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4254 | Open in IMG/M |
3300027608|Ga0208974_1028267 | All Organisms → Viruses → Predicted Viral | 1703 | Open in IMG/M |
3300027608|Ga0208974_1053803 | All Organisms → Viruses → Predicted Viral | 1151 | Open in IMG/M |
3300027631|Ga0208133_1156860 | Not Available | 524 | Open in IMG/M |
3300027659|Ga0208975_1035218 | All Organisms → Viruses → Predicted Viral | 1582 | Open in IMG/M |
3300027659|Ga0208975_1138842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
3300027659|Ga0208975_1210849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
3300027710|Ga0209599_10000365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 30952 | Open in IMG/M |
3300027710|Ga0209599_10018808 | All Organisms → Viruses → Predicted Viral | 1968 | Open in IMG/M |
3300027710|Ga0209599_10162914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
(restricted) 3300027728|Ga0247836_1327894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300027734|Ga0209087_1069961 | All Organisms → Viruses → Predicted Viral | 1547 | Open in IMG/M |
3300027754|Ga0209596_1140362 | All Organisms → Viruses → Predicted Viral | 1086 | Open in IMG/M |
3300027759|Ga0209296_1001796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15846 | Open in IMG/M |
3300027785|Ga0209246_10263544 | Not Available | 666 | Open in IMG/M |
3300027797|Ga0209107_10013967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4555 | Open in IMG/M |
3300027804|Ga0209358_10095772 | All Organisms → Viruses → Predicted Viral | 1659 | Open in IMG/M |
3300027816|Ga0209990_10122506 | All Organisms → Viruses → Predicted Viral | 1248 | Open in IMG/M |
3300027963|Ga0209400_1015362 | All Organisms → Viruses → Predicted Viral | 4665 | Open in IMG/M |
3300027973|Ga0209298_10001706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14166 | Open in IMG/M |
3300028025|Ga0247723_1007262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4718 | Open in IMG/M |
3300028025|Ga0247723_1014831 | All Organisms → Viruses → Predicted Viral | 2821 | Open in IMG/M |
3300028025|Ga0247723_1016312 | All Organisms → Viruses → Predicted Viral | 2632 | Open in IMG/M |
3300028025|Ga0247723_1018161 | All Organisms → Viruses → Predicted Viral | 2439 | Open in IMG/M |
3300028025|Ga0247723_1037439 | All Organisms → Viruses → Predicted Viral | 1471 | Open in IMG/M |
3300028025|Ga0247723_1056138 | All Organisms → Viruses → Predicted Viral | 1105 | Open in IMG/M |
3300031758|Ga0315907_10017166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6812 | Open in IMG/M |
3300031784|Ga0315899_11060018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
3300031784|Ga0315899_11152225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
3300031787|Ga0315900_10285010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1381 | Open in IMG/M |
3300031787|Ga0315900_10612871 | Not Available | 793 | Open in IMG/M |
3300031787|Ga0315900_10642836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
3300031787|Ga0315900_10742122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
3300031787|Ga0315900_10765861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
3300031787|Ga0315900_11133080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
3300031857|Ga0315909_10248295 | All Organisms → Viruses → Predicted Viral | 1368 | Open in IMG/M |
3300031857|Ga0315909_10359340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1061 | Open in IMG/M |
3300031857|Ga0315909_10482657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
3300031951|Ga0315904_10727786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 829 | Open in IMG/M |
3300031963|Ga0315901_10032189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5337 | Open in IMG/M |
3300031963|Ga0315901_11154917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
3300032050|Ga0315906_10726234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
3300032050|Ga0315906_11135626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
3300032092|Ga0315905_10118867 | All Organisms → Viruses → Predicted Viral | 2654 | Open in IMG/M |
3300032093|Ga0315902_10776630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
3300032116|Ga0315903_10099695 | All Organisms → Viruses → Predicted Viral | 2778 | Open in IMG/M |
3300033992|Ga0334992_0021519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3988 | Open in IMG/M |
3300033992|Ga0334992_0104629 | Not Available | 1508 | Open in IMG/M |
3300033993|Ga0334994_0344725 | Not Available | 739 | Open in IMG/M |
3300033993|Ga0334994_0377709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
3300033994|Ga0334996_0038951 | All Organisms → Viruses → Predicted Viral | 3002 | Open in IMG/M |
3300033995|Ga0335003_0310250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
3300033996|Ga0334979_0215955 | All Organisms → Viruses → Predicted Viral | 1124 | Open in IMG/M |
3300033996|Ga0334979_0442346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
3300034013|Ga0334991_0040197 | All Organisms → Viruses → Predicted Viral | 2526 | Open in IMG/M |
3300034018|Ga0334985_0122474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1807 | Open in IMG/M |
3300034018|Ga0334985_0151693 | All Organisms → Viruses → Predicted Viral | 1580 | Open in IMG/M |
3300034018|Ga0334985_0447775 | Not Available | 759 | Open in IMG/M |
3300034018|Ga0334985_0491841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
3300034062|Ga0334995_0074143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2667 | Open in IMG/M |
3300034082|Ga0335020_0495026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
3300034093|Ga0335012_0027396 | All Organisms → Viruses → Predicted Viral | 3361 | Open in IMG/M |
3300034093|Ga0335012_0136827 | All Organisms → Viruses → Predicted Viral | 1343 | Open in IMG/M |
3300034093|Ga0335012_0367155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
3300034102|Ga0335029_0216983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1258 | Open in IMG/M |
3300034102|Ga0335029_0220011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1246 | Open in IMG/M |
3300034102|Ga0335029_0293959 | Not Available | 1028 | Open in IMG/M |
3300034102|Ga0335029_0531939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
3300034104|Ga0335031_0001534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17447 | Open in IMG/M |
3300034104|Ga0335031_0007271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8183 | Open in IMG/M |
3300034104|Ga0335031_0158154 | All Organisms → Viruses → Predicted Viral | 1562 | Open in IMG/M |
3300034104|Ga0335031_0538554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 702 | Open in IMG/M |
3300034105|Ga0335035_0037929 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3201 | Open in IMG/M |
3300034105|Ga0335035_0376285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 813 | Open in IMG/M |
3300034105|Ga0335035_0502718 | Not Available | 663 | Open in IMG/M |
3300034110|Ga0335055_0018686 | All Organisms → Viruses → Predicted Viral | 3230 | Open in IMG/M |
3300034120|Ga0335056_0485526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
3300034272|Ga0335049_0039917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3504 | Open in IMG/M |
3300034279|Ga0335052_0409014 | Not Available | 720 | Open in IMG/M |
3300034284|Ga0335013_0793373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 20.51% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 10.26% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 9.23% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.72% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 7.69% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 7.18% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 7.18% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.13% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.62% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.62% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 3.08% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 3.08% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.54% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.54% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.54% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.03% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.51% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.51% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.51% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.51% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.51% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.51% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020515 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020560 | Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020562 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12421J11937_100204623 | 3300000756 | Freshwater And Sediment | MKLFNKKPEVIEEDTFTKLDRMMSEMASTEIYIEYLQERERV* |
JGI12421J11937_101502871 | 3300000756 | Freshwater And Sediment | MAIKLFNKKSKVREVILDSDVVFTKLDKLMSEMASKEIHKEYLKLRKGM* |
B570J14230_100192089 | 3300001282 | Freshwater | MRLFNKKPELIEDTFTKLDRLMGEMASIDIYIEYLELREGM* |
B570J14230_101698092 | 3300001282 | Freshwater | MKLFNKKPELTEDEVYAKLDKLMGKMASIDVYLEYLELREGM* |
B570J29032_1091996203 | 3300002408 | Freshwater | MIVFNLFNRKPVEDTFTKLDRLMSEMATTNTYIEYLREREGM* |
B570J40625_1000162693 | 3300002835 | Freshwater | MAMKLFNKKSELTEDEVYARLDKLMGEMSSIDIYLEYLELREGM* |
B570J40625_1000895971 | 3300002835 | Freshwater | MAMKLFNKKPELTEDEVYAKLDKLMGKMASIDVYLEYLELREGM* |
B570J40625_1000923726 | 3300002835 | Freshwater | MRLFNRKPVEDTFTKLDRLMSEMASTETYVAYLREREGM* |
B570J40625_1002229474 | 3300002835 | Freshwater | MAIRLFNKKSELTEDEVFAKLDFLMGKMANLDTYLEYLELREGM* |
B570J40625_1009138613 | 3300002835 | Freshwater | MAMRLFNKKPELIEDTFTKLDRLMGEMASIDIYIEYLELREGM* |
B570J40625_1010298061 | 3300002835 | Freshwater | MAIKLFNRKPEEDVFVTLDRLMGKMASTETYIEYLREREGMLYSNYWKR* |
B570J40625_1012161371 | 3300002835 | Freshwater | MAIKLFNKQPELTEQEVFAKLDTLMGKMSTIDVYLEYLEIREGMYV* |
JGI25912J50252_101334672 | 3300003412 | Freshwater Lake | MAIKLFNKKPEDVFVKLDKLMSDMASPEIYIEYLKERAGM* |
JGI25926J51410_10025356 | 3300003490 | Freshwater Lake | MAIRLFNKKPTEDTFTKLDKLMSEMATPDTYIEYLREREGM* |
Ga0065166_101470623 | 3300004112 | Freshwater Lake | MAIRLFNRKPTEDVFTKLDRLMSQMATSDTYIEYLREREGM* |
Ga0007787_101729344 | 3300004240 | Freshwater Lake | MAMKLFNRKPAEDVFTKLDRLMSEMASTETYVAYLREREGM* |
Ga0068876_101340796 | 3300005527 | Freshwater Lake | MKLFNRKPKFQEIILDSDVVFTKLDKLMGEMASIDVYIEYLELREGM* |
Ga0068876_102026823 | 3300005527 | Freshwater Lake | MAIKLFNRKPTEDVFTKLDKLMSEMASSDTYIEYLREREGM* |
Ga0068876_105880492 | 3300005527 | Freshwater Lake | MAIKLFNRKPELTEDTFTKLDRLMSEMASTETYVEYLREREGM* |
Ga0049081_100229169 | 3300005581 | Freshwater Lentic | MAIRLFNRKPTEDIFTKLDRLMSQMANTETYVEYLREREGM* |
Ga0049081_100421343 | 3300005581 | Freshwater Lentic | MAIKLFNRKPEVIEEDTFTKLDRMMSEMASTETYVAYLREREGM* |
Ga0049081_101307853 | 3300005581 | Freshwater Lentic | MAIRLFNRKPTEDVFTKLDRLMSQMATSNTYIEYLREREGM* |
Ga0078894_105675135 | 3300005662 | Freshwater Lake | MIVFNLFNRKPVEDTFAKLDRLMSKMANSDTYIEYLREREGM* |
Ga0079957_11742644 | 3300005805 | Lake | GPVNIERMAIKLFNRKQEVIQEDTLTKLDRLMSEMASTETYVEYLREREGM* |
Ga0070743_101412793 | 3300005941 | Estuarine | MKLFNRKPKEDVFTKLDRLMSEMASTETYVEYLREREGM* |
Ga0070744_100030142 | 3300006484 | Estuarine | MAIKLFNRKPKDVFVKLDKLMMEIASEEVYLEYLKERESMLYSNYYRKVM* |
Ga0070744_100361994 | 3300006484 | Estuarine | MAIKLFNRKPELTEDTFTKLDRLMSEMASSDTYIEYLREREGM* |
Ga0070744_100605463 | 3300006484 | Estuarine | MAIRLFNRKPKEDTFTKLDRLMSEMASTEILVAYLREREGM* |
Ga0070744_100667525 | 3300006484 | Estuarine | MKLFNKKPEVIEEDTFTKLDRLMGEMASIDIYIEYLELREGM* |
Ga0070744_101335591 | 3300006484 | Estuarine | MAMKLFKKKPEVIEEDTFTKLDRLMGEMASIDIYIE |
Ga0070744_101370362 | 3300006484 | Estuarine | MKLFNKKPEVVEEDTFTKLDRLMGEMASIDIYIEYLELREGM* |
Ga0079301_10178435 | 3300006639 | Deep Subsurface | MAIKLFNRKPKERNIIYADVWTRLDKLMGEMASIDIYIEYLEQREGM* |
Ga0099851_10872855 | 3300007538 | Aqueous | MKLFNKKPELTEDEIYSKLDKLMGEMSSIDIYTEYLELREGM* |
Ga0114340_12610672 | 3300008107 | Freshwater, Plankton | MAIKLFNRKPKEDVFVKLDRLMGQMASTEIYIEYLREREGMLYSNYWKR* |
Ga0114341_100486341 | 3300008108 | Freshwater, Plankton | RFGGMAMKLFNKKPEVIEEDTFTKLDRLMGEMASTEIYIEYLREREKV* |
Ga0114341_101003734 | 3300008108 | Freshwater, Plankton | MKLFNRKPEVIEEDVFVKLDRLMGEMASTEIYIEYLEQREGM* |
Ga0114341_101059796 | 3300008108 | Freshwater, Plankton | MAMKLFNKKPEVIEEDTFTKLDRLMGEMASIDIYIEYLELREAW* |
Ga0114341_101959235 | 3300008108 | Freshwater, Plankton | MAIKLFNRKPKFQEIILDSDVVFTKLDKLMGEMASIDVYIEYLELREAW* |
Ga0114343_10654692 | 3300008110 | Freshwater, Plankton | MAIKLFNKKPKFQEIILDSDVVFTKLDKLMGEMASIDIYIEYLELREGM* |
Ga0114344_100637024 | 3300008111 | Freshwater, Plankton | MIVLNLFNKKPVEDTFAKLDRLMSSMATPETYVEYLREREGM* |
Ga0114346_11123893 | 3300008113 | Freshwater, Plankton | MKLFNKKPEVIEEDTFTKLDRLMGEMASTEIYIEYLRERERV* |
Ga0114347_10543637 | 3300008114 | Freshwater, Plankton | MKLFNRKPELTEDEVFAKLDRLMGEMASTEIYIEYLEQREGM* |
Ga0114350_10737422 | 3300008116 | Freshwater, Plankton | MKLFNRKPELTEDEVFAKLDRLMGEMASIDIYIEYLEQREGM* |
Ga0114350_11289243 | 3300008116 | Freshwater, Plankton | MKLFNKKPEVIEEDTFTKLDRLMGEMASIDIYIEYLELREAW* |
Ga0114350_11824751 | 3300008116 | Freshwater, Plankton | MAIKLFNKKPKFQEIILDSDVVFTKLDKLMGEMASIDIYIEYLELREG |
Ga0114351_10906916 | 3300008117 | Freshwater, Plankton | MAIKLFNRKPTEDVFTKLDRLMSEMASSDTYIEYLREREGM* |
Ga0114337_13500263 | 3300008262 | Freshwater, Plankton | MAIKLFSRKSKPIEEFVFAKLDILMSKMASDEIFIQ |
Ga0114880_10351662 | 3300008450 | Freshwater Lake | MKLFNRKPEVIEEDVFVKLDRLMGEMASIDIYIEYLEQREGM* |
Ga0114880_10446833 | 3300008450 | Freshwater Lake | MAIKLFNRKPKEDVFVKLDRLMGQMASDEIFIQYLRERERM* |
Ga0114880_11049465 | 3300008450 | Freshwater Lake | AIKLFNRKPELTEDTFTKLDRLMSEMASTETYVEYLREREGM* |
Ga0104242_10045487 | 3300008962 | Freshwater | MIVFNLFKKKEVEDTFVKLDRLMSEMANTETYVEYLREREGM* |
Ga0102830_10889811 | 3300009059 | Estuarine | MAIKLFNRKPKEDVFITLDRMMSEMASTETYIEYLREREGM* |
Ga0114973_105115141 | 3300009068 | Freshwater Lake | MIVFNLFKKKEVEDTFTKLDRLMSKMATSDTYIQYLREREGM* |
Ga0114980_1000175130 | 3300009152 | Freshwater Lake | MKLFKKKEVEDTFTKLDRLMSEMATSDTYIEYLREREGM* |
Ga0114968_101772964 | 3300009155 | Freshwater Lake | MIVLNLFNRKPVEDTFTKLDRLMSEMATSDTYIEYLREREGM* |
Ga0114970_107415032 | 3300009163 | Freshwater Lake | MKLWNKKTTEEPIKKLDRLMSEMASTETYIEYLRLRERFDGR* |
Ga0105102_105837132 | 3300009165 | Freshwater Sediment | MGIKLFKKKERNIIYADTFSYLDKLMSEMASTEIYIEYLELREGM* |
Ga0114976_100298925 | 3300009184 | Freshwater Lake | MKLWSKKTKEEPIKKLDRLMSEMASTETYIEYLRLRERFDGR* |
Ga0114982_10127946 | 3300009419 | Deep Subsurface | MAIKLFNRKPVERNIIYADTFSYLDKLMSKMASTEIYIEYLRERERM* |
Ga0129333_104118883 | 3300010354 | Freshwater To Marine Saline Gradient | MKLFNRKPVERNIIYADTFSYLDKLMSEMASTEIYIEYLREREKV* |
Ga0151620_10380613 | 3300011268 | Freshwater | MKLFNRKPELTEDEVFAKLDKLMGEMASIDIYIQYLEQREGM* |
Ga0151620_10710723 | 3300011268 | Freshwater | MKLFNRKQEVIEEDTFTKLDRLMSEMASTETYIEYLRERERV* |
Ga0157203_10118993 | 3300012663 | Freshwater | MIVFNLFNRKPVEDTFTKLDRLMSQMATSDTYIEYLREREGM* |
Ga0157203_10122885 | 3300012663 | Freshwater | MAIRLFNRKQEDVFTKLDRLMSEMASTETYVAYLREREGM* |
Ga0157210_10026534 | 3300012665 | Freshwater | MAIRLFNRKPTEDAFTKLDRLMSSMATPETYIEYLREREGM* |
Ga0164293_100985371 | 3300013004 | Freshwater | FRNCRWRFSRMAIRLFNKKSELTEDEVFAKLDFLMGKMANLDTYLEYLELREGM* |
Ga0164293_105669122 | 3300013004 | Freshwater | MKLFNKKPELTEDEIYSKLDKLMGEMSSIDIYIEYLQLREGM* |
Ga0164292_101398644 | 3300013005 | Freshwater | MKLFNKKPEVIEEDTFVKLDRLMGEMASIDIYIEYLREREGME* |
Ga0164292_105354294 | 3300013005 | Freshwater | MAIKLFNKKPELTEDEIYSKLDKLMGEMSSIDIYLEYLELREGM* |
Ga0177922_105132655 | 3300013372 | Freshwater | MAIKLFTRKPKDVFVKLDKLMMEIASEEVYLEYLKERESMLYSNYYRKVM* |
Ga0181365_10218591 | 3300017736 | Freshwater Lake | PEDIFVKLDRLMSEMASTDIYIEYLRERQNLLYSNYYKR |
Ga0181359_10243798 | 3300019784 | Freshwater Lake | MAIRLFNKKPTEDTFTKLDKLMSEMATPDTYIEYLREREGM |
Ga0211732_11514512 | 3300020141 | Freshwater | MAIKLFNRKPKFQEIILDSDVVFTKLDKMMSEMASIDIYIEYLELREGMS |
Ga0211732_12478972 | 3300020141 | Freshwater | MKLFNRKPKFQEIILDSDVVFTKLDRMMSEMASTEIYIEYLELREGM |
Ga0211732_13307205 | 3300020141 | Freshwater | MKLFKKKPEVIEEDTFTKLDRMMSEMASTEIYIEYLEQREGM |
Ga0211732_13733597 | 3300020141 | Freshwater | MAIKLFNRKPEQTEDTFTKLDRLMSEMASTETFVAYLREREGM |
Ga0211736_109162863 | 3300020151 | Freshwater | MGIKLFNRKPEQTEDTFTKLDRLMSQMASTETFVAYLREREGM |
Ga0211736_109923841 | 3300020151 | Freshwater | MAMKLFNKKPKFQEIILDSDVVFTKLDKLMSEMASIDTYIEYLELREGM |
Ga0211734_107028492 | 3300020159 | Freshwater | MKLFNKKPEVIEEDTFTKLDRLMSEMASTETFVAYLREREGM |
Ga0211733_107217824 | 3300020160 | Freshwater | RMAIKLFNRKPEQTEDTFTKLDRLMSEMASTETFVAYLREREGM |
Ga0211733_109197142 | 3300020160 | Freshwater | MAIKLFNRKPKFQEIILDSDVVFTKLDKMMSEMASTEIYIEYLELREGMS |
Ga0211726_101381632 | 3300020161 | Freshwater | MAMKLFNRKPKFQEIILDSDVVFTKLDRMMSEMASTEIYIEYLELREGMS |
Ga0211726_110332753 | 3300020161 | Freshwater | MAIKLFNRKPEQTEDTFTKLDRLMSQMASTETFVAYLREREGM |
Ga0211735_105416216 | 3300020162 | Freshwater | IKLFNRKPEQTEDTFTKLDRLMSEMASTETFVAYLREREGM |
Ga0211735_109470693 | 3300020162 | Freshwater | MAIKLFNRKPEQTEDTFTKLDRLMSEMASIEIYIEYLELREAW |
Ga0211731_105056972 | 3300020205 | Freshwater | MAMKLFNKKPEVIEEDTFTKLDRLMGEMASIDIYIEYLELREAW |
Ga0211731_110264574 | 3300020205 | Freshwater | MAMKLFNKKPKFQEIILDSDVVFTKLDKMMSEMASTEIYIEYLEQREGM |
Ga0208091_10139383 | 3300020506 | Freshwater | MAMKLFNKKSELTEDEVYARLDKLMGEMSSIDIYLEYLELREGM |
Ga0208234_10029811 | 3300020515 | Freshwater | AMKLFNKKPELTEDEVYARLDKLMGEMSSIDIYLEYLELREGM |
Ga0208234_10223643 | 3300020515 | Freshwater | MAIRLFNKKPELTEDEVFAKLDFLMGKMANLDTYLEYLELREGM |
Ga0208232_10136203 | 3300020527 | Freshwater | MAMKLFNRKPELTEDEVYARLDKLMGEMSSIDIYLEYLELREGM |
Ga0208232_10386762 | 3300020527 | Freshwater | MAIKLFNKKSELTKDEVFAKLDFLMGKMANLDTYLEYLELREGM |
Ga0208235_10124035 | 3300020530 | Freshwater | MAMKLFNKKPELTEDEVYARLDKLMGEMSSIDIYLEYLELREGM |
Ga0208852_100076624 | 3300020560 | Freshwater | MRLFNRKPVEDTFTKLDRLMSEMASTETYVAYLREREGM |
Ga0208597_10031739 | 3300020562 | Freshwater | MAIKLFNKKSELTEDEVFAKLDFLMGKMANLDTYLEYLELREGM |
Ga0208597_10145851 | 3300020562 | Freshwater | MAMKLFNKKPELTEDEVYAKLDKLMGKMASIDVYLEYLELR |
Ga0222714_100351016 | 3300021961 | Estuarine Water | MKLFNRKPELTEDEVFAKLDKLMGEMASIDIYIQYLEQREGM |
Ga0222714_100422758 | 3300021961 | Estuarine Water | MAIKLFNKKPELIEDTFTKLDRLMSEMASTDIYIEYLELREGM |
Ga0222714_100648802 | 3300021961 | Estuarine Water | MKLFNKKPEVIEEDTFEKLDRLMGEMASIDIYIEYLREREGM |
Ga0222714_101120067 | 3300021961 | Estuarine Water | MKLFNRKQEVIEEDTFTKLDRLMSEMASTETYIEYLRERERV |
Ga0222712_100544776 | 3300021963 | Estuarine Water | MKLFNRKPELTEDEVFTKLDKLMSEMASTDIYIEYLEQREGM |
Ga0222712_100784443 | 3300021963 | Estuarine Water | MAIRLFNRKPIEDTLTKLDRLMSEMASTETYVEYLREREGM |
Ga0222712_100794824 | 3300021963 | Estuarine Water | MAMKLFNRKPEVIEEDTFTKLDRLMGEMASIDIYIEYLREREGM |
Ga0222712_101343785 | 3300021963 | Estuarine Water | MIVFKLFNRKPVEDTFTKLDRLMSEMATSNTYIEYLREREGM |
Ga0222712_106714521 | 3300021963 | Estuarine Water | MAIKLFNKKPELTEDEIFAKLDLLMGKMASIDIYIEYLELREGM |
Ga0181351_10495121 | 3300022407 | Freshwater Lake | MAIKLFNRKPEDVFVKLDRLMSEMASTDIYIEYLRERQNLLYSNYYKR |
Ga0214921_100489626 | 3300023174 | Freshwater | MIVFNLFKKKEVEDTFVKLDRLMSEMANTETYVEYLREREGM |
Ga0244775_102621765 | 3300024346 | Estuarine | ARFICTMGGVMKLFNKKPEVIEEDTFTKLDRLMGEMASIDIYIEYLELREGM |
Ga0244775_102742683 | 3300024346 | Estuarine | MAIKLFNRKPKDVFVKLDKLMMEIASEEVYLEYLKERESMLYSNYYRKVM |
Ga0244775_103697794 | 3300024346 | Estuarine | MAIRLFNRKPKEDTFTKLDRLMSEMASTEILVAYLREREGM |
Ga0244775_109034552 | 3300024346 | Estuarine | VMIVFNLFNRKPVEDTFTKLDRLMSEMATSNTYIEYLREREGM |
Ga0244775_110198263 | 3300024346 | Estuarine | MKLFNRKPKEDVFTKLDRLMSEMASTETYVEYLREREGM |
Ga0244775_110736524 | 3300024346 | Estuarine | MKLFNKKPEVIEEDTFTKLDRLMGEMASIDIYIEY |
Ga0244775_114190431 | 3300024346 | Estuarine | MAIKLFNRKPELTEDTFTKLDRLMSEMASSDTYIEY |
Ga0208009_10110582 | 3300027114 | Deep Subsurface | MAIKLFNRKPKERNIIYADVWTRLDKLMGEMASIDIYIEYLEQREGM |
Ga0208974_100572413 | 3300027608 | Freshwater Lentic | MKLFNKKPEVIEEDTFTKLDRMMSEMASTEIYIEYLQERERV |
Ga0208974_10282674 | 3300027608 | Freshwater Lentic | MAIKLFNRKPEVIEEDTFTKLDRMMSEMASTETYVAYLREREGM |
Ga0208974_10538033 | 3300027608 | Freshwater Lentic | MAIRLFNRKPTEDVFTKLDRLMSQMATSDTYIEYLREREGM |
Ga0208133_11568602 | 3300027631 | Estuarine | MIVFNLFNRKPVEDTFTKLDRLMSEMATSNTYIEYLREREGM |
Ga0208975_10352185 | 3300027659 | Freshwater Lentic | MAIRLFNRKPTEDIFTKLDRLMSQMANTETYVEYLREREGM |
Ga0208975_11388422 | 3300027659 | Freshwater Lentic | FNRKPVEDTFTKLDRLMSQMATSDTYIEYLREREGM |
Ga0208975_12108491 | 3300027659 | Freshwater Lentic | MAIRLFNRKPTEDVFTKLDRLMSQMATSNTYIEYLREREGM |
Ga0209599_1000036539 | 3300027710 | Deep Subsurface | MAIKLFNRKPVERNIIYPDLWTYLDKLMSEMSSTETYIEYLREREKV |
Ga0209599_100188085 | 3300027710 | Deep Subsurface | MAIKLFNRKPVERNIIYADTFSYLDKLMSKMASTEIYIEYLRERERM |
Ga0209599_101629141 | 3300027710 | Deep Subsurface | MAIKLFNRKPTEDVFTKLDRLMSEMASSDTYIEYLREREGM |
(restricted) Ga0247836_13278941 | 3300027728 | Freshwater | MAIKLFSRKPEVIEEDTFTKLDRMMSEMASTEIYIEYLELREAW |
Ga0209087_10699612 | 3300027734 | Freshwater Lake | MKLWSKKTKEEPIKKLDRLMSEMASTETYIEYLRLRERFDGR |
Ga0209596_11403624 | 3300027754 | Freshwater Lake | MIVLNLFNRKPVEDTFTKLDRLMSEMATSDTYIEYLREREGM |
Ga0209296_100179627 | 3300027759 | Freshwater Lake | MIVLNLFNRKPVEDTFAKLDRLMSEMATSDTYIEYLREREGM |
Ga0209246_102635441 | 3300027785 | Freshwater Lake | AIRLFNKKPTEDTFTKLDKLMSEMATPDTYIEYLREREGM |
Ga0209107_100139677 | 3300027797 | Freshwater And Sediment | MAIKLFNKKSKVREVILDSDVVFTKLDKLMSEMASKEIHKEYLKLRKGM |
Ga0209358_100957722 | 3300027804 | Freshwater Lake | MAMKLFNRKPAEDVFTKLDRLMSEMASTETYVAYLREREGM |
Ga0209990_101225063 | 3300027816 | Freshwater Lake | MAIKLFNRKPTEDVFTKLDKLMSEMASSDTYIEYLREREGM |
Ga0209400_10153626 | 3300027963 | Freshwater Lake | MIVFNLFKKKEVEDTFTKLDRLMSKMATSDTYIQYLREREGM |
Ga0209298_1000170629 | 3300027973 | Freshwater Lake | MKLFKKKEVEDTFTKLDRLMSEMATSDTYIEYLREREGM |
Ga0247723_10072625 | 3300028025 | Deep Subsurface Sediment | MKLFNRKPKEDVFDKLDRLMSEMASDKTYIEYLRQRESC |
Ga0247723_10148313 | 3300028025 | Deep Subsurface Sediment | MKLFNRKPNEDTFTKLDRLMSQMASTETYVEYLREREGM |
Ga0247723_10163127 | 3300028025 | Deep Subsurface Sediment | MAIRLFNRKQEDTFTKLDRLMSQMASTETYVAYLREREGM |
Ga0247723_10181615 | 3300028025 | Deep Subsurface Sediment | MIVRNLFNRKPVEDTFTKLDRLMSQMATTNTYIEYLREREGM |
Ga0247723_10374392 | 3300028025 | Deep Subsurface Sediment | MAIKLFNRKPVERNIIYADTFTYLDKLMSEMASTEIYIEYLRERERM |
Ga0247723_10561384 | 3300028025 | Deep Subsurface Sediment | MAIKLFKKNEEDVFAKLDKLMSNMASPETYVEYLREREGM |
Ga0315907_1001716617 | 3300031758 | Freshwater | MKLFNRKPEVIEEDVFVKLDRLMGEMASTEIYIEYLEQREGM |
Ga0315899_110600183 | 3300031784 | Freshwater | MIVLNLFNKKPVEDTFAKLDRLMSSMATPETYVEYLREREGM |
Ga0315899_111522253 | 3300031784 | Freshwater | MKLFNRKPELTEDEVFTKLDKLMGEMASIDVYIEYLELREGM |
Ga0315900_102850102 | 3300031787 | Freshwater | MKLFNKKPEVIEEDTFTKLDRLMGEMASIDIYIEYLELREAW |
Ga0315900_106128714 | 3300031787 | Freshwater | MIVLNLFNKKPVEDTFAKLDRLMSSMAIPETYVEYLREREGM |
Ga0315900_106428363 | 3300031787 | Freshwater | MAIKLFNRKPELTEDTFTKLDRLMSEMASTETYVEYLREREGM |
Ga0315900_107421222 | 3300031787 | Freshwater | MAIKLFNRKPKEDVFVKLDRLMGQMASTEIYIEYLREREGMLYSNYWKR |
Ga0315900_107658612 | 3300031787 | Freshwater | MAMKLFNKKPEVIEEDTFTKLDRLMGEMASTEIYIEYLRERERV |
Ga0315900_111330802 | 3300031787 | Freshwater | MAIKLFNRKPKFQEIILDSDVVFTKLDKLMGEMASIDIYIEYLELREGM |
Ga0315909_102482955 | 3300031857 | Freshwater | MAIKLFNKKPKEDVFVKLDRLMGQMASTEIYIEYLREREGMLYSNYWKR |
Ga0315909_103593402 | 3300031857 | Freshwater | MIVLNLFNKKPVEDTFTKLDRLMSEMATPETYVQYLREREGM |
Ga0315909_104826573 | 3300031857 | Freshwater | MAIKLFNRKPKFQEIILDSDVVFTKLDKLMGEMASIDVYIEYLELREGM |
Ga0315904_107277861 | 3300031951 | Freshwater | MKLFNRKPELTEDEVFTKLDKLMGEMASIDIYIEY |
Ga0315901_1003218916 | 3300031963 | Freshwater | MAMKLFNKKPEVIEEDTFTKLDRLMGEMASIDIYIEYLRERERV |
Ga0315901_111549171 | 3300031963 | Freshwater | RMAIKLFKKNEEDVFAKLDKLMSNMASPETYVEYLREREGM |
Ga0315906_107262342 | 3300032050 | Freshwater | MIVLNLFNKKSVEDTFAKLDKLMSSMATPETYVEYLREREGM |
Ga0315906_111356263 | 3300032050 | Freshwater | MAIKLFNRKPELTEDTFTKLDRLMSEMASTETYVEYL |
Ga0315905_1011886712 | 3300032092 | Freshwater | MIVRNLFNKKPVEDTFVKLDKLMSEMATPDTYIEYLREREGM |
Ga0315902_107766302 | 3300032093 | Freshwater | MKLFNRKPEVIEEDVFVKLDRLMGEMASTEIYIEYLELREGM |
Ga0315903_100996956 | 3300032116 | Freshwater | LLGVMIVLNLFNKKPVEDTFAKLDRLMSSMATPETYVEYLREREGM |
Ga0334992_0021519_2795_2929 | 3300033992 | Freshwater | MAIKLFNKKPELTEDEVYARLDKLMGEMSSIDIYLEYLELREGM |
Ga0334992_0104629_1003_1131 | 3300033992 | Freshwater | MKLFNRKPEVIEEDTFTKLDRLMGEMASTEIYIEYLEQREGM |
Ga0334994_0344725_62_196 | 3300033993 | Freshwater | MAIRLFNKKSELTEDEVFAKLDFLMGKMANLDTYLEYLELREGM |
Ga0334994_0377709_515_664 | 3300033993 | Freshwater | MAIKLFNRKPEEDVFVTLDRLMGKMASTETYIEYLREREGMLYSNYWKR |
Ga0334996_0038951_1277_1414 | 3300033994 | Freshwater | MRCMKLFNRKPELTEDEIYSKLDKLMGEMSSIDIYLEYLQLREGM |
Ga0335003_0310250_580_705 | 3300033995 | Freshwater | MAMKLFNKKPELTEDEVYARLDKLMGEMSSIDIYLEYLQLRE |
Ga0334979_0215955_434_568 | 3300033996 | Freshwater | MAIKLFNRKPELTEDEIFAKLDLLMGKMSSIDIYIEYLELREGM |
Ga0334979_0442346_462_596 | 3300033996 | Freshwater | MAIKLFNKKPELTEDEIYSKLDKLMGEMSSIDIYLEYLELREGM |
Ga0334991_0040197_1451_1588 | 3300034013 | Freshwater | MAMKLFNKKPELIEEDTFTKLDRLMGEMASIDIYIEYLREREGME |
Ga0334985_0122474_708_836 | 3300034018 | Freshwater | MKLFNKKPELTEDEVYAKLDKLMGKMASIDVYLEYLELREGM |
Ga0334985_0151693_570_704 | 3300034018 | Freshwater | MAIKLFNRKPELTEDEVYARLDKLMGEMSSIDIYLEYLELREGM |
Ga0334985_0447775_384_518 | 3300034018 | Freshwater | MAMKLFNKKPELTEDEIYSRLDKLMGEMSSIDIYLEYLELREGM |
Ga0334985_0491841_1_129 | 3300034018 | Freshwater | MAIKLFNRKPEVIEDEVYARLDKLMGEMSSIDIYLEYLELREG |
Ga0334995_0074143_2014_2142 | 3300034062 | Freshwater | MKLFNKKPELTEDEVYARLDKLMGEMSSIDIYLEYLELREGM |
Ga0335020_0495026_313_447 | 3300034082 | Freshwater | MAIKLFNKKPELTEDEVFAKLDTLMGKMASIDVYLEYLELREGM |
Ga0335012_0027396_1940_2068 | 3300034093 | Freshwater | MIVFNLFNRKPVEDTFTKLDRLMSEMATTNTYIEYLREREGM |
Ga0335012_0136827_970_1098 | 3300034093 | Freshwater | MKLFNKKPELTEDEVYAKLDKLMGKMASIDIYLEYLQLREGM |
Ga0335012_0367155_520_654 | 3300034093 | Freshwater | MAMKLFNKKPEVIEEDTFTKLDRMMSEMASTEIYIEYLREREKA |
Ga0335029_0216983_1136_1258 | 3300034102 | Freshwater | MAIKLFNKKPELTEDEVYARLDKLMGEMSSIDIYLEYLELR |
Ga0335029_0220011_1133_1246 | 3300034102 | Freshwater | MAIKLFNKKPELTEDEVYARLDKLMGEMSSIDIYLEYL |
Ga0335029_0293959_690_827 | 3300034102 | Freshwater | MKLFNRKPKERNVIYADTFSYLDKLMSEMASTEIYIEYLREREKA |
Ga0335029_0531939_366_497 | 3300034102 | Freshwater | MAMRLFNKKPELIEDTFTKLDRLMGEMASIDIYIEYLELREGM |
Ga0335031_0001534_11370_11519 | 3300034104 | Freshwater | MAIKLFNKKPKVREVILDSDVIFTKLDKLMGEMASIDIYLEYLELREGM |
Ga0335031_0007271_1010_1132 | 3300034104 | Freshwater | MAIRLFNRKQEDTFTKLDRLMSEMASTETYVAYLREREGM |
Ga0335031_0158154_1376_1492 | 3300034104 | Freshwater | MKLFNRKQEDTFTKLDRLMSEMASTETYVAYLREREGM |
Ga0335031_0538554_462_596 | 3300034104 | Freshwater | MAIKLFNRKPEVIEEDTFTKLDRMMSEMASTEIYIEYLREREKA |
Ga0335035_0037929_1004_1138 | 3300034105 | Freshwater | MAMKLFNKKPELTEDEVYARLDKLMGEMSSIDIYLEYLQLREGM |
Ga0335035_0376285_283_417 | 3300034105 | Freshwater | MAIKLFNKKPEVIEEDTFTKLDRMMSEMASTEIYIEYLREREKA |
Ga0335035_0502718_1_123 | 3300034105 | Freshwater | VMRLFNRKPVEDTFTKLDRLMSEMASTETYVAYLREREGM |
Ga0335055_0018686_329_457 | 3300034110 | Freshwater | MIVFNLFNRKPVEDTFTKLDRLMSQMATSNTYIEYLREREGM |
Ga0335056_0485526_243_377 | 3300034120 | Freshwater | MAIKLFNRKPELTEDEVFAKLDTLMGKMASIDVYLEYLELREGM |
Ga0335049_0039917_1917_2045 | 3300034272 | Freshwater | MKLFNRKPELTEDEVYARLDKLMGEMSSIDIYLEYLELREGM |
Ga0335052_0409014_2_124 | 3300034279 | Freshwater | LFNKKSELTEDEVFAKLDFLMGKMANLDTYLEYLELREGM |
Ga0335013_0793373_227_364 | 3300034284 | Freshwater | MAIKLFNKKPELIEEDTFTKLDRLMGEMASIDIYIEYLREREGME |
⦗Top⦘ |