| Basic Information | |
|---|---|
| Family ID | F027057 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 196 |
| Average Sequence Length | 43 residues |
| Representative Sequence | GTMTDAEIEAIIARVGEKKRPLDEVRDFSFARQAMKELEAGK |
| Number of Associated Samples | 167 |
| Number of Associated Scaffolds | 196 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.65 % |
| % of genes near scaffold ends (potentially truncated) | 91.84 % |
| % of genes from short scaffolds (< 2000 bps) | 89.80 % |
| Associated GOLD sequencing projects | 157 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.918 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (10.714 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.755 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (32.143 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 196 Family Scaffolds |
|---|---|---|
| PF09084 | NMT1 | 27.55 |
| PF08028 | Acyl-CoA_dh_2 | 11.22 |
| PF07883 | Cupin_2 | 7.14 |
| PF13379 | NMT1_2 | 4.59 |
| PF00441 | Acyl-CoA_dh_1 | 4.59 |
| PF07969 | Amidohydro_3 | 2.55 |
| PF04909 | Amidohydro_2 | 1.53 |
| PF03401 | TctC | 1.02 |
| PF01979 | Amidohydro_1 | 1.02 |
| PF03918 | CcmH | 0.51 |
| PF13537 | GATase_7 | 0.51 |
| PF13378 | MR_MLE_C | 0.51 |
| PF01266 | DAO | 0.51 |
| PF07690 | MFS_1 | 0.51 |
| PF00881 | Nitroreductase | 0.51 |
| PF03972 | MmgE_PrpD | 0.51 |
| PF00933 | Glyco_hydro_3 | 0.51 |
| PF06029 | AlkA_N | 0.51 |
| PF01850 | PIN | 0.51 |
| PF00005 | ABC_tran | 0.51 |
| PF04349 | MdoG | 0.51 |
| PF00596 | Aldolase_II | 0.51 |
| PF02771 | Acyl-CoA_dh_N | 0.51 |
| PF15919 | HicB_lk_antitox | 0.51 |
| PF00571 | CBS | 0.51 |
| PF01112 | Asparaginase_2 | 0.51 |
| PF04199 | Cyclase | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 196 Family Scaffolds |
|---|---|---|---|
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 27.55 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 27.55 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 16.33 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.02 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.51 |
| COG1446 | Isoaspartyl peptidase or L-asparaginase, Ntn-hydrolase superfamily | Amino acid transport and metabolism [E] | 0.51 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.51 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.51 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.51 |
| COG3088 | Cytochrome c-type biogenesis protein CcmH/NrfF | Posttranslational modification, protein turnover, chaperones [O] | 0.51 |
| COG3131 | Periplasmic glucan biosynthesis protein OpgG | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.92 % |
| Unclassified | root | N/A | 4.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725004|GPKC_F5V46DG01ANN2I | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 524 | Open in IMG/M |
| 2228664022|INPgaii200_c0699644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0501142 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101286655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 793 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101988622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1357 | Open in IMG/M |
| 3300000559|F14TC_100343548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3077 | Open in IMG/M |
| 3300000789|JGI1027J11758_12855424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1159 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1003991 | All Organisms → cellular organisms → Bacteria | 2082 | Open in IMG/M |
| 3300000891|JGI10214J12806_10704329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 986 | Open in IMG/M |
| 3300000953|JGI11615J12901_10127771 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300001431|F14TB_103430814 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300002223|C687J26845_10170166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 780 | Open in IMG/M |
| 3300003997|Ga0055466_10262233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300004013|Ga0055465_10334620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300004049|Ga0055493_10047806 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300004050|Ga0055491_10096360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 727 | Open in IMG/M |
| 3300004114|Ga0062593_100648888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1018 | Open in IMG/M |
| 3300004114|Ga0062593_103136668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300004157|Ga0062590_102652030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300004463|Ga0063356_102726812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 760 | Open in IMG/M |
| 3300004778|Ga0062383_10087317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1310 | Open in IMG/M |
| 3300004780|Ga0062378_10157081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300005169|Ga0066810_10184218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300005178|Ga0066688_10370916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 927 | Open in IMG/M |
| 3300005180|Ga0066685_10166192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1505 | Open in IMG/M |
| 3300005183|Ga0068993_10291150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300005186|Ga0066676_10198878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1287 | Open in IMG/M |
| 3300005186|Ga0066676_10485477 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300005294|Ga0065705_10681178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 662 | Open in IMG/M |
| 3300005295|Ga0065707_10992920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300005295|Ga0065707_11030642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300005330|Ga0070690_100681464 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300005332|Ga0066388_105405316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 647 | Open in IMG/M |
| 3300005364|Ga0070673_101239372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 699 | Open in IMG/M |
| 3300005447|Ga0066689_10360057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 908 | Open in IMG/M |
| 3300005526|Ga0073909_10021197 | All Organisms → cellular organisms → Bacteria | 2121 | Open in IMG/M |
| 3300005536|Ga0070697_102059137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300005553|Ga0066695_10745567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300005558|Ga0066698_10815259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300005563|Ga0068855_100372489 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
| 3300005568|Ga0066703_10713242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300005617|Ga0068859_102576302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 560 | Open in IMG/M |
| 3300005836|Ga0074470_10745841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1215 | Open in IMG/M |
| 3300005836|Ga0074470_11566258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 923 | Open in IMG/M |
| 3300005843|Ga0068860_101670793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 659 | Open in IMG/M |
| 3300006755|Ga0079222_10132010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1383 | Open in IMG/M |
| 3300006796|Ga0066665_10655915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 835 | Open in IMG/M |
| 3300006804|Ga0079221_10339214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 901 | Open in IMG/M |
| 3300006806|Ga0079220_10882418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 691 | Open in IMG/M |
| 3300006844|Ga0075428_100214914 | All Organisms → cellular organisms → Bacteria | 2077 | Open in IMG/M |
| 3300006844|Ga0075428_100961395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 905 | Open in IMG/M |
| 3300006845|Ga0075421_101194441 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300006854|Ga0075425_100114513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3076 | Open in IMG/M |
| 3300006865|Ga0073934_10297531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1033 | Open in IMG/M |
| 3300006871|Ga0075434_100397827 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
| 3300006871|Ga0075434_101145312 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300006904|Ga0075424_100129584 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2668 | Open in IMG/M |
| 3300006954|Ga0079219_10498466 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300007076|Ga0075435_100421464 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300009012|Ga0066710_103246433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 623 | Open in IMG/M |
| 3300009012|Ga0066710_104260517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300009053|Ga0105095_10401754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 756 | Open in IMG/M |
| 3300009053|Ga0105095_10732150 | Not Available | 552 | Open in IMG/M |
| 3300009087|Ga0105107_11135341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300009092|Ga0105250_10269313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 731 | Open in IMG/M |
| 3300009094|Ga0111539_10198156 | All Organisms → cellular organisms → Bacteria | 2342 | Open in IMG/M |
| 3300009100|Ga0075418_10100222 | All Organisms → cellular organisms → Bacteria | 3076 | Open in IMG/M |
| 3300009100|Ga0075418_10488479 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300009101|Ga0105247_11526303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300009137|Ga0066709_102840398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 641 | Open in IMG/M |
| 3300009147|Ga0114129_10174499 | All Organisms → cellular organisms → Bacteria | 2928 | Open in IMG/M |
| 3300009156|Ga0111538_10112198 | All Organisms → cellular organisms → Bacteria | 3463 | Open in IMG/M |
| 3300009156|Ga0111538_12709041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 621 | Open in IMG/M |
| 3300009157|Ga0105092_10399073 | Not Available | 782 | Open in IMG/M |
| 3300009157|Ga0105092_10616101 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300009162|Ga0075423_10061126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3898 | Open in IMG/M |
| 3300009162|Ga0075423_10668962 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300009167|Ga0113563_12456194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300009609|Ga0105347_1283354 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300009678|Ga0105252_10152759 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300009792|Ga0126374_10022614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2791 | Open in IMG/M |
| 3300009810|Ga0105088_1008816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1466 | Open in IMG/M |
| 3300010043|Ga0126380_10226966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1273 | Open in IMG/M |
| 3300010043|Ga0126380_10243676 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300010304|Ga0134088_10102867 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300010323|Ga0134086_10074798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1173 | Open in IMG/M |
| 3300010333|Ga0134080_10097950 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300010335|Ga0134063_10539026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300010359|Ga0126376_13084617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300010360|Ga0126372_11311697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 753 | Open in IMG/M |
| 3300010361|Ga0126378_11926540 | Not Available | 673 | Open in IMG/M |
| 3300010398|Ga0126383_10872931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 985 | Open in IMG/M |
| 3300010398|Ga0126383_11931073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 678 | Open in IMG/M |
| 3300010400|Ga0134122_11288817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 737 | Open in IMG/M |
| 3300011119|Ga0105246_11836325 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300011403|Ga0137313_1095878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 537 | Open in IMG/M |
| 3300011421|Ga0137462_1133876 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300011423|Ga0137436_1179862 | Not Available | 560 | Open in IMG/M |
| 3300011434|Ga0137464_1168468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300012039|Ga0137421_1111216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 794 | Open in IMG/M |
| 3300012096|Ga0137389_11333216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 612 | Open in IMG/M |
| 3300012171|Ga0137342_1099519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300012172|Ga0137320_1025538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1182 | Open in IMG/M |
| 3300012199|Ga0137383_10835761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 672 | Open in IMG/M |
| 3300012199|Ga0137383_10863994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 660 | Open in IMG/M |
| 3300012211|Ga0137377_10677017 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300012349|Ga0137387_10853965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 659 | Open in IMG/M |
| 3300012349|Ga0137387_10907890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300012353|Ga0137367_10982531 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300012354|Ga0137366_10181483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1578 | Open in IMG/M |
| 3300012354|Ga0137366_11115640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300012495|Ga0157323_1011189 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300012501|Ga0157351_1004172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1104 | Open in IMG/M |
| 3300012509|Ga0157334_1074401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300012532|Ga0137373_10360512 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300012685|Ga0137397_10121251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1926 | Open in IMG/M |
| 3300012918|Ga0137396_10266196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1266 | Open in IMG/M |
| 3300012925|Ga0137419_10503001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 962 | Open in IMG/M |
| 3300012958|Ga0164299_11550077 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300012985|Ga0164308_10779182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 832 | Open in IMG/M |
| 3300013306|Ga0163162_11461218 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300014262|Ga0075301_1018007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1162 | Open in IMG/M |
| 3300014263|Ga0075324_1163257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300014269|Ga0075302_1056688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 802 | Open in IMG/M |
| 3300014870|Ga0180080_1028420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 843 | Open in IMG/M |
| 3300014877|Ga0180074_1022862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1228 | Open in IMG/M |
| 3300014881|Ga0180094_1051141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 883 | Open in IMG/M |
| 3300015372|Ga0132256_100023084 | All Organisms → cellular organisms → Bacteria | 5543 | Open in IMG/M |
| 3300015372|Ga0132256_101253858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 854 | Open in IMG/M |
| 3300015373|Ga0132257_100903310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1107 | Open in IMG/M |
| 3300015373|Ga0132257_104441095 | Not Available | 510 | Open in IMG/M |
| 3300015374|Ga0132255_103593781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 659 | Open in IMG/M |
| 3300017939|Ga0187775_10194596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 749 | Open in IMG/M |
| 3300018084|Ga0184629_10181406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1081 | Open in IMG/M |
| 3300018084|Ga0184629_10447461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 677 | Open in IMG/M |
| 3300019878|Ga0193715_1034806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1091 | Open in IMG/M |
| 3300020003|Ga0193739_1045898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1127 | Open in IMG/M |
| 3300020003|Ga0193739_1167578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300020004|Ga0193755_1082924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1027 | Open in IMG/M |
| 3300020064|Ga0180107_1230709 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300021081|Ga0210379_10090820 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300021081|Ga0210379_10326718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 673 | Open in IMG/M |
| 3300022214|Ga0224505_10298684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 611 | Open in IMG/M |
| 3300025326|Ga0209342_10120597 | All Organisms → cellular organisms → Bacteria | 2398 | Open in IMG/M |
| 3300025549|Ga0210094_1113715 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300025899|Ga0207642_10412753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 810 | Open in IMG/M |
| 3300025917|Ga0207660_11516111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300025920|Ga0207649_11113457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 623 | Open in IMG/M |
| 3300025933|Ga0207706_10575620 | Not Available | 968 | Open in IMG/M |
| 3300025933|Ga0207706_10758645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 826 | Open in IMG/M |
| 3300025946|Ga0210126_130479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300025959|Ga0210116_1007261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1971 | Open in IMG/M |
| 3300025972|Ga0207668_12035833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300026089|Ga0207648_11408920 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300026142|Ga0207698_12711020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300026343|Ga0209159_1086750 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300026529|Ga0209806_1189197 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 732 | Open in IMG/M |
| 3300026536|Ga0209058_1065832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1970 | Open in IMG/M |
| 3300026536|Ga0209058_1161268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1029 | Open in IMG/M |
| 3300027277|Ga0209846_1039324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 740 | Open in IMG/M |
| 3300027560|Ga0207981_1036882 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300027840|Ga0209683_10310445 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300027843|Ga0209798_10073321 | All Organisms → cellular organisms → Bacteria | 1763 | Open in IMG/M |
| 3300027875|Ga0209283_10933476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300027907|Ga0207428_11055716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300027907|Ga0207428_11130465 | Not Available | 547 | Open in IMG/M |
| 3300027909|Ga0209382_11767875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300028803|Ga0307281_10129917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 870 | Open in IMG/M |
| 3300028807|Ga0307305_10321003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 704 | Open in IMG/M |
| 3300030606|Ga0299906_10204100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1560 | Open in IMG/M |
| 3300031226|Ga0307497_10561541 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300031226|Ga0307497_10777846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300031716|Ga0310813_12356964 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300031720|Ga0307469_12058372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300031820|Ga0307473_10895222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300031858|Ga0310892_10407498 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300031901|Ga0307406_11483437 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300031908|Ga0310900_10211776 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300031910|Ga0306923_11761671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300031912|Ga0306921_11168856 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 859 | Open in IMG/M |
| 3300031941|Ga0310912_10628122 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300031949|Ga0214473_11350258 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300031965|Ga0326597_10089336 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3769 | Open in IMG/M |
| 3300031965|Ga0326597_10442033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1433 | Open in IMG/M |
| 3300032012|Ga0310902_11219674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300032126|Ga0307415_102020933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300032157|Ga0315912_10040089 | All Organisms → cellular organisms → Bacteria | 3733 | Open in IMG/M |
| 3300032157|Ga0315912_10207325 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
| 3300032174|Ga0307470_10769725 | Not Available | 742 | Open in IMG/M |
| 3300032180|Ga0307471_100026263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4391 | Open in IMG/M |
| 3300032205|Ga0307472_100254542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1380 | Open in IMG/M |
| 3300033004|Ga0335084_10090863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3168 | Open in IMG/M |
| 3300033412|Ga0310810_10430174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1347 | Open in IMG/M |
| 3300033434|Ga0316613_10070653 | All Organisms → cellular organisms → Bacteria | 2062 | Open in IMG/M |
| 3300033815|Ga0364946_104078 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300034149|Ga0364929_0002596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4405 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.71% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.18% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.14% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 6.12% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.08% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.55% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.55% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.04% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.04% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.04% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.53% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.53% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.53% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.53% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.53% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.02% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.02% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.02% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.02% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.02% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.02% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.02% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.02% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.02% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.02% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.02% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.02% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.02% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.02% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.51% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.51% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.51% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.51% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.51% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.51% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.51% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.51% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.51% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.51% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.51% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725004 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002223 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_1.2 | Environmental | Open in IMG/M |
| 3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
| 3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
| 3300004049 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2 | Environmental | Open in IMG/M |
| 3300004050 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300004780 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011403 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2 | Environmental | Open in IMG/M |
| 3300011421 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2 | Environmental | Open in IMG/M |
| 3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
| 3300011434 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2 | Environmental | Open in IMG/M |
| 3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012171 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2 | Environmental | Open in IMG/M |
| 3300012172 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT366_2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Host-Associated | Open in IMG/M |
| 3300012501 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610 | Environmental | Open in IMG/M |
| 3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014269 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014870 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10D | Environmental | Open in IMG/M |
| 3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
| 3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020064 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT27_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025549 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025946 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025959 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
| 3300033815 | Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPKC_00658620 | 2067725004 | Soil | MTDAEIEFQMERLAEKKRPLDEVRDFSFARQAWKELESGK |
| INPgaii200_06996441 | 2228664022 | Soil | SYDAELKTLTRDGQMTDAELEALILRVGEKKRPLDEVRDFTLARQAMKELQ |
| ICChiseqgaiiDRAFT_05011422 | 3300000033 | Soil | SDAELEALMVKLGDKKRPVDEVRDFSLARQAMKELESGR* |
| INPhiseqgaiiFebDRAFT_1012866552 | 3300000364 | Soil | ELEGQLERLADKKRPLDEIRDFSFARQALKELESNK* |
| INPhiseqgaiiFebDRAFT_1019886221 | 3300000364 | Soil | AEIETIIARVGEKKRPLDEVRDFSFARQAMKELEAGK* |
| F14TC_1003435481 | 3300000559 | Soil | LAKDGQMNDAEIEFQMERLADKKRPLDEVRDFSFARQALKELEQGK* |
| JGI1027J11758_128554242 | 3300000789 | Soil | DAELEALILRVGEKKRPLDEVRDFTLARQAMKELQ* |
| AP72_2010_repI_A100DRAFT_10039911 | 3300000837 | Forest Soil | LARDGLMTDAEVESLIVRLAEKKRPLDEIRDFTPARQALKELQ* |
| JGI10214J12806_107043292 | 3300000891 | Soil | NSLIEKLADKKRPLDEVRDFSFARQAMKEWEAGR* |
| JGI11615J12901_101277712 | 3300000953 | Soil | LRGLSRDGLMSDAELEALMVKLGDKKRPVDEVRDFSLARQAMKELESGR* |
| F14TB_1034308142 | 3300001431 | Soil | KDGQMTDAEMENLMERLSDKKRPLDEVRDFSYARLALKELEAGK* |
| C687J26845_101701662 | 3300002223 | Soil | AKDGPMTDAEIEFQMERFAEKKRPLDEIRDFSFARRALKELEQNK* |
| Ga0055466_102622331 | 3300003997 | Natural And Restored Wetlands | KTLSRDGIMTDAEIEAIIARVGEKKRPLDEVRDFSFARQAMKELEAGK* |
| Ga0055465_103346202 | 3300004013 | Natural And Restored Wetlands | HSYDSELKTLSRDGILSDAEIEAIIARVGEKKRPLAEVRDFSFAREALKELEAK* |
| Ga0055493_100478062 | 3300004049 | Natural And Restored Wetlands | MSDAKLEALIVKLGDKKRPFDEVRDFSLARQALDDLGAK* |
| Ga0055491_100963602 | 3300004050 | Natural And Restored Wetlands | MSDANLEALIVKLADKKRPFDEVRDFSLARQALDDLGAK* |
| Ga0062593_1006488882 | 3300004114 | Soil | MSDAELKALMIKLGDKKRPLDEVRDFSLARQALRELESSR* |
| Ga0062593_1031366681 | 3300004114 | Soil | ELKTLSRDGTMTDAEINSIIERIGEKKRPLDEVRDFSFAREAFKELGLR* |
| Ga0062590_1026520302 | 3300004157 | Soil | LKALAKDGIMSDPEIEAQMERLADRKRPLDEIRDFSFARQAVRELEAAK* |
| Ga0063356_1027268121 | 3300004463 | Arabidopsis Thaliana Rhizosphere | TMTDAEIEFQMDRLAEKRRPLDEVRDFSFARQAMKELDSGR* |
| Ga0062383_100873171 | 3300004778 | Wetland Sediment | YDNELKNINRDGTMTDAEIESIIERIGEKKRPLNEVRDFSFAREALKELGKQ* |
| Ga0062378_101570812 | 3300004780 | Wetland Sediment | GTMTDAEIEFQMERLAEKKRPLDEVRDFSFARAALKELESAR* |
| Ga0066810_101842182 | 3300005169 | Soil | IMTDLEIDAIIARVGEKKRPLDEVRDFSFARQAMKELEAAK* |
| Ga0066688_103709161 | 3300005178 | Soil | LKTLTRDGQMTDAELEALILRVGEKKRPLDEVRDFTLARQAMKELQ* |
| Ga0066685_101661921 | 3300005180 | Soil | IRKDGQMTDAEMESFLERLGDKKRPLDEVRDFSLVRQTLKELEANK* |
| Ga0068993_102911501 | 3300005183 | Natural And Restored Wetlands | LKTLARDGQMTDAEVESLINRLAEKKRPLDEVRDFTFARQ |
| Ga0066676_101988782 | 3300005186 | Soil | TIRKDGQMTDAEMESFIERLSDKKRPLDEVRDFSLVRQALKELEANK* |
| Ga0066676_104854771 | 3300005186 | Soil | MTDAEMESFLERLGDKKRPLDEVRDFSLVRQALKELEANK* |
| Ga0065705_106811781 | 3300005294 | Switchgrass Rhizosphere | GQMTDAEMESLMERLSDKKRPLDEVRDFSYARLALKELEGGK* |
| Ga0065707_109929201 | 3300005295 | Switchgrass Rhizosphere | AKDGQMTDAEIESLMERLSDKKRPLDEVRDFSYARLALKELEAGK* |
| Ga0065707_110306421 | 3300005295 | Switchgrass Rhizosphere | GTMTDAEINSIIERIGEKKRPLDEVRDFSFAREASKELGLR* |
| Ga0070690_1006814641 | 3300005330 | Switchgrass Rhizosphere | SRDGTMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIEAGK* |
| Ga0066388_1054053161 | 3300005332 | Tropical Forest Soil | DSELKTLSRDGTMTDAEVEAIIVRVGEKKRPLDEVRDFSFARQAMKEIEAGR* |
| Ga0070673_1012393722 | 3300005364 | Switchgrass Rhizosphere | YDSELKTLSRDGTMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIDAGK* |
| Ga0066689_103600572 | 3300005447 | Soil | KDGQMTDAEIEFQMERLAEKRRPLDEIRDFSFARQAFKEIELNK* |
| Ga0073909_100211973 | 3300005526 | Surface Soil | KTLSKDGTMTDAEIETIIARVGEKKRPLDEVRDFSFARQAMKELEAGK* |
| Ga0070697_1020591372 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | RDGTMTDAEIDAIITRLGEKKRPLDEIRDFSFARQAMKELRTER* |
| Ga0066695_107455672 | 3300005553 | Soil | SYDGELKTLSRDGIMTDGEIETIIARVGEKKRPLDEVRDFSFARQAMKELETGK* |
| Ga0066698_108152591 | 3300005558 | Soil | EIEFQMERLAEKRRPLDEIRDFSFARQALKEIESNK* |
| Ga0068855_1003724893 | 3300005563 | Corn Rhizosphere | AEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIDAGK* |
| Ga0066703_107132421 | 3300005568 | Soil | MTDAEIESFIERLGDKKRPLDEVRDFSLVRQALKELEANK* |
| Ga0068859_1025763022 | 3300005617 | Switchgrass Rhizosphere | SRDGTMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIDAGK* |
| Ga0074470_107458412 | 3300005836 | Sediment (Intertidal) | LKAHAKDGTMTDAEIEFQMDRLAEKRRPLDEVRDFSFARQALKELER* |
| Ga0074470_115662581 | 3300005836 | Sediment (Intertidal) | LKTLNRDGTMTDAEIEAIIDRVGEKKRPLNEVRDFSFARDALKELSVK* |
| Ga0068860_1016707931 | 3300005843 | Switchgrass Rhizosphere | IDAIIARVGEKKRPLDEVRDFSFARQAMKELQSEK* |
| Ga0079222_101320103 | 3300006755 | Agricultural Soil | LARDGQMTDSEIEFQMERLADKKRPLDEIRDFSFARAVVKELEAGK* |
| Ga0066665_106559151 | 3300006796 | Soil | GQMTDAEIESFIERLGDKKRPLDEVRDFSLVRQALKELEASK* |
| Ga0079221_103392141 | 3300006804 | Agricultural Soil | TLSRDGTMTDAEVEAIIARVGEKKRPLNEVRDFSFARQAMKEVDAGK* |
| Ga0079220_108824181 | 3300006806 | Agricultural Soil | ALARDGQMTDAEIEFQMERLADKKRPLDEVRDFSIARQVVKELESGK* |
| Ga0075428_1002149143 | 3300006844 | Populus Rhizosphere | KALAKDGQMTDAEMENLMERLSDKKRPLDEVRDFSYARLALKELEAGK* |
| Ga0075428_1009613951 | 3300006844 | Populus Rhizosphere | MTDAEIEFQMDRLAEKRRPLDEVRDFSFARQALKELESGK* |
| Ga0075421_1011944412 | 3300006845 | Populus Rhizosphere | EIEAIIERVGDKKRPLDEVRDFSFARAALKELGR* |
| Ga0075425_1001145131 | 3300006854 | Populus Rhizosphere | ESFIERLGDKKRPLDEVRDFSLVRQALKELDANK* |
| Ga0073934_102975313 | 3300006865 | Hot Spring Sediment | TDAEIEAIIARVGEKKRPLDEVRDFSFARDALKELNLK* |
| Ga0075434_1003978272 | 3300006871 | Populus Rhizosphere | VEAIIARVGEKKRPLDEVRDFSFARQAMKEIEAGR* |
| Ga0075434_1011453122 | 3300006871 | Populus Rhizosphere | MTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIEAGR* |
| Ga0075424_1001295843 | 3300006904 | Populus Rhizosphere | GQMTDAEMEGFIERLGDKKRPLDEVRDFSLVRQALKELEGGK* |
| Ga0079219_104984661 | 3300006954 | Agricultural Soil | KDGQMTDAEVEFQMERLSEKKRPLDEVRDFSFARQALKELEGK* |
| Ga0075435_1004214641 | 3300007076 | Populus Rhizosphere | QMTDAEIEFQMERLSDKKRPLDEVRDFSFARQALKELGM* |
| Ga0066710_1032464331 | 3300009012 | Grasslands Soil | GQMTDAEIESFIERLGDKKRPLDEVRDFSLVRQALKELEASK |
| Ga0066710_1042605171 | 3300009012 | Grasslands Soil | KDGQMTDAEIEFQMERLAEKRRPLDEIRDFSFARQALKEIENK |
| Ga0105095_104017541 | 3300009053 | Freshwater Sediment | MTDAEIEAIIERVGEKKRPLDEVRDFSFARAALKELGR* |
| Ga0105095_107321501 | 3300009053 | Freshwater Sediment | LKGLSRDGLMSDAELEALMVKLGDKKRPIDEVCDFSLARQALKELESSR* |
| Ga0105107_111353411 | 3300009087 | Freshwater Sediment | DGTMTDAEIEGQMERLADKKRPLDEVRDFSFARAAWKELEAGK* |
| Ga0105250_102693131 | 3300009092 | Switchgrass Rhizosphere | RDGQMTDAEIEFQMERLADKKRPLAEVRDFSFARGAFKELEAGK* |
| Ga0111539_101981561 | 3300009094 | Populus Rhizosphere | SELKTLSRDGTMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIEGK* |
| Ga0075418_101002224 | 3300009100 | Populus Rhizosphere | DNELKSLSRDGTMTDAEVEAIIVRVGEKKRPLDEVRDFSFARQAMKELEAGK* |
| Ga0075418_104884791 | 3300009100 | Populus Rhizosphere | VEFKALAKDGQMTDAEMENLMERLSDKKRPLDEVRDFSYARLALKELEAGK* |
| Ga0105247_115263031 | 3300009101 | Switchgrass Rhizosphere | TDAEIEFQMERLADKKRPLDEVRDFSFARGAFKELEAGK* |
| Ga0066709_1028403981 | 3300009137 | Grasslands Soil | EAIIARVGEKKRPLDEVRDFSFARQAMKELEAGK* |
| Ga0114129_101744991 | 3300009147 | Populus Rhizosphere | TLSRDGIMTDLEIDAIIARVGEKKRPLDEVRDFSFARQAMKELEAAK* |
| Ga0111538_101121981 | 3300009156 | Populus Rhizosphere | DAEIEFQMERLADKKRPLDEVRDFSFARGAFKELEAGK* |
| Ga0111538_127090412 | 3300009156 | Populus Rhizosphere | LSRDGTMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIEAGR* |
| Ga0105092_103990732 | 3300009157 | Freshwater Sediment | KAITPDGQMTDAEMESLIERLGEKKKPLDEVRDFSPVRQAIKELAVGK* |
| Ga0105092_106161011 | 3300009157 | Freshwater Sediment | TDLEIDAIIARVGEKKRPLDEVRDFSFARQAMKELQ* |
| Ga0075423_100611261 | 3300009162 | Populus Rhizosphere | AEVEFQMDRLAEKKRPLDEIRDFSFARQALKELEAGK* |
| Ga0075423_106689621 | 3300009162 | Populus Rhizosphere | ELKTLSRDGTMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIEAGR* |
| Ga0113563_124561941 | 3300009167 | Freshwater Wetlands | HSYDGELKTLNRDGTMTDAEINSIIERVGDKKRNLDEVRDLSFARDAFKKMGLR* |
| Ga0105347_12833541 | 3300009609 | Soil | DAELKNLNRDGLLTDAEIEAIIERVGDKKRPLDEVRDFSFARAALKELGR* |
| Ga0105252_101527591 | 3300009678 | Soil | GLSRDGLMSDAELEALMIKLGDKKRPIDEVRDFSLARQALKELESSR* |
| Ga0126374_100226141 | 3300009792 | Tropical Forest Soil | MTDAEIEGQLERLADKKRPLDEIRDFSFARQALKEIESGK* |
| Ga0105088_10088161 | 3300009810 | Groundwater Sand | LSRDGIMTDAEIDAIIARVGEKKRPLDEVRDFSFARQAMKELQ* |
| Ga0126380_102269662 | 3300010043 | Tropical Forest Soil | MTDAEIEAIIARVGEKRRPLDEVRDFSFARDALKELGR* |
| Ga0126380_102436763 | 3300010043 | Tropical Forest Soil | TDPEIEAIIARVGEKKRPLDEVRDFSFARQAMKELQ* |
| Ga0134088_101028673 | 3300010304 | Grasslands Soil | QMTDAEMESFLERLGDKKRPLDEVRDFSLVRQTLKELEANK* |
| Ga0134086_100747982 | 3300010323 | Grasslands Soil | EFQMERLAEKRRPLDEIRDFSFARQALKEIESNK* |
| Ga0134080_100979501 | 3300010333 | Grasslands Soil | KDGQMTDAELESYLERLGDKKRPPDEERDFSLMRQALKELQANK* |
| Ga0134063_105390261 | 3300010335 | Grasslands Soil | RKDGQMTDAEIESFIERLGDKKRPLDEVRDFSLVRQALKELEANK* |
| Ga0126376_130846172 | 3300010359 | Tropical Forest Soil | AKDGTMTDAEIEGQLERLADKKRPLDEIRDFSFARQALKEIESGK* |
| Ga0126372_113116972 | 3300010360 | Tropical Forest Soil | GIMTDAEIEGQLERLADKKRPLDEIRDFSFARQALKELESGK* |
| Ga0126378_119265401 | 3300010361 | Tropical Forest Soil | EFQMERLTDKKRPLDEVRDFSFARAVFKELEAGK* |
| Ga0126383_108729311 | 3300010398 | Tropical Forest Soil | LKTLARDGLMTDAEVESLIVRLAEKKRPLDEIRDFAPARQALKELQ* |
| Ga0126383_119310733 | 3300010398 | Tropical Forest Soil | SYDGELKTLSRDGIMTDPEIEAIIARVGEKKRPLDEVRDFSFARQAMKELQ* |
| Ga0134122_112888173 | 3300010400 | Terrestrial Soil | FKALAKDGQMTDGEIEFQMDRLADKKRPLDEIRDFSFARQALKELESGK* |
| Ga0105246_118363252 | 3300011119 | Miscanthus Rhizosphere | YDSELKTLSRDGTMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIEGK* |
| Ga0137313_10958782 | 3300011403 | Soil | LAKDGQMTDSEIEFQMERLADKKRPLDEIRDFSFARQALKELDSGK* |
| Ga0137462_11338761 | 3300011421 | Soil | KTMTKDGLMSDAELEAVMVKLGDKKRPLDEVRDFSLARQAMKELEGGR* |
| Ga0137436_11798623 | 3300011423 | Soil | LKTLAKDGTMTDAEIEGQMERLADKKRPLDEVRDFSFARAAWKELESGK* |
| Ga0137464_11684681 | 3300011434 | Soil | KNINRDGTMTDAEINSIIERVGEKKRPLDEVRDFSFARDAMKELGLR* |
| Ga0137421_11112162 | 3300012039 | Soil | TDLEIDAIIARVGDKKRPLDEVRDFSFARDAMKELGLAR* |
| Ga0137389_113332161 | 3300012096 | Vadose Zone Soil | EFQMERLADKKRPLDEIRDFSFARQALKEIESSK* |
| Ga0137342_10995192 | 3300012171 | Soil | TDAEIEFQMDRLAEKRRPLDEIRDFSFARQALKELKASR* |
| Ga0137320_10255381 | 3300012172 | Soil | FELKNLTVDGLMSDAELDSLITRLGDKRRPLDEVRDFTLVRQAVKELDAGK* |
| Ga0137383_108357611 | 3300012199 | Vadose Zone Soil | AEIEAIIARVGEKKRPLDEVRDFSFARQAMKELEAGK* |
| Ga0137383_108639941 | 3300012199 | Vadose Zone Soil | QMTDAEIEFQMDRLADKKRPLDEIRDFSFARQALKELAAGK* |
| Ga0137377_106770171 | 3300012211 | Vadose Zone Soil | MTDAELEAVINRVADKKRPLDEVRDFTPARQALKELQAEK* |
| Ga0137387_108539652 | 3300012349 | Vadose Zone Soil | ALAKDGQMTDAEIEFQMERLAEKRRPLDEIRDFSFARQALKEIESNK* |
| Ga0137387_109078901 | 3300012349 | Vadose Zone Soil | QMTDAEIESFIERLGDKKRPLDEVRDFSLVRQALKELEANK* |
| Ga0137367_109825312 | 3300012353 | Vadose Zone Soil | QMTDAELEAVINRVADKKRPLDEVRDFTPARQALKELQAEK* |
| Ga0137366_101814833 | 3300012354 | Vadose Zone Soil | KALAKDGQMTDAEIEFQMERLAEKRRPLDEIRDFSFARQALKEIESNK* |
| Ga0137366_111156401 | 3300012354 | Vadose Zone Soil | TIRKDGQMTDAEMESFLERLGDKKRPLDEVRDFSLVRQALKELEANK* |
| Ga0157323_10111891 | 3300012495 | Arabidopsis Rhizosphere | GELKTLSKDGTMTDAEIEAIIARVGEKKRPLDEVRDFSFARQAMKELEAGK* |
| Ga0157351_10041721 | 3300012501 | Unplanted Soil | LKTLSKDGQMTDAEIEFQMDRLADKRRPLDEVRDFSFARQALKELAVGK* |
| Ga0157334_10744012 | 3300012509 | Soil | SKDGQMTDAEIEFQMDRLADKRRPLDEVRDFSFARQALKELAAGK* |
| Ga0137373_103605122 | 3300012532 | Vadose Zone Soil | DAEMESLMERLSDKKRPLDEVRDFSYARLALKELEAGK* |
| Ga0137397_101212513 | 3300012685 | Vadose Zone Soil | MTDAEIEAIIARVGEKKRPLDEVRDFSFARQAMKELEAGK* |
| Ga0137396_102661961 | 3300012918 | Vadose Zone Soil | KDGQMTDAEIEFQMDRLADKKRPLDEVRDFSFARQALKELAAGK* |
| Ga0137419_105030012 | 3300012925 | Vadose Zone Soil | SRDGTMTDAEIEAIIARVGEKKRPLDEVRDFSFARQAMKELEAGK* |
| Ga0164299_115500772 | 3300012958 | Soil | LAKDGQMTDAEIESLMERLSDKKRPLDEVRDFSYARLALKELEAGK* |
| Ga0164308_107791821 | 3300012985 | Soil | TDAEIEFQMDRLADKKRPLDEIRDFSFARQALKELAAGK* |
| Ga0163162_114612181 | 3300013306 | Switchgrass Rhizosphere | GTMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIEGK* |
| Ga0075301_10180072 | 3300014262 | Natural And Restored Wetlands | LKTLARDGQMTDAEVESLINRLAEKKRPLDEVRDFTFARQALKELETGK* |
| Ga0075324_11632571 | 3300014263 | Natural And Restored Wetlands | GQMTDSEIEFQMERLADKKRPLDEIRDFSFARQALKELDSGK* |
| Ga0075302_10566881 | 3300014269 | Natural And Restored Wetlands | GTMTDAEIEFQMDRLAEKRRPLDEVRDFSFARQALKELESGAR* |
| Ga0180080_10284201 | 3300014870 | Soil | AEIEFQMDRLAEKRRPLDEVRDFSFARQAMKELDAVK* |
| Ga0180074_10228622 | 3300014877 | Soil | QLARDGQMTDAEIEFQMDRLAEKRRPLDEIRDFSFARQALKELEAGR* |
| Ga0180094_10511412 | 3300014881 | Soil | LKALNRDGTMTDGEIEAIIARVGEKKRPLDEVRDFSFAREALKELNLK* |
| Ga0132256_1000230841 | 3300015372 | Arabidopsis Rhizosphere | GTMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIEAGR* |
| Ga0132256_1012538581 | 3300015372 | Arabidopsis Rhizosphere | ALARDGQMTDSEIEFQMERLADKKRPLDEIRDFSFARAVVKELEAGK* |
| Ga0132257_1009033101 | 3300015373 | Arabidopsis Rhizosphere | IEFQMDRLADKKRPLDEVRDFSFARQAMKELAAGK* |
| Ga0132257_1044410952 | 3300015373 | Arabidopsis Rhizosphere | DGQMTDSEIEFQMERLADKKRPLDEVRDFSFARQAVKELESGK* |
| Ga0132255_1035937811 | 3300015374 | Arabidopsis Rhizosphere | TMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIEGK* |
| Ga0187775_101945963 | 3300017939 | Tropical Peatland | EIEFQMDRLADKKRPLDEIRDFSFARAALKELETGK |
| Ga0184629_101814061 | 3300018084 | Groundwater Sediment | DGQMTDAELEFQMERLAEKKRPLDEIRDFSFGRQALKELEQNR |
| Ga0184629_104474611 | 3300018084 | Groundwater Sediment | LNRDGTMTDGEIEAIIARVGEKKRPLDEVRDFSFAREALKELNLK |
| Ga0193715_10348061 | 3300019878 | Soil | AESKTLSLDGTMTDAEIETIIARVGEKKRPLDEVRDFSFARQAMKELEAGK |
| Ga0193739_10458982 | 3300020003 | Soil | KTLSRDGIMTDAEIDAIIARVGEKKRPLDEVRDFSFARQAMKELETGR |
| Ga0193739_11675781 | 3300020003 | Soil | GQMTDAEIEFQMDRLAEKRRPLDEIRDFSFARQALKELEANR |
| Ga0193755_10829241 | 3300020004 | Soil | KDGQMTDAEIEFQMDRLADKKRPLDEVRDFSFARQALKELAAGK |
| Ga0180107_12307092 | 3300020064 | Groundwater Sediment | ELEALMVKLGDKKRPLDEVRDFSLARQAARELESTR |
| Ga0210379_100908203 | 3300021081 | Groundwater Sediment | RDGLMTDAELEAVMVKLGDKKRPIDEVRDFSLARQAMKELEAGK |
| Ga0210379_103267183 | 3300021081 | Groundwater Sediment | RDGQMTDGEIETLIDRLAEKKRPLDEVRDFSFARQAMKELPAGK |
| Ga0224505_102986841 | 3300022214 | Sediment | MTDAEIESIIERIGEKKRPLNEVRDFSFAREALKELGR |
| Ga0209342_101205975 | 3300025326 | Soil | MTDAEIEFQMERFAEKKRPLDEIRDFSFARRALKDA |
| Ga0210094_11137152 | 3300025549 | Natural And Restored Wetlands | MTDAEVESLINRLAEKKRPLDEVRDFTFARQALKELETGK |
| Ga0207642_104127532 | 3300025899 | Miscanthus Rhizosphere | EVEAIIARVGEKKRPLDEVRDFSFARQAMKEIDAGK |
| Ga0207660_115161111 | 3300025917 | Corn Rhizosphere | RDGTMTDAEIDAIIARVGEKKRPLDEVRDFSFARQAMKELQSEK |
| Ga0207649_111134572 | 3300025920 | Corn Rhizosphere | YDSELKTLSRDGTMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIDAGK |
| Ga0207706_105756201 | 3300025933 | Corn Rhizosphere | QMTDSEIEFQMERLADKKRPLDEVRDFSFARAVFKELEAGK |
| Ga0207706_107586451 | 3300025933 | Corn Rhizosphere | KTLSKDGTMTDAEIEAIIARVGEKKRPLDEVRDFSFARQAMKELQTER |
| Ga0210126_1304792 | 3300025946 | Natural And Restored Wetlands | TDAEINAIIERLGDKKRPLDEVRDFSFARDAFKELGMK |
| Ga0210116_10072613 | 3300025959 | Natural And Restored Wetlands | MSDAKLEALIVKLGDKKRPFDEVRDFSLARQALDDLGAK |
| Ga0207668_120358331 | 3300025972 | Switchgrass Rhizosphere | GTMTDAEIEAIIARVGEKKRPLDEVRDFSFARQAMKELEAGK |
| Ga0207648_114089202 | 3300026089 | Miscanthus Rhizosphere | LKTLAKDGQMTDAEIEFQMDRLAEKRRPLDEVRDFSFARQALKELESGK |
| Ga0207698_127110202 | 3300026142 | Corn Rhizosphere | VELKALARDGQMTDAEIEFQMERLADKKRPLDEVRDFSFARGAFKELEAGK |
| Ga0209159_10867503 | 3300026343 | Soil | GQMTDAEMESFIERLSDKKRPLDEVRDFSLVRQALKELEANK |
| Ga0209806_11891971 | 3300026529 | Soil | DLELKTIRKDGQMTDAEIESFIERLGDKKRPLDEVRDFSLVRQALKELEASK |
| Ga0209058_10658322 | 3300026536 | Soil | MTDAELEAVINRVADKKRPLDEVRDFTPARQALKELQAEK |
| Ga0209058_11612682 | 3300026536 | Soil | MTDAEIEFQMERLAEKRRPLDEIRDFSFARQALKEIESNK |
| Ga0209846_10393241 | 3300027277 | Groundwater Sand | AKDGQMTDAEIEFQMERLTEKKRPLDEIRDFSFARQAWKELEQRK |
| Ga0207981_10368823 | 3300027560 | Soil | DGTMTDAEIEFQMDRLAEKRRPLDEVRDFSFARQAMKELESAR |
| Ga0209683_103104451 | 3300027840 | Wetland Sediment | EIESIIERIGEKKRPLNEVRDFSFAREALKELGNR |
| Ga0209798_100733214 | 3300027843 | Wetland Sediment | ELKNINRDGTMTDAEIESIIERIGEKKRPLNEVRDFSFAREALKELGKQ |
| Ga0209283_109334762 | 3300027875 | Vadose Zone Soil | KALAKDGQMTDAEIEFQMERLADKKRPLDEIRDFSFARQALKEIESSK |
| Ga0207428_110557162 | 3300027907 | Populus Rhizosphere | YDNELKTLSRDGTMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIEAGR |
| Ga0207428_111304653 | 3300027907 | Populus Rhizosphere | EIEFQMERLADKKRPLDEVRDFSFARAVFKELEAGK |
| Ga0209382_117678751 | 3300027909 | Populus Rhizosphere | LKALAKDGQMTDAEVEFQMDRLAEKKRPLDEIRDFSFARQALKELEAGK |
| Ga0307281_101299172 | 3300028803 | Soil | MTDAEIEFQMDRLAEKRRPLDEVRDFSFARQALKELETGK |
| Ga0307305_103210032 | 3300028807 | Soil | GQMTDAEIEFQMDRLADKKRLLDEVRDFSFARQALKELAAGK |
| Ga0299906_102041003 | 3300030606 | Soil | LSRDGQMTDAEINALIDKLGDKKRPLDEVRDFSFARQAMKELEARK |
| Ga0307497_105615412 | 3300031226 | Soil | AELKALMIKLGDKKRPLDEVRNFSLARQALRELEIGK |
| Ga0307497_107778461 | 3300031226 | Soil | ELKTLSKDGTMTDAEIETIIARVGEKKRPLDEVRDFSFARQAMKELEAGK |
| Ga0310813_123569641 | 3300031716 | Soil | MTDAEINSIIERIGDKKRPLDEVRDFSFAREASKELGLR |
| Ga0307469_120583722 | 3300031720 | Hardwood Forest Soil | YDAELKTLTRDGQMTDGELEALILRVGEKKRPLDEVRDFTLARQAMKELQ |
| Ga0307473_108952222 | 3300031820 | Hardwood Forest Soil | KTIRKDGQMTDAEMESFIDRLGDKKRPLDEVRDFSLVRQALKELEGGK |
| Ga0310892_104074983 | 3300031858 | Soil | EVEAIIARVGEKKRPLDEVRDFSFARQAMKEIEAGK |
| Ga0307406_114834371 | 3300031901 | Rhizosphere | MSDAELEAVMIKLGDKKRSIDEVRDFSLARQAMKELESGR |
| Ga0310900_102117762 | 3300031908 | Soil | MSDAELKALMIKLGDKKRPLDEVRDFSLARQALRELESSR |
| Ga0306923_117616711 | 3300031910 | Soil | ARDGQMTDSEIEFQMDRLADKKRPLDEVRDFSFARAAFKELEAGK |
| Ga0306921_111688561 | 3300031912 | Soil | DAELKTLTRDGQMTDAELEALITRLGEKKRPLDEVRDFTLARQAMKELQ |
| Ga0310912_106281221 | 3300031941 | Soil | KDGQMTDAEMESLMKRLSDKKRPLDEVRDFSYARLALKELEAGK |
| Ga0214473_113502582 | 3300031949 | Soil | MTDAEIEFQMERFAEKKRPLDEIRDFSFARRALKELEQNK |
| Ga0326597_100893361 | 3300031965 | Soil | MTDAEIEFQMERFAEKKRPLDEIRDFSFARQALKELEQNR |
| Ga0326597_104420332 | 3300031965 | Soil | EMEFQMERLAEKKRPSDQIRDFSFARQALKELEQNN |
| Ga0310902_112196741 | 3300032012 | Soil | TDLEIAAIIARVGEKKRPLDEVRDFSFARQAMKELEAAK |
| Ga0307415_1020209331 | 3300032126 | Rhizosphere | DGTMTDAEISSIIERVGEKKRPLDEVRDFSFAREAMKELGRQ |
| Ga0315912_100400893 | 3300032157 | Soil | MSDAELEAPMITLGDKKRPLDEVRDFSLARQALRELECSR |
| Ga0315912_102073251 | 3300032157 | Soil | KGLSRDGLMSDAELEALMVTLGDKKRPLDEVRDFSLARQALRELEIGK |
| Ga0307470_107697252 | 3300032174 | Hardwood Forest Soil | LNTITKDGQMTDAEMESFIDRLGDKKRPLDEVRDFSLVRQALKELEGGK |
| Ga0307471_1000262634 | 3300032180 | Hardwood Forest Soil | IRKDGQMTDAEMEGFIERLGDKKRPLDEVRDFSLVRQALKELEGGK |
| Ga0307472_1002545423 | 3300032205 | Hardwood Forest Soil | SKDGTMTDAEIEGQLERLADKKRPLDEIRDFSFARQALKEIESGK |
| Ga0335084_100908635 | 3300033004 | Soil | TMTDAEIEFQMDRLADKRRPLDEVRDFSIARQALKELEAGK |
| Ga0310810_104301742 | 3300033412 | Soil | KTLSRDGTMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIEAGR |
| Ga0316613_100706532 | 3300033434 | Soil | MSDAELEALMVKLGDKKRPIDEVRDFSLARQALRELESRR |
| Ga0364946_104078_2_136 | 3300033815 | Sediment | AKDGQMTDAEMEFQMERLADKKRPLDEVRDFFHARQAVKELEGK |
| Ga0364929_0002596_4280_4402 | 3300034149 | Sediment | MTDTEIEFQMDRLAEKRRPLDEVRDFSFARQALKELESGK |
| ⦗Top⦘ |