| Basic Information | |
|---|---|
| Family ID | F027035 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 196 |
| Average Sequence Length | 41 residues |
| Representative Sequence | GAGARILSVSQVKATLEEFFMNLVEADRAQASAVEVSGK |
| Number of Associated Samples | 159 |
| Number of Associated Scaffolds | 196 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.49 % |
| % of genes from short scaffolds (< 2000 bps) | 86.73 % |
| Associated GOLD sequencing projects | 150 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.959 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.592 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.490 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.33% β-sheet: 0.00% Coil/Unstructured: 65.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 196 Family Scaffolds |
|---|---|---|
| PF12679 | ABC2_membrane_2 | 93.37 |
| PF01433 | Peptidase_M1 | 5.61 |
| PF08281 | Sigma70_r4_2 | 0.51 |
| PF00999 | Na_H_Exchanger | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 196 Family Scaffolds |
|---|---|---|---|
| COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 5.61 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.51 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.51 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.51 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.51 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001661|JGI12053J15887_10599127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100848978 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300002914|JGI25617J43924_10106508 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300002917|JGI25616J43925_10364082 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300004080|Ga0062385_10653394 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300004635|Ga0062388_100606725 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300004635|Ga0062388_102084696 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005332|Ga0066388_103584006 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300005332|Ga0066388_107741395 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005533|Ga0070734_10661841 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300005549|Ga0070704_101595774 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300005618|Ga0068864_100814394 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300005921|Ga0070766_10268525 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300006041|Ga0075023_100440524 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300006057|Ga0075026_101000132 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300006086|Ga0075019_10933153 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300006163|Ga0070715_10288617 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300006174|Ga0075014_100464678 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300006176|Ga0070765_100437098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium | 1225 | Open in IMG/M |
| 3300006806|Ga0079220_12002239 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300006954|Ga0079219_10387583 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300007076|Ga0075435_101700026 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300007265|Ga0099794_10172217 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300007788|Ga0099795_10010488 | All Organisms → cellular organisms → Bacteria | 2731 | Open in IMG/M |
| 3300009038|Ga0099829_11117059 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300009088|Ga0099830_11158248 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300009089|Ga0099828_10082968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2740 | Open in IMG/M |
| 3300009089|Ga0099828_10166735 | All Organisms → cellular organisms → Bacteria | 1954 | Open in IMG/M |
| 3300009137|Ga0066709_103957013 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300009522|Ga0116218_1540443 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300010324|Ga0129297_10029828 | All Organisms → cellular organisms → Bacteria | 2656 | Open in IMG/M |
| 3300010335|Ga0134063_10272411 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300010336|Ga0134071_10266587 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300010358|Ga0126370_11962147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300010358|Ga0126370_12251882 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300010359|Ga0126376_11018797 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300010360|Ga0126372_10616718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1044 | Open in IMG/M |
| 3300010360|Ga0126372_11753084 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300010371|Ga0134125_12558082 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300010376|Ga0126381_102990117 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300010396|Ga0134126_11581049 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300010398|Ga0126383_10067166 | All Organisms → cellular organisms → Bacteria | 3065 | Open in IMG/M |
| 3300011270|Ga0137391_10211215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1687 | Open in IMG/M |
| 3300011270|Ga0137391_10510795 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300011270|Ga0137391_11042580 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300011271|Ga0137393_10156919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1904 | Open in IMG/M |
| 3300011271|Ga0137393_11714144 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300012096|Ga0137389_10781858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 820 | Open in IMG/M |
| 3300012198|Ga0137364_10501821 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300012203|Ga0137399_10721566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 839 | Open in IMG/M |
| 3300012203|Ga0137399_10866709 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300012203|Ga0137399_11791407 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300012205|Ga0137362_10960531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300012285|Ga0137370_10068623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1940 | Open in IMG/M |
| 3300012285|Ga0137370_10293975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
| 3300012362|Ga0137361_10035898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3980 | Open in IMG/M |
| 3300012362|Ga0137361_10921305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
| 3300012363|Ga0137390_10180185 | All Organisms → cellular organisms → Bacteria | 2099 | Open in IMG/M |
| 3300012363|Ga0137390_11736838 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300012917|Ga0137395_11178292 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300012922|Ga0137394_11530512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300012924|Ga0137413_10296174 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300012927|Ga0137416_12075609 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300012930|Ga0137407_11094621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300012948|Ga0126375_11409337 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300012960|Ga0164301_11744723 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300015052|Ga0137411_1380296 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300015053|Ga0137405_1342186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1272 | Open in IMG/M |
| 3300015054|Ga0137420_1130981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300015054|Ga0137420_1134135 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300015242|Ga0137412_11148788 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300015371|Ga0132258_10118459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6286 | Open in IMG/M |
| 3300016319|Ga0182033_10035877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3222 | Open in IMG/M |
| 3300016319|Ga0182033_11527186 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300016341|Ga0182035_11140996 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300016371|Ga0182034_10071671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2379 | Open in IMG/M |
| 3300016404|Ga0182037_10874330 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300017654|Ga0134069_1318346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300017934|Ga0187803_10294046 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300017959|Ga0187779_10285632 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300017975|Ga0187782_11268293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300018090|Ga0187770_11763574 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300019882|Ga0193713_1201107 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300020170|Ga0179594_10169763 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300020199|Ga0179592_10047070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1958 | Open in IMG/M |
| 3300020199|Ga0179592_10510995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300020580|Ga0210403_11416250 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300020580|Ga0210403_11463177 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300020581|Ga0210399_11605459 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300020582|Ga0210395_10343330 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300020583|Ga0210401_10742412 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300021088|Ga0210404_10047588 | All Organisms → cellular organisms → Bacteria | 2002 | Open in IMG/M |
| 3300021088|Ga0210404_10385798 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300021178|Ga0210408_11239962 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300021406|Ga0210386_10219135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1617 | Open in IMG/M |
| 3300021407|Ga0210383_10319566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1336 | Open in IMG/M |
| 3300021432|Ga0210384_10986206 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300021432|Ga0210384_11485431 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300021474|Ga0210390_10258636 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300021476|Ga0187846_10432308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300021477|Ga0210398_10031879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4407 | Open in IMG/M |
| 3300021478|Ga0210402_10209839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1791 | Open in IMG/M |
| 3300021478|Ga0210402_10881606 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300021478|Ga0210402_11663974 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300021479|Ga0210410_10153302 | All Organisms → cellular organisms → Bacteria | 2054 | Open in IMG/M |
| 3300021559|Ga0210409_10598950 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300021559|Ga0210409_10718025 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300021559|Ga0210409_11095862 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300021560|Ga0126371_12462682 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300021560|Ga0126371_13574069 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300024323|Ga0247666_1087905 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300024330|Ga0137417_1091862 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300025922|Ga0207646_11320258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300026296|Ga0209235_1007809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5982 | Open in IMG/M |
| 3300026317|Ga0209154_1018240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3313 | Open in IMG/M |
| 3300026376|Ga0257167_1022177 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300026377|Ga0257171_1003105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2488 | Open in IMG/M |
| 3300026515|Ga0257158_1048049 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300026515|Ga0257158_1112865 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300026551|Ga0209648_10179949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1637 | Open in IMG/M |
| 3300026551|Ga0209648_10530516 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300026552|Ga0209577_10849622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300026959|Ga0207852_1030245 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300027174|Ga0207948_1000934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3056 | Open in IMG/M |
| 3300027376|Ga0209004_1086416 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300027502|Ga0209622_1064050 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300027562|Ga0209735_1004614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2509 | Open in IMG/M |
| 3300027605|Ga0209329_1154521 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300027635|Ga0209625_1079852 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300027660|Ga0209736_1160772 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300027667|Ga0209009_1011043 | All Organisms → cellular organisms → Bacteria | 2155 | Open in IMG/M |
| 3300027674|Ga0209118_1020961 | All Organisms → cellular organisms → Bacteria | 2083 | Open in IMG/M |
| 3300027674|Ga0209118_1211781 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300027729|Ga0209248_10167383 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300027846|Ga0209180_10195030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1168 | Open in IMG/M |
| 3300027855|Ga0209693_10104739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1401 | Open in IMG/M |
| 3300027857|Ga0209166_10612157 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300027874|Ga0209465_10039133 | All Organisms → cellular organisms → Bacteria | 2252 | Open in IMG/M |
| 3300027875|Ga0209283_10114269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1774 | Open in IMG/M |
| 3300027884|Ga0209275_10279597 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300027884|Ga0209275_10926375 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300027895|Ga0209624_10448656 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300027898|Ga0209067_10932307 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300027911|Ga0209698_10075822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2862 | Open in IMG/M |
| 3300028047|Ga0209526_10706673 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300028906|Ga0308309_10582091 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300028906|Ga0308309_10915129 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300028906|Ga0308309_11761149 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300030847|Ga0075405_12213740 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300030862|Ga0265753_1090266 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300030991|Ga0073994_12401463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1627 | Open in IMG/M |
| 3300031018|Ga0265773_1047343 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300031231|Ga0170824_105849942 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300031231|Ga0170824_121222213 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300031668|Ga0318542_10677470 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300031715|Ga0307476_10033060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3450 | Open in IMG/M |
| 3300031718|Ga0307474_10232192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1410 | Open in IMG/M |
| 3300031719|Ga0306917_11030801 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300031720|Ga0307469_10976206 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300031744|Ga0306918_10323641 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300031748|Ga0318492_10185820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1059 | Open in IMG/M |
| 3300031753|Ga0307477_10196090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1405 | Open in IMG/M |
| 3300031754|Ga0307475_11165418 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300031763|Ga0318537_10196508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300031777|Ga0318543_10450967 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300031796|Ga0318576_10210367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 915 | Open in IMG/M |
| 3300031820|Ga0307473_10700310 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300031820|Ga0307473_10814054 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300031820|Ga0307473_11349992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300031859|Ga0318527_10197942 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300031941|Ga0310912_10534192 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300031942|Ga0310916_11237553 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300031942|Ga0310916_11327057 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300031945|Ga0310913_10233249 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300031945|Ga0310913_10817356 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300031947|Ga0310909_11062080 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300031962|Ga0307479_10411088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1338 | Open in IMG/M |
| 3300032042|Ga0318545_10252653 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300032052|Ga0318506_10321052 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300032076|Ga0306924_10135664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2810 | Open in IMG/M |
| 3300032089|Ga0318525_10532478 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300032160|Ga0311301_10219053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3214 | Open in IMG/M |
| 3300032180|Ga0307471_100648155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1218 | Open in IMG/M |
| 3300032180|Ga0307471_103340163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300032205|Ga0307472_102049680 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300032770|Ga0335085_12039368 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300032782|Ga0335082_10018317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7574 | Open in IMG/M |
| 3300032783|Ga0335079_11837883 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300032892|Ga0335081_10458845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1618 | Open in IMG/M |
| 3300032892|Ga0335081_10953315 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300032895|Ga0335074_10840698 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300032954|Ga0335083_10604904 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300033289|Ga0310914_10455549 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300033290|Ga0318519_10070011 | All Organisms → cellular organisms → Bacteria | 1817 | Open in IMG/M |
| 3300033412|Ga0310810_10184769 | All Organisms → cellular organisms → Bacteria | 2377 | Open in IMG/M |
| 3300034130|Ga0370494_139888 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.14% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.08% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.08% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.57% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.06% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.55% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.04% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.04% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.53% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.53% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.53% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.02% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.02% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.02% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.02% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.02% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 0.51% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.51% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.51% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.51% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300010324 | Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I18A1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026959 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030847 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034130 | Peat soil microbial communities from wetlands in Alaska, United States - Collapse_03_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12053J15887_105991272 | 3300001661 | Forest Soil | QLRAAGGRILSVTQVKATLEEFFMNLVEADRAQASAVEVSGK* |
| JGIcombinedJ26739_1008489782 | 3300002245 | Forest Soil | AKILSVTQVKSTLEEYFMHLVEADRAQAPAVEVSGK* |
| JGI25617J43924_101065081 | 3300002914 | Grasslands Soil | IEQLRGAGARIISVSQVKATLEEFFMNLVEADRAQGAAVEVSGQ* |
| JGI25616J43925_103640821 | 3300002917 | Grasslands Soil | LRGTGARILSVSQVKATLEEFFMHLVEADRAQGAAVEVSGK* |
| Ga0062385_106533941 | 3300004080 | Bog Forest Soil | LRETGARILSVTQMKASLEEYFMHLIAADRAQAAAVDVSGK* |
| Ga0062388_1006067251 | 3300004635 | Bog Forest Soil | LDELKAAGARILAVSQIKPTLEEFFMDLVEKDRAQASAVEVSGK* |
| Ga0062388_1020846961 | 3300004635 | Bog Forest Soil | PAIEELKLAGARILSVTQIKATLEEFFMGLVAADRAQAAAVEVHGK* |
| Ga0066388_1035840062 | 3300005332 | Tropical Forest Soil | DELKAAGARIHSVSQIKPTLEDYFMHLVAADRAQASAIEVSGK* |
| Ga0066388_1077413952 | 3300005332 | Tropical Forest Soil | ATLDQLQGTGARVLSVTQVKASLEEYFMHLVEADRAQAAAVEVHGK* |
| Ga0070734_106618411 | 3300005533 | Surface Soil | RLDELKAANARILSVTQLKPTLEEFFMHLVEADRAQASAVDVSGK* |
| Ga0070704_1015957742 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VAGARITSVTQIKPTLEDFFMELVGKDRAQAAAVEVGAQ* |
| Ga0068864_1008143942 | 3300005618 | Switchgrass Rhizosphere | RVAGARITSVTQIKPTLEDFFMELVGKDRAQAAAVEVGAQ* |
| Ga0070766_102685251 | 3300005921 | Soil | ELYAAIEQLRVAGAEIISVTQVRATLEEFFMNLVEADRAQAAAVEVSGK* |
| Ga0075023_1004405242 | 3300006041 | Watersheds | ELYTAMEQLRGAGAKILSVSQVKASLEEYFMHLIEADRAQAAAVEVSGK* |
| Ga0075026_1010001321 | 3300006057 | Watersheds | GAKILSVTQVKSTLEEYFMHLVEADRAQAPAVEVSGK* |
| Ga0075019_109331531 | 3300006086 | Watersheds | LRAAGARILSVSQVKATLEEFFMNLVAADRAQASAVEVSGK* |
| Ga0070715_102886172 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | TTLEQLRGAGARILSVTQMKASLEEYFMHLVAADRAQAAAVEVHGK* |
| Ga0075014_1004646781 | 3300006174 | Watersheds | IISVAQVKATLEEFFMNLVGADRAQASAIEVSGK* |
| Ga0070765_1004370983 | 3300006176 | Soil | ILSVAQVKASLEEYFMHLIEADRAQAAAVEVSGK* |
| Ga0079220_120022391 | 3300006806 | Agricultural Soil | IEQLRGAGARILSVSQVKATLEEFFMNLVEADRAQGAAVEVSEQ* |
| Ga0079219_103875831 | 3300006954 | Agricultural Soil | IEQLRVAGARILSVAPVRATLEEFFMDLVEADRAQAAAVEVSGK* |
| Ga0075435_1017000261 | 3300007076 | Populus Rhizosphere | AGARITSVTQIKPTLEDFFMELVSKDRAQAAAIEVSAQ* |
| Ga0099794_101722171 | 3300007265 | Vadose Zone Soil | QQLCGVGATVVSVTQVKATLEEYFMHLVEADRAQAPAVEVSGK* |
| Ga0099795_100104881 | 3300007788 | Vadose Zone Soil | IISVTQIKATLEDFFMELVGKDRAQAAAVEVSGQ* |
| Ga0099829_111170592 | 3300009038 | Vadose Zone Soil | IEQLRGAGARILSVSQVKATLEEFFMNLVEADRAQAAAVEVSGK* |
| Ga0099830_111582482 | 3300009088 | Vadose Zone Soil | AEAKILSVAQLKPTLEEYFMNLVDAGRAQAAAVEVTGK* |
| Ga0099828_100829681 | 3300009089 | Vadose Zone Soil | AADARILSVTEIKVTLEEYFMHLVAADRAQAPAVEVSGK* |
| Ga0099828_101667351 | 3300009089 | Vadose Zone Soil | AAIEQLRGAGARIVSVAEVKSTLEEFFMNLVEADRAQAAAVEVNGK* |
| Ga0066709_1039570131 | 3300009137 | Grasslands Soil | QLRAAGARILSVAQVKATLEEFFTNLVEADGTHTSAVEVSGK* |
| Ga0116218_15404432 | 3300009522 | Peatlands Soil | RTAGARVLSVAQIKPTLEEFFMNLVEADRAQANAVEVSGK* |
| Ga0129297_100298281 | 3300010324 | Lake Sediment | ACEARILSVTQIKPTLEDFFFTLVGGENARRYAMEISGS* |
| Ga0134063_102724112 | 3300010335 | Grasslands Soil | KILPASLSAVARILSVSQLKATLEEFFLNLVGADRAQASAVEVSGK* |
| Ga0134071_102665872 | 3300010336 | Grasslands Soil | ILSVSQVKATLEEFFMNLVEADRAQAAAVEVSEK* |
| Ga0126370_119621472 | 3300010358 | Tropical Forest Soil | AKVISVTQIKPTLEDFFMELVGKERTQAAAVEVSGK* |
| Ga0126370_122518822 | 3300010358 | Tropical Forest Soil | AGAKILSVTQVKATLEEYFMHLVEADRAQAAAVEVSGK* |
| Ga0126376_110187972 | 3300010359 | Tropical Forest Soil | DLKAAGARIHSVTQIKPTLEEYFMNLVAADRAQASAVEVSGR* |
| Ga0126372_106167181 | 3300010360 | Tropical Forest Soil | GAIEQLRAAGARILSLAPVRATLEEFFVNLVEVDRAQAAAVEVSGK* |
| Ga0126372_117530842 | 3300010360 | Tropical Forest Soil | QARILSVTQVRATLEEYFMHLVEADRAQAAAVEVSGK* |
| Ga0134125_125580822 | 3300010371 | Terrestrial Soil | LEQLRGAGAKILSVTQVKASLEEYFMHLVEADRAQAAAVEVYGK* |
| Ga0126381_1029901171 | 3300010376 | Tropical Forest Soil | QQLCVAQARILSVTQVRATLEEYFMHLVEADRAQAAAVEVSGK* |
| Ga0134126_115810491 | 3300010396 | Terrestrial Soil | LYATLEQLKNVGARILSVTQVKASLEEFFMGLISADRARAAAVDVHGK* |
| Ga0126383_100671661 | 3300010398 | Tropical Forest Soil | RIVAVTQIKPTLEDFFMGLVGKDRAQAAAVEVSGK* |
| Ga0137391_102112151 | 3300011270 | Vadose Zone Soil | QLRAAGARILSVAQVKATLEEYFMDLVEADRAQAAAVEVSGK* |
| Ga0137391_105107951 | 3300011270 | Vadose Zone Soil | TLQQLGSAGAKILSVAQVKSTLEEYFMDLVEADRAQAPAVEVSGK* |
| Ga0137391_110425801 | 3300011270 | Vadose Zone Soil | QLRGAGARILSVSQVKATLEEFFMNLVEADRAQAAAVEVSGK* |
| Ga0137393_101569191 | 3300011271 | Vadose Zone Soil | EEVYTTLEQLRGAGAKILSMTQVKATLEEYFMHLVEADRAQAAAVEVSGK* |
| Ga0137393_117141441 | 3300011271 | Vadose Zone Soil | LGTGGAKIISVTQVKATLEEYFMHLVEADRAQAPAVEVSGK* |
| Ga0137389_107818582 | 3300012096 | Vadose Zone Soil | AEGELYTAIEQLRGVGARVFSVTQVKATLEEFFMNLEEADRAQASAVEVSGK* |
| Ga0137364_105018212 | 3300012198 | Vadose Zone Soil | EQLRGAGARILSVSQVKATLEEFFLNLVGADRAQASAVEVSGK* |
| Ga0137399_107215662 | 3300012203 | Vadose Zone Soil | AIEQLRGTGARILSVTQVKATLEEFFMNLVEADRAQAAAVEVSGK* |
| Ga0137399_108667091 | 3300012203 | Vadose Zone Soil | QQLGIAGAKILSVTQVKATLEEYFMHLVEADRAQAPAVEVSGK* |
| Ga0137399_117914071 | 3300012203 | Vadose Zone Soil | ILSVSQVKATLEEFFMNLVQADRAQASAVEVSEK* |
| Ga0137362_109605312 | 3300012205 | Vadose Zone Soil | YVAIEQLRGTGARILSVTQVKATLEEFFMNLVEADRAQAAAVEVSGK* |
| Ga0137370_100686231 | 3300012285 | Vadose Zone Soil | QLRGAGARILSVSQVKATLEEFFMNLVEADRAQGAAVEVSGQ* |
| Ga0137370_102939753 | 3300012285 | Vadose Zone Soil | RAAGAKILSVAQVKATLEEFFMNLVEADRAQAAGVEVSGK* |
| Ga0137361_100358981 | 3300012362 | Vadose Zone Soil | KLGAAGARILSVTEIKVTLEEYFMHLVAADRAQAPAVEVSGK* |
| Ga0137361_109213051 | 3300012362 | Vadose Zone Soil | QLRGVGARILSVTQVKAKQKEFFMNLVEADRAQASAVEVSGK* |
| Ga0137390_101801854 | 3300012363 | Vadose Zone Soil | GARILSVSQVKATLEEFFMNLVEADRAQAAAVEVSGK* |
| Ga0137390_117368381 | 3300012363 | Vadose Zone Soil | ARILSVTQLKPSLEEYFMHLVDAGRAQAAAVEVSGT* |
| Ga0137395_111782922 | 3300012917 | Vadose Zone Soil | KVLSVSQVRATLEEYFMHLVEADRAQAPAVEVSGK* |
| Ga0137394_115305122 | 3300012922 | Vadose Zone Soil | EQLRSAGARILSVTQVKATLEEFFMNLVEADRAQAAAVEVSGK* |
| Ga0137413_102961743 | 3300012924 | Vadose Zone Soil | LQQLGIAGAKIISVTQVKATLEEYFMHLVESDRAQAPAVEVSGK* |
| Ga0137416_120756091 | 3300012927 | Vadose Zone Soil | ARILSVTEVKMTLEEYFMHLVAADRAQAPAVEVSGK* |
| Ga0137407_110946212 | 3300012930 | Vadose Zone Soil | RIHSVSQVRATLEEFFMNLVEADRAQASAVEVSGK* |
| Ga0126375_114093372 | 3300012948 | Tropical Forest Soil | GARVLSVAQIKPTLEDFFMHLVEADRAQASAVEVSGK* |
| Ga0164301_117447231 | 3300012960 | Soil | LRGAGAKILSVTQVKASLEEYFMHLVEADRAQAAAVEVYGK* |
| Ga0137411_13802962 | 3300015052 | Vadose Zone Soil | AGAKIISVTQVKATLEEYFMHLVEADRAQAPAVEVSGK* |
| Ga0137405_13421863 | 3300015053 | Vadose Zone Soil | QLCGAGAKVLSVSPVRATLEEYFMHLVEADRAQAPAVEVSGK* |
| Ga0137420_11309811 | 3300015054 | Vadose Zone Soil | RGAGARIIISVSQVKATLEEFFMNLVEADRAQGAAVEVSGQ* |
| Ga0137420_11341351 | 3300015054 | Vadose Zone Soil | RILSVSQVKATLEEFFMNLVEADRAQGSAVEVSGK* |
| Ga0137412_111487882 | 3300015242 | Vadose Zone Soil | EQLRGAGARILSVSQVKATLEEFFLNLVEADRAQASAVEVSGK* |
| Ga0132258_101184591 | 3300015371 | Arabidopsis Rhizosphere | IISVTQIKPTLEDYFMELIGKDRAQAAAVEVSAQ* |
| Ga0182033_100358774 | 3300016319 | Soil | GALDELKAAEARILNVAQLKPTLEEVFMDLVEADRAQASAVDVSGK |
| Ga0182033_115271862 | 3300016319 | Soil | EGELYGALDELKGAGARVLSVAQIKPTLEDFFMDLVEADRAQASAVEVSGK |
| Ga0182035_111409962 | 3300016341 | Soil | KAAEARILNVAQLKPTLEEVFMDLVEADRAQASAVDVSGK |
| Ga0182034_100716714 | 3300016371 | Soil | LDELKGAGARVLSVAQIKPTLEDFFMDLVEADRAQASAVEVSGK |
| Ga0182037_108743301 | 3300016404 | Soil | ELKGAGARVLSVAQIKPTLEDFFMDLVEADRAQASAVEVSGK |
| Ga0134069_13183462 | 3300017654 | Grasslands Soil | AELYDTIDQLRAAGAKILSAAQVRATLEEFFMDLVEADRAQAAAVEVSGK |
| Ga0187803_102940461 | 3300017934 | Freshwater Sediment | TIEQLRTAGARILSVTQIKPTLEEFFMNLVEADRAQASAIEVSGK |
| Ga0187779_102856321 | 3300017959 | Tropical Peatland | QLFAALEQVKAAGGRVLSVAQLKPTLEEYFMHLVEADRAQAAAIEVNAK |
| Ga0187782_112682931 | 3300017975 | Tropical Peatland | LEQLRTAGARILSVSQERATLEEFFMNLVEADRAQASAVEVSGK |
| Ga0187770_117635741 | 3300018090 | Tropical Peatland | GARILSVAQIKPTLEEFFMNLVDADRAQANAVEVSGR |
| Ga0193713_12011072 | 3300019882 | Soil | GASATIISVTQIKPTLEDFFMELVGKDRAQAAAVEVSGQ |
| Ga0179594_101697632 | 3300020170 | Vadose Zone Soil | LRAAGVRILSVSQVKATLEEFFMNLVEADRAQASAVEVSEK |
| Ga0179592_100470701 | 3300020199 | Vadose Zone Soil | GARIVSVAEVKATLEEFFMSLVEADRAQAAAVEVSGK |
| Ga0179592_105109951 | 3300020199 | Vadose Zone Soil | RILSVTQVKATLEEFFMNLVEADRAQAAAVEVSGK |
| Ga0210403_114162501 | 3300020580 | Soil | RGVGAKILSVSQIKASLEEYFMNLMEADRAQAAAVEVSGK |
| Ga0210403_114631771 | 3300020580 | Soil | GAGAKILSVTQVKSTLEEYFMHLVEADRAQAPAVEVSGK |
| Ga0210399_116054592 | 3300020581 | Soil | GAKILSVAQVKASLEEYFMHLIEADRAQAAAVEVSGK |
| Ga0210395_103433301 | 3300020582 | Soil | RLAGARILTVTQVKATLEEYFMHLVERDRAQAAAVEVHGK |
| Ga0210401_107424122 | 3300020583 | Soil | STIEMLRETGARILSVTQMKASLEEYFMHLIEADRAQAAAVDVSGK |
| Ga0210404_100475884 | 3300021088 | Soil | GSAGAKILSVTQVKSTLEEYFMHLVEADRAQAPAVEVSEK |
| Ga0210404_103857982 | 3300021088 | Soil | EQLRAAQARILSVTQLKPTLEEYFMHLVDAGRAQAAAVEVSEK |
| Ga0210408_112399621 | 3300021178 | Soil | AGARILSVSQVKATLEEFFMNMVEGDRAQAAAVEVSGK |
| Ga0210386_102191351 | 3300021406 | Soil | AGARILSVAQIKPTLEEYFMHLVETDRAQASAVEVSGT |
| Ga0210383_103195661 | 3300021407 | Soil | PTIETLREAGARILSVTQMKASLEEYFMHLIAADRAQAAAVDVSGK |
| Ga0210384_109862062 | 3300021432 | Soil | EAELYAAIEQLRGAGAQIISVTQVKATLEEFFMNLVEADRAQAAAVEVSGK |
| Ga0210384_114854312 | 3300021432 | Soil | GAGARIVSVSQVRATLKEFFMNLVEADRAQASAVEVSGK |
| Ga0210390_102586363 | 3300021474 | Soil | ARILSVTQLKPTLEEFFMNLVDADRAQANAVEVSAQ |
| Ga0187846_104323081 | 3300021476 | Biofilm | LRAAGARILSVAQVKATLEEFFMNLVEADRAQGAAVEVSGK |
| Ga0210398_100318794 | 3300021477 | Soil | TLEQLRSAGARILSVAQIKASLEEYFMHLIAADRAQAAAVDVSGK |
| Ga0210402_102098391 | 3300021478 | Soil | AELYAAIEQLRGAGAQVISVTQVKATLEEFFMHLVEADRAQAAAVEVSGK |
| Ga0210402_108816062 | 3300021478 | Soil | GGAGARILSVTQVKSTLEEYFMHLVEADRAQAPAVEVSGK |
| Ga0210402_116639741 | 3300021478 | Soil | AALDQLRGAGAKILSVTQVKASLEEVFMGLVAADRAQASAVEVSGK |
| Ga0210410_101533021 | 3300021479 | Soil | GLYAAMEQLGAAGVKILSVTQVKPSLEEYFMHLVKADRAQAAAVEVSAK |
| Ga0210409_105989501 | 3300021559 | Soil | GARILSVSQVKATLEEFFMDLVAADRAQASAVEVSGK |
| Ga0210409_107180252 | 3300021559 | Soil | AGARVLSVSQVKATLEEFFMNLVEADRAQASAVEVSGK |
| Ga0210409_110958621 | 3300021559 | Soil | AGARILSVSQVKATLEEFFMNLVGADRAQASAVEVSGK |
| Ga0126371_124626821 | 3300021560 | Tropical Forest Soil | AGAQIISVTQIKPTLEDFFMELVGRDRAQAAAIEVSGK |
| Ga0126371_135740692 | 3300021560 | Tropical Forest Soil | AGARILSVSQLKPTLEDFFMNLVDADRAQANAVEVSGR |
| Ga0247666_10879052 | 3300024323 | Soil | AKILSVAQVKASLEEYFMNLIEADRAQGAAVEVSGK |
| Ga0137417_10918622 | 3300024330 | Vadose Zone Soil | AIEQLRAAGGRILSVSQVKATLEEFFMNLVEADRAQGSAVEVSGK |
| Ga0207646_113202582 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GAGARILSVSQVKATLEEFFMNLVEADRAQASAVEVSGK |
| Ga0209235_10078096 | 3300026296 | Grasslands Soil | GVRILSVSQVKATLEEFFMNLVEADRAQASAVEVSGK |
| Ga0209154_10182404 | 3300026317 | Soil | AKILAVARVRATLEEFFMNLVEADRAQAAAVEVSGK |
| Ga0257167_10221772 | 3300026376 | Soil | EELYAAIDQLRAAGVRILSVSQVKATLEEFFMNLVEADRAQASAVEVSGK |
| Ga0257171_10031054 | 3300026377 | Soil | RILSVAQIKPTLEEYFMHLVEADRAQASAVEVSGK |
| Ga0257158_10480491 | 3300026515 | Soil | AALQQLGTAGAKIISVTQVKATLEEYFMHLVEADRAQAPAVEVSGK |
| Ga0257158_11128651 | 3300026515 | Soil | GATIMSVTQIKPTLEDFFMELVGKDRAQAAAVEVSGQ |
| Ga0209648_101799493 | 3300026551 | Grasslands Soil | ARILSVSQVKATLEEFFMNLVEADRAQAAAVEVSEK |
| Ga0209648_105305162 | 3300026551 | Grasslands Soil | LYGAIEQLREAGARILSVSQVKAKLEEFFMHLVEADRAQGAAVEVSGK |
| Ga0209577_108496221 | 3300026552 | Soil | AGAKVLSAAEVRATVEEFFMDLVEADRAQAAAVEVSGK |
| Ga0207852_10302452 | 3300026959 | Tropical Forest Soil | KLAGARILTVTQIKATLEEFFMGLVEADRAQAAAVEVHGK |
| Ga0207948_10009341 | 3300027174 | Forest Soil | KILSVAQVKASLEEYFMHLIEADRAQAAAVEVSEK |
| Ga0209004_10864161 | 3300027376 | Forest Soil | VHVSEAELYPALDELKAAGARIASVTQLKPTLEEFFLNLVDADRAQANAVEVTGK |
| Ga0209622_10640501 | 3300027502 | Forest Soil | RILSVAQIKPTLEEYFMHLVETDRAQASAVEVSGT |
| Ga0209735_10046141 | 3300027562 | Forest Soil | YAAMERLSAAGAKILSVTQVKPSLEEYFMHLVEADRAQASAVEVRAK |
| Ga0209329_11545212 | 3300027605 | Forest Soil | AGARILQVTQMKASLEEYFMHLIEADRAQAAAVDVSEK |
| Ga0209625_10798522 | 3300027635 | Forest Soil | ERLHAAGAKLLSVTQVKPSLEEYFMHLVEADRAQAAAVEVRAK |
| Ga0209736_11607721 | 3300027660 | Forest Soil | SGLYAAMERLGAAGAKILSVTQVKPSLEEYFMHLVEADRAQGVAVEVREK |
| Ga0209009_10110434 | 3300027667 | Forest Soil | AKILSVTQVKPSLEEYFMHLVEADRTQAAAVEVRPK |
| Ga0209118_10209614 | 3300027674 | Forest Soil | IEQLRGAGARILSVSQVKATLEEFFMNLVEADRAQASAVEVSGK |
| Ga0209118_12117812 | 3300027674 | Forest Soil | VDLYATLQQLGGAGAKILLVTQVKSTLEEYFMHLVDADRAQAPAVEVSGK |
| Ga0209248_101673831 | 3300027729 | Bog Forest Soil | LDELKAAGARILSVAQLKPTLEEFFMNLVSADRAQASAVEVGAQ |
| Ga0209180_101950303 | 3300027846 | Vadose Zone Soil | IEQLRGAGARILSVSQVKATLEEFFMNLVEADRAQAAAVEVSGK |
| Ga0209693_101047391 | 3300027855 | Soil | ELYGALEQLRGVGAKILSVAQIKASLEEYFMNLIEADRAQAAAVEVSGK |
| Ga0209166_106121571 | 3300027857 | Surface Soil | HVEEADLYATLDQLKGVGARILLVTQMKASLEEFFMGLISADRAQANAVDVSGK |
| Ga0209465_100391334 | 3300027874 | Tropical Forest Soil | VGARILLVSQIKGTLEEFFMNLVETDRAQASAVEVSGK |
| Ga0209283_101142693 | 3300027875 | Vadose Zone Soil | LQQLGGARAKILSVSQVKSTLEEYFMHLVEADRAQAPAVEVSGK |
| Ga0209275_102795973 | 3300027884 | Soil | AGARILSVTQMKASLEEFFMGLVSADRARANAVDVHGK |
| Ga0209275_109263752 | 3300027884 | Soil | LEQLRGVGAKILSVAQVKASLEEYFMHLIEADRAQAAAVEVSGK |
| Ga0209624_104486561 | 3300027895 | Forest Soil | WLSAAGAKILSVTQVKPSLEEYFMHLIEVDRAQGAAVEVSAK |
| Ga0209067_109323072 | 3300027898 | Watersheds | LRAAGARILSVSQVKATLEEFFMNLVAADRAQASAVEVSGK |
| Ga0209698_100758224 | 3300027911 | Watersheds | IEQLRGAGAQIISVSQVKATLEEFFMNLVGADRAQASAIEVSGK |
| Ga0209526_107066732 | 3300028047 | Forest Soil | GAKILSVSQVRATLEEYFMHLVEAERAQAPAVEVSGK |
| Ga0308309_105820912 | 3300028906 | Soil | LYATLDQLKNAGARILSVTQMKASLEEFFMGLISADRAQATAVDVHGK |
| Ga0308309_109151291 | 3300028906 | Soil | GAQILQVTQIKASLEEYFMHLIEADRAQAAAVDVSGK |
| Ga0308309_117611491 | 3300028906 | Soil | AGARILSVAQMKASLEEYFMHLIEADRAQAAAVDVSGK |
| Ga0075405_122137402 | 3300030847 | Soil | KVAGARILSVTQIKPTLEEFFVDLVEADRAQASAVEVRGK |
| Ga0265753_10902661 | 3300030862 | Soil | QLKNAGARILSVTQMKASLEEFFMGLVSADRARANAVDVHGK |
| Ga0073994_124014631 | 3300030991 | Soil | VRAKILSVTQVKATLEEYFMHLVEGDRAQATAVEVSGK |
| Ga0265773_10473432 | 3300031018 | Soil | ETGASILSVTQMKASLEEYFMHLIEADRAQAAAVDVSGK |
| Ga0170824_1058499422 | 3300031231 | Forest Soil | LYQTLEQLKNVGARILSVTQVKASLEEFFMGLISADRARAAAVDVHGK |
| Ga0170824_1212222131 | 3300031231 | Forest Soil | MCAAKIISVTQIKPTLEDFFMDLVGKDRAQAAAIEVTGK |
| Ga0318542_106774701 | 3300031668 | Soil | ARILSVAQIKPTLEDFFMHLVEADRAQASAVEVTGK |
| Ga0307476_100330601 | 3300031715 | Hardwood Forest Soil | ARILSVTQMKASLEEFFMGLVSADRARANAVDVHGK |
| Ga0307474_102321921 | 3300031718 | Hardwood Forest Soil | DQLKNAGARILSVTQMKASLEEFFMGLISADRAQATAVDVHGK |
| Ga0306917_110308012 | 3300031719 | Soil | GLDELKAAGARILSVVQIKATLEEFFMNLVDADRAQANAIEVTGK |
| Ga0307469_109762062 | 3300031720 | Hardwood Forest Soil | EKLRDAGARILQVTQMKASLEEYFMHLIEADRAQAAAVDVSGK |
| Ga0306918_103236413 | 3300031744 | Soil | EAELYPALDELKSAGARISSVSQLKPTLEEFFMHLVDADRAQASAVEVSGK |
| Ga0318492_101858201 | 3300031748 | Soil | LYDAIDQLRSAGAKILSVAQVRATLEEFFMHLVEADRAQAAAVEVSGK |
| Ga0307477_101960901 | 3300031753 | Hardwood Forest Soil | IEQLRGAGARILTVSQVKATLEEFFMNMVEADRAQAAAVEVSGK |
| Ga0307475_111654182 | 3300031754 | Hardwood Forest Soil | AKIISVTQIKPTLEDFFMELVGKDRARASAIEVSGQ |
| Ga0318537_101965082 | 3300031763 | Soil | EAELYDAIDQLRSAGAKILSVAQVRATLEEFFMHLVEADRAQAAAVEVSGK |
| Ga0318543_104509671 | 3300031777 | Soil | VSEGELYGALDELKGAGARVLSVAQIKPTLEDFFMDLVEADRAQASAVEVSGK |
| Ga0318576_102103672 | 3300031796 | Soil | AGAKILSVAQVRATLEEFFMHLVEADRAQAAAVEVSGK |
| Ga0307473_107003101 | 3300031820 | Hardwood Forest Soil | ARILSVAQIKPTLEEFFMNLVDGDRAQANAIEVSGR |
| Ga0307473_108140542 | 3300031820 | Hardwood Forest Soil | AGARILSVTQIKPTLEEFFVDLVEADRAQASAVEVRGK |
| Ga0307473_113499922 | 3300031820 | Hardwood Forest Soil | RIVSVAEVKATLEEFFMSLVEADRAQAAAVEVSGK |
| Ga0318527_101979421 | 3300031859 | Soil | NSVGARILSVAQIKPTLEDFFMHLVEADRAQASAVEVSGK |
| Ga0310912_105341922 | 3300031941 | Soil | ELKAAGARILSVVQIKATLEEFFMNLVDADRAQANAIEVTGK |
| Ga0310916_112375532 | 3300031942 | Soil | GARILSVAQLKPTLEEFFMNLVDADRAQASAIEVSGQ |
| Ga0310916_113270572 | 3300031942 | Soil | ELKAAGARILSVSQIKGTLEEFFMNVVEADRAQASAIEVSGK |
| Ga0310913_102332491 | 3300031945 | Soil | RISSVSQLKPTLEEFFMHLVDADRAQASAVEVSGK |
| Ga0310913_108173561 | 3300031945 | Soil | SEGELHAALDELNGVGARILLVAQIKPTLEDFFMHLVEVDRAQASAVEVSGK |
| Ga0310909_110620802 | 3300031947 | Soil | LEELKAAGARILLVSQIKGTLEEFFMNLVETDRAQASAVEVSGK |
| Ga0307479_104110881 | 3300031962 | Hardwood Forest Soil | EELKVAGARILSVTQIKPTLEEFFVHLVEADRAQASAVEVHGK |
| Ga0318545_102526532 | 3300032042 | Soil | LDELKSAGARISSVSQLKPTLEEFFMHLVDADRAQASAVEVSGK |
| Ga0318506_103210522 | 3300032052 | Soil | HGAGGRILSVTQIKPTLEDFFMELVGKDRAQAAAVEVSGR |
| Ga0306924_101356641 | 3300032076 | Soil | KAAGARILSVSQIKGTLEEFFMNVVEADRAQASAIEVSGK |
| Ga0318525_105324782 | 3300032089 | Soil | GALNELNSVGARILSVAQIKPTLEDFFMHLVEADRAQASAVEVSGK |
| Ga0311301_102190531 | 3300032160 | Peatlands Soil | AIEQLRTAGARVLSVAQIKPTLEEFFMNLVEADRAQANAVEVSGK |
| Ga0307471_1006481553 | 3300032180 | Hardwood Forest Soil | LREVGAKILSVAQVKASLEEYFMHLIEADRAQGAAVEVSGK |
| Ga0307471_1033401631 | 3300032180 | Hardwood Forest Soil | ARIHSVTQVKATLEEFFMNLVEADRAQASAVEVSGK |
| Ga0307472_1020496801 | 3300032205 | Hardwood Forest Soil | RGAGARILSVSQVKATLEEFFLNLVEADRAQASAVEVSGK |
| Ga0335085_120393681 | 3300032770 | Soil | LKAAGAKIASVSQVRPTLEEYFMHLVAKDRAQASAIEVHEK |
| Ga0335082_100183177 | 3300032782 | Soil | ANARVLSVVQIKPTLEEFFMNLVDADRAQANAVEVSGR |
| Ga0335079_118378831 | 3300032783 | Soil | LKSAGARILSVTQLKPTLEEFFMNLVDADRAQANAVDVSGK |
| Ga0335081_104588451 | 3300032892 | Soil | AELYAALEELKAARARILSVAQIKPTLEEFFMNLVDADRAQANAVEVSGK |
| Ga0335081_109533151 | 3300032892 | Soil | AGARILSVTQLKPTLEEFFMNLVDADRAQANAVDVSGK |
| Ga0335074_108406982 | 3300032895 | Soil | AAGARILSVVQVKPTLEDFFMNLVDADRAQANAVEVSAP |
| Ga0335083_106049041 | 3300032954 | Soil | KAASARILSVTQLKPTLEEFFMNLVDADRAQANAVEVSWR |
| Ga0310914_104555491 | 3300033289 | Soil | KILSVTQIKPTLEDFFMELVGKDRAQAAAVEVSGR |
| Ga0318519_100700113 | 3300033290 | Soil | VAAARIVAVTQIKPTLEDFFMGLVGKDRAQAAAVEVSGK |
| Ga0310810_101847691 | 3300033412 | Soil | KILSVAQVKESLEEYFMHLIEADRAQGAAVEVSGK |
| Ga0370494_139888_16_177 | 3300034130 | Untreated Peat Soil | MKEEELYAAIEELKLAEARILTVAQVKATLEEFFMGLVEADRAQAAAVEVHGK |
| ⦗Top⦘ |