| Basic Information | |
|---|---|
| Family ID | F027024 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 196 |
| Average Sequence Length | 44 residues |
| Representative Sequence | YFSSPAVAQVPRRCGEEVARVLTGQRPLNVVNPEVYAPGAVRRAR |
| Number of Associated Samples | 158 |
| Number of Associated Scaffolds | 196 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.03 % |
| % of genes near scaffold ends (potentially truncated) | 97.45 % |
| % of genes from short scaffolds (< 2000 bps) | 89.29 % |
| Associated GOLD sequencing projects | 150 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.694 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (10.204 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.490 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.837 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.03% β-sheet: 0.00% Coil/Unstructured: 73.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 196 Family Scaffolds |
|---|---|---|
| PF00296 | Bac_luciferase | 22.45 |
| PF00206 | Lyase_1 | 6.12 |
| PF00528 | BPD_transp_1 | 6.12 |
| PF00903 | Glyoxalase | 5.61 |
| PF04392 | ABC_sub_bind | 4.59 |
| PF13561 | adh_short_C2 | 4.08 |
| PF07690 | MFS_1 | 4.08 |
| PF08241 | Methyltransf_11 | 3.06 |
| PF07859 | Abhydrolase_3 | 2.55 |
| PF03328 | HpcH_HpaI | 2.04 |
| PF01168 | Ala_racemase_N | 1.53 |
| PF00535 | Glycos_transf_2 | 1.53 |
| PF12697 | Abhydrolase_6 | 1.53 |
| PF10397 | ADSL_C | 1.02 |
| PF02518 | HATPase_c | 1.02 |
| PF04909 | Amidohydro_2 | 1.02 |
| PF01850 | PIN | 1.02 |
| PF00583 | Acetyltransf_1 | 1.02 |
| PF05378 | Hydant_A_N | 1.02 |
| PF00106 | adh_short | 1.02 |
| PF03069 | FmdA_AmdA | 1.02 |
| PF00561 | Abhydrolase_1 | 0.51 |
| PF14864 | Alkyl_sulf_C | 0.51 |
| PF02515 | CoA_transf_3 | 0.51 |
| PF02913 | FAD-oxidase_C | 0.51 |
| PF07355 | GRDB | 0.51 |
| PF12911 | OppC_N | 0.51 |
| PF03972 | MmgE_PrpD | 0.51 |
| PF11716 | MDMPI_N | 0.51 |
| PF13649 | Methyltransf_25 | 0.51 |
| PF01547 | SBP_bac_1 | 0.51 |
| PF03741 | TerC | 0.51 |
| PF07589 | PEP-CTERM | 0.51 |
| PF14595 | Thioredoxin_9 | 0.51 |
| PF13468 | Glyoxalase_3 | 0.51 |
| PF00248 | Aldo_ket_red | 0.51 |
| PF02668 | TauD | 0.51 |
| PF00012 | HSP70 | 0.51 |
| PF16868 | NMT1_3 | 0.51 |
| PF01321 | Creatinase_N | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 196 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 22.45 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 4.59 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 2.55 |
| COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 2.04 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 2.04 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 2.04 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 2.04 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 1.02 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.51 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.51 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.51 |
| COG0861 | Tellurite resistance membrane protein TerC | Inorganic ion transport and metabolism [P] | 0.51 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.51 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.51 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.69 % |
| Unclassified | root | N/A | 15.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090015|GPICI_9144121 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 2228664021|ICCgaii200_c0867195 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_14072502 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101580751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 687 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101631458 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300000955|JGI1027J12803_101769195 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101022591 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 711 | Open in IMG/M |
| 3300003324|soilH2_10117160 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1111 | Open in IMG/M |
| 3300004024|Ga0055436_10305469 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300004267|Ga0066396_10022878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 858 | Open in IMG/M |
| 3300004281|Ga0066397_10157396 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300004463|Ga0063356_103385396 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 687 | Open in IMG/M |
| 3300004633|Ga0066395_10418363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 758 | Open in IMG/M |
| 3300004633|Ga0066395_10504617 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300005175|Ga0066673_10159810 | Not Available | 1260 | Open in IMG/M |
| 3300005179|Ga0066684_10509536 | Not Available | 807 | Open in IMG/M |
| 3300005183|Ga0068993_10259270 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005186|Ga0066676_10211286 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300005213|Ga0068998_10007456 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
| 3300005332|Ga0066388_101123529 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1333 | Open in IMG/M |
| 3300005332|Ga0066388_102653121 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300005332|Ga0066388_102940513 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 871 | Open in IMG/M |
| 3300005332|Ga0066388_106182191 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005345|Ga0070692_10869943 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300005353|Ga0070669_101173174 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300005406|Ga0070703_10044447 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1397 | Open in IMG/M |
| 3300005444|Ga0070694_100242342 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300005444|Ga0070694_100908879 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300005444|Ga0070694_101145279 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300005445|Ga0070708_101826942 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300005446|Ga0066686_10926450 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 570 | Open in IMG/M |
| 3300005468|Ga0070707_100646086 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1020 | Open in IMG/M |
| 3300005518|Ga0070699_101275667 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300005536|Ga0070697_100723729 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300005543|Ga0070672_100023580 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4538 | Open in IMG/M |
| 3300005545|Ga0070695_100007946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6281 | Open in IMG/M |
| 3300005545|Ga0070695_100447901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 989 | Open in IMG/M |
| 3300005559|Ga0066700_11160964 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 504 | Open in IMG/M |
| 3300005616|Ga0068852_101501087 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300005713|Ga0066905_100576617 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300005719|Ga0068861_101285488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 711 | Open in IMG/M |
| 3300005764|Ga0066903_101280946 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1368 | Open in IMG/M |
| 3300005764|Ga0066903_101415009 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
| 3300005764|Ga0066903_107089212 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300006034|Ga0066656_10517722 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300006163|Ga0070715_10795301 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300006173|Ga0070716_100589116 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300006804|Ga0079221_11406868 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300006806|Ga0079220_11748315 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300006844|Ga0075428_101322758 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300006845|Ga0075421_100153217 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2879 | Open in IMG/M |
| 3300006845|Ga0075421_101611063 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300006845|Ga0075421_101678968 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300006846|Ga0075430_101714913 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300006846|Ga0075430_101809749 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300006847|Ga0075431_100898088 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 856 | Open in IMG/M |
| 3300006852|Ga0075433_10112610 | All Organisms → cellular organisms → Bacteria | 2414 | Open in IMG/M |
| 3300006853|Ga0075420_100559183 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300006871|Ga0075434_100266142 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
| 3300006871|Ga0075434_100597268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1123 | Open in IMG/M |
| 3300006881|Ga0068865_101400216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 624 | Open in IMG/M |
| 3300006903|Ga0075426_10320611 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300006903|Ga0075426_10714593 | Not Available | 752 | Open in IMG/M |
| 3300006904|Ga0075424_100871304 | Not Available | 960 | Open in IMG/M |
| 3300006918|Ga0079216_10703336 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300006918|Ga0079216_11297456 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 594 | Open in IMG/M |
| 3300007004|Ga0079218_11955904 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300007004|Ga0079218_12914634 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 575 | Open in IMG/M |
| 3300007265|Ga0099794_10013951 | All Organisms → cellular organisms → Bacteria | 3509 | Open in IMG/M |
| 3300009012|Ga0066710_104770340 | Not Available | 507 | Open in IMG/M |
| 3300009078|Ga0105106_11185205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Lautropia → unclassified Lautropia → Lautropia sp. | 542 | Open in IMG/M |
| 3300009093|Ga0105240_11254697 | Not Available | 783 | Open in IMG/M |
| 3300009137|Ga0066709_102865391 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300009137|Ga0066709_104338995 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 517 | Open in IMG/M |
| 3300009147|Ga0114129_10139959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3318 | Open in IMG/M |
| 3300009162|Ga0075423_10694565 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300009162|Ga0075423_10853580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 964 | Open in IMG/M |
| 3300009174|Ga0105241_10091496 | All Organisms → cellular organisms → Bacteria | 2400 | Open in IMG/M |
| 3300009795|Ga0105059_1052370 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300010043|Ga0126380_11689485 | Not Available | 568 | Open in IMG/M |
| 3300010046|Ga0126384_11371006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 658 | Open in IMG/M |
| 3300010046|Ga0126384_12419850 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300010047|Ga0126382_10514552 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300010137|Ga0126323_1144230 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300010304|Ga0134088_10040514 | All Organisms → cellular organisms → Bacteria | 2122 | Open in IMG/M |
| 3300010329|Ga0134111_10000776 | All Organisms → cellular organisms → Bacteria | 10419 | Open in IMG/M |
| 3300010358|Ga0126370_10223147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1441 | Open in IMG/M |
| 3300010358|Ga0126370_12035265 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300010360|Ga0126372_11563933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 697 | Open in IMG/M |
| 3300010360|Ga0126372_12575843 | Not Available | 560 | Open in IMG/M |
| 3300010362|Ga0126377_10774196 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300010362|Ga0126377_11589522 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300010366|Ga0126379_10998091 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300010366|Ga0126379_12563514 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 608 | Open in IMG/M |
| 3300010366|Ga0126379_12765437 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300010397|Ga0134124_10738519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 978 | Open in IMG/M |
| 3300010398|Ga0126383_10135232 | All Organisms → cellular organisms → Bacteria | 2274 | Open in IMG/M |
| 3300010399|Ga0134127_13204296 | Not Available | 535 | Open in IMG/M |
| 3300011406|Ga0137454_1013742 | Not Available | 1001 | Open in IMG/M |
| 3300011443|Ga0137457_1340741 | Not Available | 511 | Open in IMG/M |
| 3300012203|Ga0137399_10174492 | All Organisms → cellular organisms → Bacteria | 1732 | Open in IMG/M |
| 3300012205|Ga0137362_10036711 | All Organisms → cellular organisms → Bacteria | 3921 | Open in IMG/M |
| 3300012206|Ga0137380_11045149 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300012207|Ga0137381_10317157 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300012209|Ga0137379_11150939 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 682 | Open in IMG/M |
| 3300012356|Ga0137371_10585791 | Not Available | 858 | Open in IMG/M |
| 3300012360|Ga0137375_10133703 | All Organisms → cellular organisms → Bacteria | 2453 | Open in IMG/M |
| 3300012360|Ga0137375_11096195 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300012361|Ga0137360_10037348 | All Organisms → cellular organisms → Bacteria | 3412 | Open in IMG/M |
| 3300012362|Ga0137361_11025296 | Not Available | 745 | Open in IMG/M |
| 3300012396|Ga0134057_1187451 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300012685|Ga0137397_10165424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1641 | Open in IMG/M |
| 3300012685|Ga0137397_10227533 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
| 3300012912|Ga0157306_10455916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 514 | Open in IMG/M |
| 3300012930|Ga0137407_10844829 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300012930|Ga0137407_11317701 | Not Available | 686 | Open in IMG/M |
| 3300012931|Ga0153915_12997476 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300012944|Ga0137410_10125109 | All Organisms → cellular organisms → Bacteria | 1934 | Open in IMG/M |
| 3300012948|Ga0126375_10358965 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300012971|Ga0126369_10953053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 945 | Open in IMG/M |
| 3300012971|Ga0126369_11358922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica | 800 | Open in IMG/M |
| 3300012976|Ga0134076_10254896 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 749 | Open in IMG/M |
| 3300012987|Ga0164307_11417697 | Not Available | 586 | Open in IMG/M |
| 3300013306|Ga0163162_13128815 | Not Available | 531 | Open in IMG/M |
| 3300014268|Ga0075309_1115160 | Not Available | 664 | Open in IMG/M |
| 3300014883|Ga0180086_1192691 | Not Available | 529 | Open in IMG/M |
| 3300014884|Ga0180104_1003439 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3340 | Open in IMG/M |
| 3300015077|Ga0173483_10419573 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 692 | Open in IMG/M |
| 3300015245|Ga0137409_11083412 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300015359|Ga0134085_10114867 | Not Available | 1126 | Open in IMG/M |
| 3300015374|Ga0132255_105099346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha4_Bin1 | 556 | Open in IMG/M |
| 3300017792|Ga0163161_11324748 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 627 | Open in IMG/M |
| 3300017959|Ga0187779_10408797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 886 | Open in IMG/M |
| 3300018029|Ga0187787_10235152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 662 | Open in IMG/M |
| 3300018056|Ga0184623_10307974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 715 | Open in IMG/M |
| 3300018076|Ga0184609_10381633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 657 | Open in IMG/M |
| 3300018079|Ga0184627_10086140 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1651 | Open in IMG/M |
| 3300018079|Ga0184627_10552604 | Not Available | 586 | Open in IMG/M |
| 3300018081|Ga0184625_10175241 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300018433|Ga0066667_10926799 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 750 | Open in IMG/M |
| 3300019889|Ga0193743_1133386 | Not Available | 877 | Open in IMG/M |
| 3300020004|Ga0193755_1159793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 677 | Open in IMG/M |
| 3300021406|Ga0210386_11280390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 618 | Open in IMG/M |
| 3300022694|Ga0222623_10291964 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300025538|Ga0210132_1038668 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 690 | Open in IMG/M |
| 3300025549|Ga0210094_1015384 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1193 | Open in IMG/M |
| 3300025906|Ga0207699_10322706 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1084 | Open in IMG/M |
| 3300025922|Ga0207646_10205362 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
| 3300025922|Ga0207646_11572259 | Not Available | 568 | Open in IMG/M |
| 3300025923|Ga0207681_10443311 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300025936|Ga0207670_10337132 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300025940|Ga0207691_10058942 | All Organisms → cellular organisms → Bacteria | 3492 | Open in IMG/M |
| 3300026300|Ga0209027_1171164 | Not Available | 718 | Open in IMG/M |
| 3300026312|Ga0209153_1206326 | Not Available | 682 | Open in IMG/M |
| 3300026335|Ga0209804_1010806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4958 | Open in IMG/M |
| 3300026361|Ga0257176_1009122 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300026475|Ga0257147_1007281 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
| 3300026514|Ga0257168_1040949 | Not Available | 1005 | Open in IMG/M |
| 3300026532|Ga0209160_1176850 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 902 | Open in IMG/M |
| 3300026532|Ga0209160_1193709 | Not Available | 803 | Open in IMG/M |
| 3300027655|Ga0209388_1169178 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 613 | Open in IMG/M |
| 3300027880|Ga0209481_10170141 | Not Available | 1081 | Open in IMG/M |
| 3300027882|Ga0209590_10382059 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300027909|Ga0209382_10211655 | All Organisms → cellular organisms → Bacteria | 2217 | Open in IMG/M |
| 3300027909|Ga0209382_11540099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 660 | Open in IMG/M |
| 3300028381|Ga0268264_10353503 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
| 3300028592|Ga0247822_10216273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1437 | Open in IMG/M |
| 3300028673|Ga0257175_1055152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 734 | Open in IMG/M |
| 3300028715|Ga0307313_10152559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 713 | Open in IMG/M |
| 3300028792|Ga0307504_10186125 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 727 | Open in IMG/M |
| 3300028792|Ga0307504_10263673 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300028885|Ga0307304_10600191 | Not Available | 510 | Open in IMG/M |
| 3300031474|Ga0170818_113903662 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300031564|Ga0318573_10675681 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300031716|Ga0310813_10229561 | All Organisms → cellular organisms → Bacteria | 1536 | Open in IMG/M |
| 3300031740|Ga0307468_100300902 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1164 | Open in IMG/M |
| 3300031765|Ga0318554_10009959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4689 | Open in IMG/M |
| 3300031820|Ga0307473_11360584 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300031820|Ga0307473_11482268 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 514 | Open in IMG/M |
| 3300031860|Ga0318495_10089101 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300031903|Ga0307407_10431375 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300031947|Ga0310909_11357340 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300031949|Ga0214473_10513166 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300032002|Ga0307416_101084575 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300032010|Ga0318569_10518053 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300032066|Ga0318514_10024633 | Not Available | 2770 | Open in IMG/M |
| 3300032180|Ga0307471_100425186 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300032180|Ga0307471_101137303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 946 | Open in IMG/M |
| 3300032180|Ga0307471_104176776 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 510 | Open in IMG/M |
| 3300032205|Ga0307472_100254726 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1379 | Open in IMG/M |
| 3300032256|Ga0315271_10950846 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300032893|Ga0335069_10066550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 4652 | Open in IMG/M |
| 3300033433|Ga0326726_11232356 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300034090|Ga0326723_0385305 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 635 | Open in IMG/M |
| 3300034178|Ga0364934_0266923 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 648 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.20% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.18% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.10% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.57% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.06% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.55% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.55% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.04% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.02% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.02% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.02% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.02% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.02% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.02% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.02% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.02% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.02% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.51% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.51% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.51% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.51% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.51% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.51% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.51% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.51% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.51% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.51% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.51% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.51% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.51% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005213 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009795 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010137 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011406 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012396 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014268 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025538 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025549 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPICI_03482310 | 2088090015 | Soil | PAVAQVPRRCGEEVARVLTKERPLHVVNPEVYAPGHRRRGP |
| ICCgaii200_08671951 | 2228664021 | Soil | HAAYFSSPAVAQVPRRCGEEVARVLTKERPLHVVNPEVYAPGHRRRGP |
| ICChiseqgaiiFebDRAFT_140725021 | 3300000363 | Soil | AVAQIPGRCGEEVARVLAGQRPLNVVNPEIYAPGATRRAR* |
| INPhiseqgaiiFebDRAFT_1015807511 | 3300000364 | Soil | AVAQVPRRCGEEAARILTGQRPLSVVNPHVYAPGAVRRAR* |
| INPhiseqgaiiFebDRAFT_1016314581 | 3300000364 | Soil | AQVPRRCGEEVARVLTGQRPLNVVNPEIYAPGAARRARP* |
| JGI1027J12803_1017691951 | 3300000955 | Soil | YFSSAAVAQVPRRCGEEVARVLTGQRPLNVVNPEVYAPGAARRARAGS* |
| JGIcombinedJ26739_1010225911 | 3300002245 | Forest Soil | YFSSPAVAQVPRRCGEEVARVLTKERPLHVVNPEVYAPGHRRRGP* |
| soilH2_101171601 | 3300003324 | Sugarcane Root And Bulk Soil | IATPHAAYFSSPAVAAVPRRCGEEIARVLIGQRPLNVVNPEVYGPGASRRAR* |
| Ga0055436_103054692 | 3300004024 | Natural And Restored Wetlands | YFSSAAVAQVPRRCGEEVARVLTGQRPLNVVNPEVYAPGAARRLR* |
| Ga0066396_100228781 | 3300004267 | Tropical Forest Soil | VIATPHAAYFSTAAVAAVPRRCGEEVARVLTGQRPLNVVNLEVYAPGAARRAR* |
| Ga0066397_101573961 | 3300004281 | Tropical Forest Soil | HAAYFSSAAVAQVPRRCGEEVARVITGQRPLNVVNPEIYAPGAARRARP* |
| Ga0063356_1033853961 | 3300004463 | Arabidopsis Thaliana Rhizosphere | PAVAQVPRRCGEELARVLTRERPINVVNPEVYAPGAVRRGR* |
| Ga0066395_104183632 | 3300004633 | Tropical Forest Soil | FSSPAVAQVPRRCGEEIARVFAKERPLNVVNPEVYDARHRRRAE* |
| Ga0066395_105046172 | 3300004633 | Tropical Forest Soil | HAAYFSSPAVAEVPRRCGEEVARVLTGQRPINVVNPEVYAPGAARRAR* |
| Ga0066673_101598102 | 3300005175 | Soil | TAAVAAVPRRCGEEVARVLTGQRPLNVVNPEVYAPGAARRAR* |
| Ga0066684_105095363 | 3300005179 | Soil | SPAVAQVPRRCGEEIARVLTGQRPLHVVNPAVYAPGAARRAR* |
| Ga0068993_102592701 | 3300005183 | Natural And Restored Wetlands | ATPHAAYFSSAAVAQVPRRCGEEVARVLTGQRPLNVVNPEVYAPGAARRLR* |
| Ga0066676_102112864 | 3300005186 | Soil | PHAAYFSSPAVAQVPRRCGEEVARVLTGQRPLNVVNPDVYAPGAVRRAR* |
| Ga0068998_100074561 | 3300005213 | Natural And Restored Wetlands | PHAAYFSSPAVAQVPKRCGEEIARVLLKERPLNVVNPEVYAPGRVRRGR* |
| Ga0066388_1011235291 | 3300005332 | Tropical Forest Soil | AYYSSAAVAQIPGRCGEEVARVLTGQRPLNVVNPEVYAPGATRRAR* |
| Ga0066388_1026531212 | 3300005332 | Tropical Forest Soil | AVAQVPRRCGEEVARVLTGQRPINVVNPEVYAPGAARRARSR* |
| Ga0066388_1029405132 | 3300005332 | Tropical Forest Soil | AVAQVPRRCGEEIARVLTGQRPLNVVNPEVYGPGAVRRAR* |
| Ga0066388_1061821912 | 3300005332 | Tropical Forest Soil | SSAVAQVPRRCGEEVARVLTGQRPINVVNPEVYAPGAARRARPR* |
| Ga0070692_108699432 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | IAAVPRRCGEEVARVLTGQRPINVVNSEVYAEGAVRRAREAHR* |
| Ga0070669_1011731741 | 3300005353 | Switchgrass Rhizosphere | IATPHAAYFSSPAVAQVPRRCGEEVARVLTGQRPLNVVNPEVYAPGAVRRAR* |
| Ga0070703_100444473 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | TPHAAYFSSPAVAQVPRRCGEEVARVLTKERPLHVVNAEVYAPGQRRRGP* |
| Ga0070694_1002423421 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | IATPHAAYFSTAAVAQVPRRCGEELARALTGRRPLNVVNPEVYAPGAVRRAR* |
| Ga0070694_1009088792 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | AYFSSAAVAQVPRRCGEEVARVLTGQRPLNVVNPEIYAPGAARRARP* |
| Ga0070694_1011452792 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | HAAYFSSPAIAAVPRRCGEEVARVLTGQRPINVVNSEVYAEGAVRRAREAHR* |
| Ga0070708_1018269422 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | AVAQVPRRCGEEIARVLTGQRPLNVVNPEVYAPGAVRRAR* |
| Ga0066686_109264501 | 3300005446 | Soil | IATSHAAYFSSPAVAQVPRRCGEEVARVLTGQRPLHVVNPKVYAPGAVRRAR* |
| Ga0070707_1006460861 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | AAVAQVPGRCGEEVARVLAGQRPLNVVNLELYAPGATRRAR* |
| Ga0070699_1012756671 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VAEIPRRCGEEVARVLTGQRPLHVVNPEVYEPGAVRRAR* |
| Ga0070697_1007237292 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | TPHAAYFSSPAVAQVPRRCGEEVARVLTKERPLHVVNPEVYAPGHRRRGP* |
| Ga0070672_1000235806 | 3300005543 | Miscanthus Rhizosphere | YFSSPAVAQVPRRCGEEVARVLTGQRPLNVVNPEVYAPGAARRAR* |
| Ga0070695_1000079461 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | PAVAQVPRRCGEEIARVLLKERPINVVNPEVYGPGRVRRGR* |
| Ga0070695_1004479012 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | HAAYFSSPAVAQVPRRCGEEVARVLTKERPLHVVNAEVYAPGQRRRGP* |
| Ga0066700_111609641 | 3300005559 | Soil | VPRRCGEEIARALTGQRPLNVVNPEVYASGAARRS* |
| Ga0068852_1015010871 | 3300005616 | Corn Rhizosphere | LTPHAAYFSSPAVAQVPRRCGEEVARVLTKERPLHVVNPEVYAPGHRRRGP* |
| Ga0066905_1005766171 | 3300005713 | Tropical Forest Soil | TPHAAYFSSAAVAQVPRRCGEEVARVLTGQRPLNVVNPEIYAPGAARRARP* |
| Ga0068861_1012854882 | 3300005719 | Switchgrass Rhizosphere | AAYFSSPAVAQIPRRCGEEVARVLTDARPLHVVNPDVYAPGHHRRSV* |
| Ga0066903_1012809462 | 3300005764 | Tropical Forest Soil | MIATPHAAYFSSPGAAQAPKRCREDLARAPTEQHPVNVVSPEVYASGAVRRAR* |
| Ga0066903_1014150092 | 3300005764 | Tropical Forest Soil | IPGRCGEEAARVLTGQRPLNVVNPEVYQPGAVRRAR* |
| Ga0066903_1070892121 | 3300005764 | Tropical Forest Soil | SPAVAQVPRRCGEEIARVLAGERPAHVVNPDVYGSGRRRRAR* |
| Ga0066656_105177222 | 3300006034 | Soil | HAAYFSSPAVAQVPRRCGEEIARVLTGERPLNVVNPEVYAAGAVRRAR* |
| Ga0070715_107953011 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | PHAAYFSSAAVAQVPRRCGEEVARVLTGQRPLNVVNTEVYAPGAARRARAGS* |
| Ga0070716_1005891161 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | PHAAYFSSAAVAQVPRRCGEEVARVLTGQRPLNVVNPEVYAPGAARRARAGS* |
| Ga0079221_114068681 | 3300006804 | Agricultural Soil | ILTPHAAYFSSPAVAQVPRRCGEEVARVLTKERPLHVVNPEVYAPGQRRRGP* |
| Ga0079220_117483152 | 3300006806 | Agricultural Soil | IATPHAAYFSTAAVAQIPGRCGEEVARVLGGQRPLNVVNPEIYAPGAARRAR* |
| Ga0075428_1013227581 | 3300006844 | Populus Rhizosphere | STAAVAQIPGRCGEEVARVLGGQRPLNVVNPEIYAPGAARRAR* |
| Ga0075421_1001532171 | 3300006845 | Populus Rhizosphere | PRRCGEEVARVLTKERPLHVVNPEVYAPGRRRRGP* |
| Ga0075421_1016110631 | 3300006845 | Populus Rhizosphere | SPAVAAVPRRCGEEIARVLRGQRPLNVVNPEVYAPGAVRRAR* |
| Ga0075421_1016789682 | 3300006845 | Populus Rhizosphere | AQIPGRCGEEVARVLAGQRPLNVVNPEVYAKGAARRAR* |
| Ga0075430_1017149131 | 3300006846 | Populus Rhizosphere | IATPHAAYYSTAAVAQVPRRCGEEAARVLDGQRPLNVVNPEVYAPGAARRAR* |
| Ga0075430_1018097491 | 3300006846 | Populus Rhizosphere | TPHAAYFSSAAVAQVPRRCGEEVARVLTRQRPLNVVNPEVYAPGAALRAR* |
| Ga0075431_1008980883 | 3300006847 | Populus Rhizosphere | AQVPRRCGEEVARVLTGQRPLHVINPEVYAPGAARRAR* |
| Ga0075433_101126104 | 3300006852 | Populus Rhizosphere | ATPHAAYFSTAAVAAVPRRCGEEVARVLTGQRPLNVVNPAVYVPGAARRAR* |
| Ga0075420_1005591831 | 3300006853 | Populus Rhizosphere | PHAAYFSSPAVAQVPRRCGEEVARVLTGQRPLNVVNPEVYAAGAVRRAR* |
| Ga0075434_1002661424 | 3300006871 | Populus Rhizosphere | YFSSAAVAQVPRRCGEEVARVLTGQRPLNVVNPEIYTPGAARRARP* |
| Ga0075434_1005972681 | 3300006871 | Populus Rhizosphere | QVPRRCGEEIARVLTGQRPLNVVNPEVYAPGATLRRP* |
| Ga0068865_1014002161 | 3300006881 | Miscanthus Rhizosphere | AVAQVPRRCGEEIARVLLKERPINVVNPEVYGPGRVRRGR* |
| Ga0075426_103206113 | 3300006903 | Populus Rhizosphere | VAQIPRRCGEEVACVLTGQRPRNVVNPEVYAAGAVRRAR* |
| Ga0075426_107145932 | 3300006903 | Populus Rhizosphere | IPRRCGEEIARVLTGQRPLNVVNPAVYAPGAARRAR* |
| Ga0075424_1008713041 | 3300006904 | Populus Rhizosphere | PRRCGEEVARVLTGQRPLNVVNPAVYAPGAARRAR* |
| Ga0079216_107033361 | 3300006918 | Agricultural Soil | RRCGEEIARVLTGQRPLNVVNPEVYAPGAPRRAR* |
| Ga0079216_112974561 | 3300006918 | Agricultural Soil | MPYAAHPSVAVAAVPRRCGEEVARVLAGQRPLNVVNPEVYAPGAVRRARET* |
| Ga0079218_119559043 | 3300007004 | Agricultural Soil | SPAVAAVPRRCGEEVARVLTGQRPLNVVNPEVYAPGAVRRAR* |
| Ga0079218_129146342 | 3300007004 | Agricultural Soil | FSTAAVAQVPKRCGEEVARVLTKQRPLNVVNPEVYAPGALRR* |
| Ga0099794_100139515 | 3300007265 | Vadose Zone Soil | ILTPHAAYFSSPAVAQVPRRCGEEVARVLTKERPLHVVNPEVYAPGRRRRGP* |
| Ga0066710_1047703402 | 3300009012 | Grasslands Soil | ATPHAAYFSTAAVAAVPRRCGEEVARVLTGQRPLNVVNPEVYAPGAARRAR |
| Ga0105106_111852051 | 3300009078 | Freshwater Sediment | NVIATSHAAYFSTPAVAQVPGRCGEEVIRALRGERPLNVVNTAIFEPGAKRRSL* |
| Ga0105240_112546971 | 3300009093 | Corn Rhizosphere | RRCGEELARVLTRERPINVVNPEVYAPGAVRRGR* |
| Ga0066709_1028653912 | 3300009137 | Grasslands Soil | LTPHAAYFSSPAVARVPQRCGEEAARVLTGQRPLHVVNPEVYKALRT* |
| Ga0066709_1043389952 | 3300009137 | Grasslands Soil | YFSSAAVAQIPGRCGEEVARVLTGQRPLNVVNPEVYAVGAARRAG* |
| Ga0114129_101399596 | 3300009147 | Populus Rhizosphere | AAVAQVPRRCGEEVARVLTGQRPLNVVNPEIYAPGAARRARP* |
| Ga0075423_106945652 | 3300009162 | Populus Rhizosphere | AYFSSAAVAQIPRRCGEEVARVLTGQRPLNVVNPEVYAAGAIRRAR* |
| Ga0075423_108535801 | 3300009162 | Populus Rhizosphere | TPHAAYLSSVAVAEVPRRCGDEIARVLTGQRPLNVVNPEVYAPGATLRRP* |
| Ga0105241_100914961 | 3300009174 | Corn Rhizosphere | AAYFSSPAVAQVPRRCGEEVARVLTGQRPLNVVNPEVYAPGAARRAR* |
| Ga0105059_10523701 | 3300009795 | Groundwater Sand | VAQVPRRCGEEVARVLTGQRPLHVVNPEVYGPGAVRRAR* |
| Ga0126380_116894851 | 3300010043 | Tropical Forest Soil | RRCGEEIARVLAGQRPRNVVNPEVYAAGAARRAR* |
| Ga0126384_113710061 | 3300010046 | Tropical Forest Soil | TPHAAYFSSAAVARVPRRCGEEIARLLTGQRPLNVVNPEVFAAGAVRRR* |
| Ga0126384_124198501 | 3300010046 | Tropical Forest Soil | QVPRRCGEEIARVFAKERPLNVVNPEVYDARHRRRAE* |
| Ga0126382_105145522 | 3300010047 | Tropical Forest Soil | AQIPGRCGEEVARVLTGQRPLNVVNPEIYAPGAVRR* |
| Ga0126323_11442301 | 3300010137 | Soil | ILTPHAAYFSSPAVARVPQRCGEEAARALTGQRPLHVVNPEVYKALRK* |
| Ga0134088_100405143 | 3300010304 | Grasslands Soil | VPRRCGEEVARVLTGQRPLHVVNPEVYAPGAVRRAR* |
| Ga0134111_100007761 | 3300010329 | Grasslands Soil | AVPRRCGEEVARVLTGQRPLNVVNPEVYAPRAVRRAR* |
| Ga0126370_102231471 | 3300010358 | Tropical Forest Soil | IPARCGEEAARVLTGQRPLHVVNPEIYAPGAARR* |
| Ga0126370_120352651 | 3300010358 | Tropical Forest Soil | PHAAYFSSAAVAQVPRRCGEEVARVLTGQRPLNVVNPEIYAPGAARRARP* |
| Ga0126372_115639331 | 3300010360 | Tropical Forest Soil | AAYFSSPAVAQVPRRCGEEIARVFAKERPLNVVNPEVYDARHRRRAE* |
| Ga0126372_125758432 | 3300010360 | Tropical Forest Soil | AYFSSPAVAQVPRRCGEEVARVLTNQRPLHVVNTEVYAAGHQRRPL* |
| Ga0126377_107741963 | 3300010362 | Tropical Forest Soil | AAYFSSAAVAQVPRRCGEEVARVLTGQRPLNVVNPEIYAPGAARRARP* |
| Ga0126377_115895222 | 3300010362 | Tropical Forest Soil | YFSSPAVAQVPRRCGEEVARVLTNQRPLHVVNTEVYAAGHQRRPL* |
| Ga0126379_109980911 | 3300010366 | Tropical Forest Soil | VPRRCGEEVARVLTGQRPLNVVNPEIYAPGAARRARP* |
| Ga0126379_125635142 | 3300010366 | Tropical Forest Soil | WRCGEEVARVLTGQRPLNVVNPEVYAPGAVRRAR* |
| Ga0126379_127654372 | 3300010366 | Tropical Forest Soil | VAQVPRRCGEEVARVLTGQRPLNVVNPEIYAPGAARRARP* |
| Ga0134124_107385194 | 3300010397 | Terrestrial Soil | AQIPRRCGEEVARVLTNARPLHVVNPDVYAPGHHRRSV* |
| Ga0126383_101352322 | 3300010398 | Tropical Forest Soil | VPRRCGEEIARVLTGQRPLNVVNPEVYAASAARRAR* |
| Ga0134127_132042961 | 3300010399 | Terrestrial Soil | LTPHAAYFSSPAVAQVPRRCGEELARVLTRERPSNVVNPEVYAPGAVRRGR* |
| Ga0137454_10137421 | 3300011406 | Soil | PHAAYFSSPAVAQVPKRCGEEIARVLMKERPLNVVNPEVYAPGRARRGR* |
| Ga0137457_13407411 | 3300011443 | Soil | AYFSSPAVAQVPRRCGEEIARVLVKERPLNVVNPDVYAPGRVRRGR* |
| Ga0137399_101744923 | 3300012203 | Vadose Zone Soil | PHAAYFSSPAVAQVPRRCGEEVARVLTKERPLHVVNPEVYAPGHRRRGP* |
| Ga0137362_100367115 | 3300012205 | Vadose Zone Soil | AQVPRRCGEEVARVLTKERPLHVVNPEVYAPGHRRRGP* |
| Ga0137380_110451492 | 3300012206 | Vadose Zone Soil | PHAAYFSSPAVAQVPRRCGEEIARALTGERPLNVVNPEIYAPGAVRRAR* |
| Ga0137381_103171573 | 3300012207 | Vadose Zone Soil | VIVTLHAAYFSSPAVAQVPRRCGEEVARVLTNQRPLHVVNTEVYAAGHQRRPL* |
| Ga0137379_111509393 | 3300012209 | Vadose Zone Soil | RRCGEEVARVLTGQRPLNVVNPEVYAPGATLRRL* |
| Ga0137371_105857912 | 3300012356 | Vadose Zone Soil | AAYFSTAAVAAIPRRCGEEIARVLKGQRPLNVVNPEVYASGAVRRAR* |
| Ga0137375_101337035 | 3300012360 | Vadose Zone Soil | SHAAYFSSPAVAQIPRRCGEEVARVLTGQRPLHVVNPEVYAPGAVRRAR* |
| Ga0137375_110961951 | 3300012360 | Vadose Zone Soil | SHAAYFSSPAVAQIPRRCGEEVARVLTGQRPLHVVNPEVYGPGAVRRAR* |
| Ga0137360_100373485 | 3300012361 | Vadose Zone Soil | HAAYYSSPAVAQVPRRCGEEVARVLTKERPLHVVNPEVYAPGHRRRGP* |
| Ga0137361_110252961 | 3300012362 | Vadose Zone Soil | TAAVAQVPRRCGEEVARVLTGQRPLNVVNPEVYAPGAARRAR* |
| Ga0134057_11874511 | 3300012396 | Grasslands Soil | PAVAQVPRRCGEEVARVLTGQRPLHVVNPKVYAPGAVRRAR* |
| Ga0137397_101654241 | 3300012685 | Vadose Zone Soil | PHTAYFSSPAVAQVPRRCGEEIARVLLKERPINVVNPEVYGPGRVRRGR* |
| Ga0137397_102275331 | 3300012685 | Vadose Zone Soil | QIPGRCGEEVARVLTGQRPLNVVNPEVYAPGAARRAR* |
| Ga0157306_104559163 | 3300012912 | Soil | RRCGEEVARVLTNARPLHVVNPDVYAPGHHRRSI* |
| Ga0137407_108448293 | 3300012930 | Vadose Zone Soil | FSSAAVAQIPGRCGEEVARVLTSQRPLNVMNPKVYAIGATRRAE* |
| Ga0137407_113177011 | 3300012930 | Vadose Zone Soil | HAAYFSTAAVAAVPRRCGEEVARVLTGQRPLNVVNPEVYAPGAVRRAR* |
| Ga0153915_129974761 | 3300012931 | Freshwater Wetlands | PRRCGEEVARVLTGQRPLNVVNPEVYAPGAPRRAR* |
| Ga0137410_101251091 | 3300012944 | Vadose Zone Soil | TPHAAYFSSPAVAQVPKRCGEEIARVLLKERPLNVVNPEVYAPGRVRRGR* |
| Ga0126375_103589651 | 3300012948 | Tropical Forest Soil | PHAAYYSSAAVAQIPGRCGEEVARVLTGQRPLNVVNPEIYAPGAVRR* |
| Ga0126369_109530533 | 3300012971 | Tropical Forest Soil | AQIPGRCGEEAARVLTGQRPLNVVNPEVYAPGAVRRAR* |
| Ga0126369_111476572 | 3300012971 | Tropical Forest Soil | PAVAQVPRRCGEEIARVFAKERPLNVVNPEVYDARHRRRAE* |
| Ga0126369_113589223 | 3300012971 | Tropical Forest Soil | AVAAVPHRCGEEVARVLTGQRPLNVVNLEVYAPGAARRAR* |
| Ga0134076_102548963 | 3300012976 | Grasslands Soil | AVAQVPRRCGEEVARVLTGQRPLNVVNPEVYAPGATLRRL* |
| Ga0164307_114176972 | 3300012987 | Soil | PHAAYFSSPAVAQVPRRCGEEVARVLTKERPLHVVNPEVYAPGRRRRGP* |
| Ga0163162_131288151 | 3300013306 | Switchgrass Rhizosphere | QVPRRCGEEVARVLTKERPLHVVNPEVYAPGRRRRGP* |
| Ga0075309_11151602 | 3300014268 | Natural And Restored Wetlands | RRCGEEVARVLTGQRPLNVVNPEVYAPGAVLRAR* |
| Ga0180086_11926911 | 3300014883 | Soil | FSSPAVAQVPKRCGEEIARVLLKERPINVVNPEVYAPGRARRGR* |
| Ga0180104_10034395 | 3300014884 | Soil | AQVPKRCGEEIARVLLKERPVNVVNPEVYAPGRVRRGR* |
| Ga0173483_104195731 | 3300015077 | Soil | QVPRRCGEELARVLTRERPINVVNPEVYAPGAVRRGR* |
| Ga0137409_110834121 | 3300015245 | Vadose Zone Soil | PAVAQVPRRCGEEIARVLTGQRPLNVVNPEVYAPGAARRAR* |
| Ga0134085_101148672 | 3300015359 | Grasslands Soil | ATPHAAYFSTAAVAAIPRRCGEEIARVLTGQRPLNVVNPEVYSTGAVRRAR* |
| Ga0132255_1050993461 | 3300015374 | Arabidopsis Rhizosphere | IPRRCGEEVARVLTNARPLHVVNPEVYAPGHHRRSP* |
| Ga0163161_113247482 | 3300017792 | Switchgrass Rhizosphere | YFSSPAVAQVPRRCGEEVARVLTGQRPLNVVNPEVYAPGAARRAR |
| Ga0187779_104087971 | 3300017959 | Tropical Peatland | TAAVAQVPRRCGEEVARVLTKERPLHVVNPEVYAPGRRRRGP |
| Ga0187787_102351521 | 3300018029 | Tropical Peatland | VAQIPGRCGEEVARVLTGQRPLHVVNPEIYAPGAVRRAR |
| Ga0184623_103079741 | 3300018056 | Groundwater Sediment | SPAVAQVPRRCGEEIARVLVKERPLNVVNPEVYAPGRVRRGR |
| Ga0184609_103816332 | 3300018076 | Groundwater Sediment | FSSPAVAQVPRRCGEEIAHVLVKERPVNVVNPEVYAPGRVRRGR |
| Ga0184627_100861401 | 3300018079 | Groundwater Sediment | QVPRRCGEEIARVLVKERPLNVVNPEVYAPGRVRRGG |
| Ga0184627_105526042 | 3300018079 | Groundwater Sediment | VAQVPRRCGEEVARVLMKERPLNVVNPEVYAPGHRRRGP |
| Ga0184625_101752412 | 3300018081 | Groundwater Sediment | MTERPPIATPHAAYFSSPAVAQVPRRCGEEAARVLTGPLNVVNPEIYAPGAARRAR |
| Ga0066667_109267993 | 3300018433 | Grasslands Soil | AVAQVPRRCGEEVARVLTGQRPLNVVNPEVYAPGATLRRL |
| Ga0193743_11333862 | 3300019889 | Soil | AVAQVPKRCGEEIARVLVKERPVNVVNPEVYAPGRVRRGR |
| Ga0193755_11597932 | 3300020004 | Soil | VPKRCGEEIARVLVKERPLNVVNPEVYAPGRVRRGR |
| Ga0210386_112803901 | 3300021406 | Soil | VPRRCGEEVARVLTKERPLHVVNPEVYAPGHRRRGL |
| Ga0222623_102919642 | 3300022694 | Groundwater Sediment | AYFSSPAVAQVPRRCGEEVARVLTGQRPLHVVNPEVYAPGAVRRAR |
| Ga0210132_10386681 | 3300025538 | Natural And Restored Wetlands | VPRRCGEEVARALTGQRPLNVVNPEVYAPGAARRAR |
| Ga0210094_10153843 | 3300025549 | Natural And Restored Wetlands | SPAVAQVPRRCGEEIARVLLKERPLHVVNPEIYAPGRARRGR |
| Ga0207699_103227061 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LTPHAAYFSSPAVAQVPRRCGEEVARVLTKERPLHVVNPEVYAPGQRRRGP |
| Ga0207646_102053621 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | AYFSSPAVAQIPRRCGEEVARVLTNARPLHVVNPDVYAAGHHRRSAGG |
| Ga0207646_115722591 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | YFSSPAVAQVPRRCGEEVARVLTGQRPLNVVNPEVYAPGAVRRAR |
| Ga0207681_104433112 | 3300025923 | Switchgrass Rhizosphere | VAQVPRRCGEEVARVLTGQRPLNVVNPEVYEPGAVRRAR |
| Ga0207670_103371323 | 3300025936 | Switchgrass Rhizosphere | PAVAQVPRRCGEEVARVLTGQRPLNVVNPEVYAPRAVRRAR |
| Ga0207691_100589424 | 3300025940 | Miscanthus Rhizosphere | TPHAAYFSSPAVAQVPRRCGEEVARVLTGQRPLNVVNPEVYAPGAARRAR |
| Ga0209027_11711642 | 3300026300 | Grasslands Soil | STAAVAAVPRRCGEEVARVLTGQRPLNVVNPEVYAPGAARRAR |
| Ga0209153_12063261 | 3300026312 | Soil | TPHAAYFSTAAVAAVPRRCGEEVARVLTGQRPLNVVNPAVYAPGAARRAR |
| Ga0209804_10108061 | 3300026335 | Soil | SAAVAQIPRRCGEEIARVLTGQRPLNVVNPEVYTTGAVRRAR |
| Ga0257176_10091221 | 3300026361 | Soil | AYFSSPAVAQVPRRCGEEVARVLTKERPLHVVNPEVYAPGRRRRGP |
| Ga0257147_10072811 | 3300026475 | Soil | PRRCGEEVARVLTKERPLHVVNPEVYAPGRRRRGP |
| Ga0257168_10409492 | 3300026514 | Soil | YFSSPAVAQVPRRCGEEVARVLTKERPLHVVNPEVYAPGHRRRGP |
| Ga0209160_11768502 | 3300026532 | Soil | IATPHAAYFSSAAVAQVPRRCGEEIARALTGQRPLNVVNPEVYASGAARRS |
| Ga0209160_11937092 | 3300026532 | Soil | FSTAAVAAVPRRCGEEVARVLTGQRPLNVVNPEVYAPGAARRAR |
| Ga0209388_11691782 | 3300027655 | Vadose Zone Soil | HAAYYSSAAVAQIPGRCGEEVARVLTGQRPLNVVNPEVYAPGAARRAR |
| Ga0209481_101701412 | 3300027880 | Populus Rhizosphere | PHAAYFSTAAVAAVPRRCGEEIARVLTGQRPLNVVNPDVYAPGAARRAR |
| Ga0209590_103820591 | 3300027882 | Vadose Zone Soil | SPAVAQVPRRCGEEVARVLTNQRPLHVVNTEVYAAGHQRRPL |
| Ga0209382_102116551 | 3300027909 | Populus Rhizosphere | VPRRCGEEIARVLTGQRPLNVVNPEVYAPGAARRAR |
| Ga0209382_115400992 | 3300027909 | Populus Rhizosphere | IPGRCGEEVARVLGGQRPLNVVNPEIYAPGAARRAR |
| Ga0268264_103535034 | 3300028381 | Switchgrass Rhizosphere | YFSSAAVAQVPRRCGEEVARVLTGQRPLNVVNPEIYAPGAAPRARP |
| Ga0247822_102162731 | 3300028592 | Soil | PRRTAVAQVPRRCGEEVARVLTGRRPLNVVNPEVYAPGAVRRAR |
| Ga0257175_10551522 | 3300028673 | Soil | AAYFSSPAVAQVPRRCGEEVARVLTKERPLHVVNPEVYAPGHRRRGP |
| Ga0307313_101525591 | 3300028715 | Soil | AQVPKRCGEEIARVLLKERPLNVVNPEVYAPGRVRRGR |
| Ga0307504_101861252 | 3300028792 | Soil | HAAYFSSPAVAQVPRRCGEEVARVLTGQRPLNVVNPEVYAPGAARRARSGRTIE |
| Ga0307504_102636732 | 3300028792 | Soil | SSPAVAQVPRRCGEEVARVLTGERPLNVVNPEVYAPGSVRRAR |
| Ga0307304_106001912 | 3300028885 | Soil | PAVAQVPRRCGEEVARVLTKERPLHVVNPEVDAPGHRRRGP |
| Ga0170818_1139036621 | 3300031474 | Forest Soil | FFFPAVAQVPRRCGEEVARVLTGQRPLNVVNPEVYAPGAARRARAGS |
| Ga0318573_106756811 | 3300031564 | Soil | YFSSPAVAEVPRRCGEEVARVLTGQRPINVVNPEVYAPGAARRAR |
| Ga0310813_102295614 | 3300031716 | Soil | VPRRCGEAVARVLTGERPLNVVNPEVYAPGAVRRAR |
| Ga0307468_1003009023 | 3300031740 | Hardwood Forest Soil | ILTPHAAYFSSPAVAQVPRRCGEEIARILLKERPINVVNPEVYAPGRVRRGG |
| Ga0318554_100099591 | 3300031765 | Soil | AVAQIPGRCGEEVARVLTGQRPRNVVNPEVYAPGAARRAR |
| Ga0307473_113605841 | 3300031820 | Hardwood Forest Soil | ATPHAAYFSSAAVAQVPRRCGEEVARVLTGQRPLNVVNPEIYAAGAARRARP |
| Ga0307473_114822681 | 3300031820 | Hardwood Forest Soil | ATPHAAYFSSPAVAQVPRRCGEEVARVLTGQRPLNVVNPEVYAPGATLRRL |
| Ga0318495_100891013 | 3300031860 | Soil | AYYSSAAVAQIPGRCGEEVARVLTGQRPRNVVNPEVYAPGAARRAR |
| Ga0307407_104313751 | 3300031903 | Rhizosphere | PRRCGEEIARVLTGQRPLNVVNQEVYAPGAPRRAR |
| Ga0310909_113573402 | 3300031947 | Soil | LTPHAAYFSSPAVARVPQRCGEEAARVLTGQRPLHVVNPEVYKALRK |
| Ga0214473_105131661 | 3300031949 | Soil | SHAAYFSSPAVAQVPRRCGEEVARVLTGQRPLNVVNAEVYVPGAVRRPLQAGW |
| Ga0307416_1010845751 | 3300032002 | Rhizosphere | AVPRRCGEEIARVLTGQRPLNVVNPEVYAPGAARRAR |
| Ga0318569_105180531 | 3300032010 | Soil | YYSSAAVAQIPGRCGEEVARVLTGQRPLNVVNPEVYAPGATRRAR |
| Ga0318514_100246331 | 3300032066 | Soil | SSAAVAQIPGRCGEEVARVLTGQRPLNVVNPEVYAPGATRRAR |
| Ga0307471_1004251861 | 3300032180 | Hardwood Forest Soil | YFSSPAVAQVPRRCGEEIACVLTRERPINVVNPEVYASGAVRRAR |
| Ga0307471_1011373031 | 3300032180 | Hardwood Forest Soil | VPRHCGEEAARVLTGQCPLNVVNPHVYAPGAVRRAR |
| Ga0307471_1041767762 | 3300032180 | Hardwood Forest Soil | PHAAYFSSPAVAQVPRRCGEEVARVLTGQRPLNVVNPEVYAPGAARRAR |
| Ga0307472_1002547262 | 3300032205 | Hardwood Forest Soil | FSTAAVAAVPRRCGEEVARVLTGERPLNVVNPEVYAPGAVRRAR |
| Ga0315271_109508462 | 3300032256 | Sediment | MSHAAYFSSPAVAQVPRRCGEEVARVLTGQRPLNVVNPEVYAPGAARRAR |
| Ga0335069_100665505 | 3300032893 | Soil | QVPRRCGEEVARALTGQRPLNVVNPEVYAPGAVRRAR |
| Ga0326726_112323561 | 3300033433 | Peat Soil | SSPAVAQVPRRCGEEIARVLTDERPLNVVNAELYGAGHKRRGG |
| Ga0326723_0385305_496_633 | 3300034090 | Peat Soil | YFSSPAVAQVPRRCGEEVARALTGQRPLNVVNPEVYAPGAVRRAR |
| Ga0364934_0266923_494_646 | 3300034178 | Sediment | TPHAAYFSSPAIAAVPRRCGEEVARVLAGERPINVVNPEVYAPGAVRRAR |
| ⦗Top⦘ |