| Basic Information | |
|---|---|
| Family ID | F027021 |
| Family Type | Metagenome |
| Number of Sequences | 196 |
| Average Sequence Length | 41 residues |
| Representative Sequence | NDDSQIYAMLLASNPQLQKVSRQRAEKILRNRFPEYFEG |
| Number of Associated Samples | 150 |
| Number of Associated Scaffolds | 196 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.84 % |
| Associated GOLD sequencing projects | 134 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (55.102 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (36.224 % of family members) |
| Environment Ontology (ENVO) | Unclassified (86.224 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (83.673 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.76% β-sheet: 0.00% Coil/Unstructured: 52.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 196 Family Scaffolds |
|---|---|---|
| PF00149 | Metallophos | 1.02 |
| PF06147 | DUF968 | 0.51 |
| PF03237 | Terminase_6N | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.37 % |
| Unclassified | root | N/A | 31.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10039218 | All Organisms → Viruses → Predicted Viral | 2148 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10129681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 895 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10177631 | Not Available | 701 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10180479 | Not Available | 693 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10186916 | Not Available | 675 | Open in IMG/M |
| 3300000212|SI47jul10_120mDRAFT_c1045059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 728 | Open in IMG/M |
| 3300002231|KVRMV2_101334919 | Not Available | 1019 | Open in IMG/M |
| 3300002242|KVWGV2_10000328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 2738 | Open in IMG/M |
| 3300002242|KVWGV2_10200476 | Not Available | 869 | Open in IMG/M |
| 3300005427|Ga0066851_10036769 | Not Available | 1716 | Open in IMG/M |
| 3300005432|Ga0066845_10146590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 903 | Open in IMG/M |
| 3300005508|Ga0066868_10100351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 909 | Open in IMG/M |
| 3300005512|Ga0074648_1001161 | Not Available | 29025 | Open in IMG/M |
| 3300005520|Ga0066864_10219113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 540 | Open in IMG/M |
| 3300005523|Ga0066865_10086785 | Not Available | 1123 | Open in IMG/M |
| 3300006025|Ga0075474_10124933 | Not Available | 818 | Open in IMG/M |
| 3300006027|Ga0075462_10069268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1111 | Open in IMG/M |
| 3300006027|Ga0075462_10082157 | Not Available | 1009 | Open in IMG/M |
| 3300006090|Ga0082015_1008367 | Not Available | 1800 | Open in IMG/M |
| 3300006164|Ga0075441_10120361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1000 | Open in IMG/M |
| 3300006310|Ga0068471_1462942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 608 | Open in IMG/M |
| 3300006315|Ga0068487_1058311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 806 | Open in IMG/M |
| 3300006318|Ga0068475_1368543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 532 | Open in IMG/M |
| 3300006332|Ga0068500_1286282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 559 | Open in IMG/M |
| 3300006735|Ga0098038_1105863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 966 | Open in IMG/M |
| 3300006736|Ga0098033_1093499 | Not Available | 858 | Open in IMG/M |
| 3300006750|Ga0098058_1005156 | Not Available | 4014 | Open in IMG/M |
| 3300006750|Ga0098058_1045395 | Not Available | 1249 | Open in IMG/M |
| 3300006751|Ga0098040_1140667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 716 | Open in IMG/M |
| 3300006752|Ga0098048_1194384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 599 | Open in IMG/M |
| 3300006753|Ga0098039_1205084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 668 | Open in IMG/M |
| 3300006753|Ga0098039_1246801 | Not Available | 600 | Open in IMG/M |
| 3300006754|Ga0098044_1159033 | Not Available | 903 | Open in IMG/M |
| 3300006754|Ga0098044_1368831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 542 | Open in IMG/M |
| 3300006789|Ga0098054_1101183 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 1079 | Open in IMG/M |
| 3300006793|Ga0098055_1099997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1133 | Open in IMG/M |
| 3300006793|Ga0098055_1142384 | Not Available | 925 | Open in IMG/M |
| 3300006802|Ga0070749_10289832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 920 | Open in IMG/M |
| 3300006802|Ga0070749_10449913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 706 | Open in IMG/M |
| 3300006810|Ga0070754_10282016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 750 | Open in IMG/M |
| 3300006810|Ga0070754_10306666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 711 | Open in IMG/M |
| 3300006862|Ga0079299_1055789 | Not Available | 773 | Open in IMG/M |
| 3300006869|Ga0075477_10167821 | Not Available | 910 | Open in IMG/M |
| 3300006874|Ga0075475_10333834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 620 | Open in IMG/M |
| 3300006916|Ga0070750_10423445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 553 | Open in IMG/M |
| 3300006919|Ga0070746_10190094 | Not Available | 982 | Open in IMG/M |
| 3300006919|Ga0070746_10378613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 637 | Open in IMG/M |
| 3300006921|Ga0098060_1060772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1103 | Open in IMG/M |
| 3300006924|Ga0098051_1194373 | Not Available | 531 | Open in IMG/M |
| 3300006926|Ga0098057_1044521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1093 | Open in IMG/M |
| 3300006926|Ga0098057_1093580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 732 | Open in IMG/M |
| 3300006927|Ga0098034_1090639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 879 | Open in IMG/M |
| 3300006929|Ga0098036_1179824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 644 | Open in IMG/M |
| 3300007236|Ga0075463_10036855 | Not Available | 1595 | Open in IMG/M |
| 3300007539|Ga0099849_1268219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 623 | Open in IMG/M |
| 3300007539|Ga0099849_1328261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 547 | Open in IMG/M |
| 3300007540|Ga0099847_1067498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1109 | Open in IMG/M |
| 3300007541|Ga0099848_1093026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1164 | Open in IMG/M |
| 3300008012|Ga0075480_10229426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 969 | Open in IMG/M |
| 3300008050|Ga0098052_1078539 | Not Available | 1371 | Open in IMG/M |
| 3300008050|Ga0098052_1254584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 671 | Open in IMG/M |
| 3300008050|Ga0098052_1262098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 659 | Open in IMG/M |
| 3300008218|Ga0114904_1028229 | Not Available | 1581 | Open in IMG/M |
| 3300009173|Ga0114996_10254695 | Not Available | 1390 | Open in IMG/M |
| 3300009173|Ga0114996_10378633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1090 | Open in IMG/M |
| 3300009420|Ga0114994_10351958 | Not Available | 978 | Open in IMG/M |
| 3300009420|Ga0114994_10462729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 837 | Open in IMG/M |
| 3300009420|Ga0114994_10480748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 819 | Open in IMG/M |
| 3300009425|Ga0114997_10207679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1123 | Open in IMG/M |
| 3300009433|Ga0115545_1155336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 797 | Open in IMG/M |
| 3300009435|Ga0115546_1188479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 717 | Open in IMG/M |
| 3300009438|Ga0115559_1192967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 738 | Open in IMG/M |
| 3300009440|Ga0115561_1025560 | Not Available | 2869 | Open in IMG/M |
| 3300009441|Ga0115007_10179087 | All Organisms → Viruses → Predicted Viral | 1365 | Open in IMG/M |
| 3300009481|Ga0114932_10028910 | All Organisms → Viruses → Predicted Viral | 3715 | Open in IMG/M |
| 3300009481|Ga0114932_10316885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 933 | Open in IMG/M |
| 3300009481|Ga0114932_10329729 | Not Available | 912 | Open in IMG/M |
| 3300009481|Ga0114932_10460652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 750 | Open in IMG/M |
| 3300009481|Ga0114932_10627211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 628 | Open in IMG/M |
| 3300009495|Ga0115571_1124359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1099 | Open in IMG/M |
| 3300009507|Ga0115572_10226942 | Not Available | 1073 | Open in IMG/M |
| 3300009593|Ga0115011_10088393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 2171 | Open in IMG/M |
| 3300009602|Ga0114900_1038902 | Not Available | 1530 | Open in IMG/M |
| 3300009620|Ga0114912_1114856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 639 | Open in IMG/M |
| 3300009703|Ga0114933_10667035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 668 | Open in IMG/M |
| 3300009703|Ga0114933_10749092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 624 | Open in IMG/M |
| 3300009785|Ga0115001_10259264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1111 | Open in IMG/M |
| 3300009786|Ga0114999_11215081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 537 | Open in IMG/M |
| 3300009790|Ga0115012_10117747 | Not Available | 1880 | Open in IMG/M |
| 3300009790|Ga0115012_11340925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 608 | Open in IMG/M |
| 3300010150|Ga0098056_1078299 | All Organisms → Viruses → Predicted Viral | 1132 | Open in IMG/M |
| 3300010151|Ga0098061_1172486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 776 | Open in IMG/M |
| 3300010153|Ga0098059_1076534 | All Organisms → Viruses → Predicted Viral | 1336 | Open in IMG/M |
| 3300010153|Ga0098059_1232871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 712 | Open in IMG/M |
| 3300010155|Ga0098047_10102021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1119 | Open in IMG/M |
| 3300010155|Ga0098047_10332968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 571 | Open in IMG/M |
| 3300010297|Ga0129345_1313591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 542 | Open in IMG/M |
| 3300010300|Ga0129351_1346624 | Not Available | 557 | Open in IMG/M |
| 3300010368|Ga0129324_10262586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 686 | Open in IMG/M |
| 3300010883|Ga0133547_11912906 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 1091 | Open in IMG/M |
| 3300011013|Ga0114934_10050630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 2141 | Open in IMG/M |
| 3300011013|Ga0114934_10313407 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 706 | Open in IMG/M |
| 3300011013|Ga0114934_10352319 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 659 | Open in IMG/M |
| 3300017697|Ga0180120_10155048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 969 | Open in IMG/M |
| 3300017702|Ga0181374_1016840 | Not Available | 1311 | Open in IMG/M |
| 3300017713|Ga0181391_1043790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1067 | Open in IMG/M |
| 3300017715|Ga0181370_1024868 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 780 | Open in IMG/M |
| 3300017726|Ga0181381_1053564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 882 | Open in IMG/M |
| 3300017727|Ga0181401_1052292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1115 | Open in IMG/M |
| 3300017728|Ga0181419_1061862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 959 | Open in IMG/M |
| 3300017732|Ga0181415_1065678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 821 | Open in IMG/M |
| 3300017732|Ga0181415_1115847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 604 | Open in IMG/M |
| 3300017733|Ga0181426_1128223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 511 | Open in IMG/M |
| 3300017738|Ga0181428_1037037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1134 | Open in IMG/M |
| 3300017742|Ga0181399_1160483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 537 | Open in IMG/M |
| 3300017746|Ga0181389_1073578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 966 | Open in IMG/M |
| 3300017760|Ga0181408_1174891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 549 | Open in IMG/M |
| 3300017765|Ga0181413_1067284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1101 | Open in IMG/M |
| 3300017765|Ga0181413_1177176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 639 | Open in IMG/M |
| 3300017768|Ga0187220_1119962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 795 | Open in IMG/M |
| 3300017769|Ga0187221_1099461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 889 | Open in IMG/M |
| 3300017782|Ga0181380_1103788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 985 | Open in IMG/M |
| 3300017783|Ga0181379_1016858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2993 | Open in IMG/M |
| 3300017783|Ga0181379_1070968 | Not Available | 1303 | Open in IMG/M |
| 3300019937|Ga0194022_1018990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 906 | Open in IMG/M |
| 3300020174|Ga0181603_10295779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 627 | Open in IMG/M |
| 3300020364|Ga0211538_1056444 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 1217 | Open in IMG/M |
| 3300020371|Ga0211500_1137064 | Not Available | 718 | Open in IMG/M |
| 3300020394|Ga0211497_10175223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 828 | Open in IMG/M |
| 3300020403|Ga0211532_10274469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 654 | Open in IMG/M |
| 3300020410|Ga0211699_10309924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 616 | Open in IMG/M |
| 3300020417|Ga0211528_10263760 | Not Available | 649 | Open in IMG/M |
| 3300020438|Ga0211576_10500269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 614 | Open in IMG/M |
| 3300020462|Ga0211546_10010853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4669 | Open in IMG/M |
| 3300020478|Ga0211503_10301095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 876 | Open in IMG/M |
| 3300022050|Ga0196883_1007690 | Not Available | 1260 | Open in IMG/M |
| 3300022065|Ga0212024_1007027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1579 | Open in IMG/M |
| 3300022065|Ga0212024_1019483 | Not Available | 1097 | Open in IMG/M |
| 3300022187|Ga0196899_1001352 | Not Available | 12124 | Open in IMG/M |
| 3300022187|Ga0196899_1083887 | Not Available | 970 | Open in IMG/M |
| 3300022198|Ga0196905_1041812 | Not Available | 1333 | Open in IMG/M |
| 3300022198|Ga0196905_1084010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 864 | Open in IMG/M |
| 3300022225|Ga0187833_10212629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1127 | Open in IMG/M |
| 3300022227|Ga0187827_10576500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 661 | Open in IMG/M |
| 3300023237|Ga0222650_1027150 | Not Available | 1149 | Open in IMG/M |
| 3300024262|Ga0210003_1219872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 766 | Open in IMG/M |
| 3300025069|Ga0207887_1020408 | Not Available | 1047 | Open in IMG/M |
| 3300025085|Ga0208792_1011488 | Not Available | 1998 | Open in IMG/M |
| 3300025086|Ga0208157_1036196 | Not Available | 1395 | Open in IMG/M |
| 3300025097|Ga0208010_1003984 | Not Available | 4377 | Open in IMG/M |
| 3300025097|Ga0208010_1062461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 809 | Open in IMG/M |
| 3300025097|Ga0208010_1073608 | Not Available | 728 | Open in IMG/M |
| 3300025099|Ga0208669_1038910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1126 | Open in IMG/M |
| 3300025099|Ga0208669_1050654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 950 | Open in IMG/M |
| 3300025102|Ga0208666_1091054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 767 | Open in IMG/M |
| 3300025103|Ga0208013_1027539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1641 | Open in IMG/M |
| 3300025108|Ga0208793_1070254 | All Organisms → Viruses → Predicted Viral | 1031 | Open in IMG/M |
| 3300025118|Ga0208790_1122328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 740 | Open in IMG/M |
| 3300025118|Ga0208790_1147856 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 652 | Open in IMG/M |
| 3300025118|Ga0208790_1214914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 500 | Open in IMG/M |
| 3300025122|Ga0209434_1106208 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 798 | Open in IMG/M |
| 3300025122|Ga0209434_1180668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 557 | Open in IMG/M |
| 3300025133|Ga0208299_1150289 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 733 | Open in IMG/M |
| 3300025168|Ga0209337_1129144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1127 | Open in IMG/M |
| 3300025267|Ga0208179_1044307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1032 | Open in IMG/M |
| 3300025280|Ga0208449_1111954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 631 | Open in IMG/M |
| 3300025508|Ga0208148_1016812 | Not Available | 2130 | Open in IMG/M |
| 3300025621|Ga0209504_1060789 | Not Available | 1109 | Open in IMG/M |
| 3300025652|Ga0208134_1061165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1152 | Open in IMG/M |
| 3300025671|Ga0208898_1001225 | Not Available | 17314 | Open in IMG/M |
| 3300025674|Ga0208162_1067276 | Not Available | 1144 | Open in IMG/M |
| 3300025674|Ga0208162_1155957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 620 | Open in IMG/M |
| 3300025685|Ga0209095_1225934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 506 | Open in IMG/M |
| 3300025759|Ga0208899_1095250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1123 | Open in IMG/M |
| 3300025830|Ga0209832_1135351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 740 | Open in IMG/M |
| 3300025890|Ga0209631_10178265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1115 | Open in IMG/M |
| 3300026258|Ga0208130_1004144 | All Organisms → Viruses | 6286 | Open in IMG/M |
| 3300027791|Ga0209830_10135166 | Not Available | 1194 | Open in IMG/M |
| 3300027801|Ga0209091_10236057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 895 | Open in IMG/M |
| 3300027844|Ga0209501_10254373 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 1101 | Open in IMG/M |
| 3300028194|Ga0257106_1080392 | Not Available | 1192 | Open in IMG/M |
| (restricted) 3300028553|Ga0247839_1354821 | Not Available | 532 | Open in IMG/M |
| 3300029448|Ga0183755_1024440 | Not Available | 1907 | Open in IMG/M |
| 3300031143|Ga0308025_1147634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 835 | Open in IMG/M |
| 3300031510|Ga0308010_1026047 | Not Available | 2496 | Open in IMG/M |
| 3300031569|Ga0307489_10387380 | Not Available | 927 | Open in IMG/M |
| 3300031630|Ga0308004_10070952 | Not Available | 1507 | Open in IMG/M |
| 3300031647|Ga0308012_10037316 | Not Available | 1864 | Open in IMG/M |
| 3300031658|Ga0307984_1069448 | Not Available | 1065 | Open in IMG/M |
| 3300032006|Ga0310344_10930338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 732 | Open in IMG/M |
| 3300032278|Ga0310345_10471379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1194 | Open in IMG/M |
| 3300032278|Ga0310345_11704747 | Not Available | 615 | Open in IMG/M |
| 3300032820|Ga0310342_102281686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 648 | Open in IMG/M |
| 3300032820|Ga0310342_102650092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 599 | Open in IMG/M |
| 3300032820|Ga0310342_102684247 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 595 | Open in IMG/M |
| 3300033742|Ga0314858_044848 | Not Available | 1058 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 36.22% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 15.82% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 9.18% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.61% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 5.10% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.59% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 4.08% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 2.55% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.55% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.55% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.04% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.53% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.02% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 1.02% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.51% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.51% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.51% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.51% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.51% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.51% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.51% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.51% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.51% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.51% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.51% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000212 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 120m | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300005427 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 | Environmental | Open in IMG/M |
| 3300005432 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 | Environmental | Open in IMG/M |
| 3300005508 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV259 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005520 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV251 | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006090 | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP124 | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
| 3300006315 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0770m | Environmental | Open in IMG/M |
| 3300006318 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0200m | Environmental | Open in IMG/M |
| 3300006332 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200m | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006862 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series LW 2014_7_11 | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006926 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
| 3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
| 3300009620 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017702 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_10 viral metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017715 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_06 viral metaG | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300019937 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW29Aug16_MG | Environmental | Open in IMG/M |
| 3300020174 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020364 | Marine microbial communities from Tara Oceans - TARA_B100000097 (ERX556021-ERR599037) | Environmental | Open in IMG/M |
| 3300020371 | Marine microbial communities from Tara Oceans - TARA_B100000003 (ERX555978-ERR598991) | Environmental | Open in IMG/M |
| 3300020394 | Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020462 | Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986) | Environmental | Open in IMG/M |
| 3300020478 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111) | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022225 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_400_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022227 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_150_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300023237 | Saline water microbial communities from Ace Lake, Antarctica - #367 | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025069 | Marine viral communities from the Pacific Ocean - LP-38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025097 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025122 | Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025267 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar (SPAdes) | Environmental | Open in IMG/M |
| 3300025280 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025830 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300026258 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300027844 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031143 | Marine microbial communities from water near the shore, Antarctic Ocean - #422 | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031630 | Marine microbial communities from water near the shore, Antarctic Ocean - #38 | Environmental | Open in IMG/M |
| 3300031647 | Marine microbial communities from water near the shore, Antarctic Ocean - #179 | Environmental | Open in IMG/M |
| 3300031658 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_100392181 | 3300000116 | Marine | SDGNVLTNDDSQIFNMLLASNPQLQKVSKQRAERILKARFPEYFEG* |
| DelMOSpr2010_101296813 | 3300000116 | Marine | LSNDDSQIYAMLLASNPQLQKVSRQRAEKILRNRFPEYFEG* |
| DelMOSpr2010_101776311 | 3300000116 | Marine | DDSQIFNMLLASNPQLQKVSKQRAERILKSRFPEYFEG* |
| DelMOSpr2010_101804791 | 3300000116 | Marine | QIFNMLLASNPQLQKVSKQRAERILKSRFPEYFEG* |
| DelMOSpr2010_101869161 | 3300000116 | Marine | IFSMLLASNPQLQKVSRQRAERVLRNRFPEYFEG* |
| SI47jul10_120mDRAFT_10450592 | 3300000212 | Marine | TNDDSQIYAMLLASNPQLQKVSKARAEKIMRNRFPEYFEG* |
| KVRMV2_1013349191 | 3300002231 | Marine Sediment | NVLSNDDSQIYAMLLAANPQLQKVSKIRAEKILRNRFPEYFE* |
| KVWGV2_100003281 | 3300002242 | Marine Sediment | QVFSMLLASNPQLQKVSKERAMKILKAKFPEYFD* |
| KVWGV2_102004763 | 3300002242 | Marine Sediment | SQVFSMLLASNPQLQKVSKERAMKILKAKFPEYFE* |
| Ga0066851_100367693 | 3300005427 | Marine | SDGNVLANDDSQIFAMLLASNPQLQNVSKQRAERILRSRFPEYFEG* |
| Ga0066845_101465901 | 3300005432 | Marine | SNDDSQIYAMLLASNPQLQKVSRARAEKILRARFPEYFE* |
| Ga0066868_101003512 | 3300005508 | Marine | NVLSNDDSQIFAMLLASNPQLQNVSKQRAERILRSRFPEYFEG* |
| Ga0074648_10011611 | 3300005512 | Saline Water And Sediment | DSQIYAMLLAANPQLQKVSRQRAEKILKARFPEYFEG* |
| Ga0066864_102191132 | 3300005520 | Marine | DDSRIFAMLLAANPQLQQVSRTRSEKILRNRFPEYFE* |
| Ga0066865_100867851 | 3300005523 | Marine | AKVLSNDDSKIFAMLLAANPQLQKVSKTRAEKILRNRFPEYFEV* |
| Ga0075474_101249331 | 3300006025 | Aqueous | IYAMLLAANPQLQKVSRQRAEKILKARFPEYFEG* |
| Ga0075462_100692681 | 3300006027 | Aqueous | NVLSNDDSQIYAMLLASNPQLQKVSRQRAEKIMRNRFPEYFEG* |
| Ga0075462_100821573 | 3300006027 | Aqueous | DDSQIYAMLLASNPQLQKVSRQRAEKILRNRFPEYFEG* |
| Ga0082015_10083671 | 3300006090 | Marine | LSNDDSRIFAMLLSANPQLQQVSRTRAEKILRNRFPEYFD* |
| Ga0075441_101203613 | 3300006164 | Marine | QIYAMLLASNPQLQKVSKTRAEKIMRNRFPEYFEG* |
| Ga0068471_14629421 | 3300006310 | Marine | KILSNDDSRIFSMLLAANPQLQNVSRTRSEKILRNRFPEYFE* |
| Ga0068487_10583113 | 3300006315 | Marine | NVIANDDLQIYNMLLAENPQLQKVSKARAMKILRSRFPEYFE* |
| Ga0068475_13685432 | 3300006318 | Marine | DSQIFAMLLAANPQLQKVSKARAMKILRSRFPEYFE* |
| Ga0068500_12862822 | 3300006332 | Marine | ANDDLQIYNMLLAENPQLQKVSKARAMKILRSRFPEYFE* |
| Ga0098038_11058631 | 3300006735 | Marine | QIYAMLLASNPQLQKVSRQRAEKILRNRFPEYFEG* |
| Ga0098033_10934991 | 3300006736 | Marine | NDDSRIFAMLLTANPQLQQVSRTRAEKILRNRFPEYFE* |
| Ga0098058_10051561 | 3300006750 | Marine | FLPKESGKVLSNDDSRIFAMLLTANPQLQQVSRTRAEKILRNRFPEYFD* |
| Ga0098058_10453951 | 3300006750 | Marine | RIFAMLLTANPQLQQVSRTRAEKILRNRFPEYFE* |
| Ga0098040_11406671 | 3300006751 | Marine | KILSNDDSRIFAMLLAANPQLQQVSRTRSEKILRNRFPEYFE* |
| Ga0098048_11943842 | 3300006752 | Marine | DGNVLSNDDSQIYAMLLASNPQLQKVSRTRAEKILRSRFPEYFE* |
| Ga0098039_12050842 | 3300006753 | Marine | DDSQIYAMLLASNPQLQKVSRARAERILRSRFPEYFE* |
| Ga0098039_12468011 | 3300006753 | Marine | QVMSMLLASNPQLQNISRARAEGILRSRFPDYFA* |
| Ga0098044_11590331 | 3300006754 | Marine | DSRIFAMLLTANPQLQQVSRTRAEKILRNRFPEYFE* |
| Ga0098044_13688311 | 3300006754 | Marine | PRSDGNVLSNDDSQIYAMLLASNPQLQQVSRARAEKILRSRFPEYFE* |
| Ga0098054_11011833 | 3300006789 | Marine | SSGNVLSTDDSQIFAMLLAANPQLQKVSKARAEKIMRSRFPEYFE* |
| Ga0098055_10999971 | 3300006793 | Marine | DSQIFNMLLASNPQLQKVSRQRAEKIMRNRFPEYFEG* |
| Ga0098055_11423841 | 3300006793 | Marine | NDDSQIFNMLLASNPQLQKVSRQRAEKIMRNRFPEYFEG* |
| Ga0070749_102898323 | 3300006802 | Aqueous | NDDSQIYAMLLASNPQLQKVSRQRAEKILRNRFPEYFEG* |
| Ga0070749_104499131 | 3300006802 | Aqueous | KSDGNVLTNDDSQIYAMLLAANPQLQKVSRQRAEKILKARFPEYFEG* |
| Ga0070754_102820162 | 3300006810 | Aqueous | SNDDSQIFNMLLASNPQLQKVSKQRAERILKSRFPEYFEG* |
| Ga0070754_103066661 | 3300006810 | Aqueous | TNDDSQIYAMLLASNPQLQKISKARAEKIMRNRFPEYFEG* |
| Ga0079299_10557892 | 3300006862 | Deep Subsurface | SKIINLLLEANPHLKSVSPARAEKILRNRFPDYFE* |
| Ga0075477_101678212 | 3300006869 | Aqueous | SQIYAMLLAANPQLQKVSRQRAEKILKARFPEYFEG* |
| Ga0075475_103338342 | 3300006874 | Aqueous | SNDDSQIFNMLLASNPQLQKVSKQRAEKILRARFPEYFE* |
| Ga0070750_104234451 | 3300006916 | Aqueous | IYAMLLASNPQLQKVSRQRAEKILRNRFPEYFEG* |
| Ga0070746_101900941 | 3300006919 | Aqueous | NVLTNDDSQIYAMLLAANPQLQKVSRQRAEKILKARFPEYFEG* |
| Ga0070746_103786131 | 3300006919 | Aqueous | PTSDGNVLSNDDSQIFNMLLASNPQLQKVSRQRAERVLRNRFPEYFEG* |
| Ga0098060_10607721 | 3300006921 | Marine | TSDGNVLSNDDSQIFNMLLASNPQLQKVSRQRAEKIMRNRFPEYFEG* |
| Ga0098051_11943732 | 3300006924 | Marine | SQIIAMLLASNPQLQKVSRARAIKILKARFPEYFE* |
| Ga0098057_10445213 | 3300006926 | Marine | SSGNVLSNDDSQIYAMLLASNPQLQQVSRPRAEKILRSRFPEYFE* |
| Ga0098057_10935802 | 3300006926 | Marine | SSGNVLSNDDSQIYAMLLAANPQLQKVSKTRAERILRSRFPEYFE* |
| Ga0098034_10906392 | 3300006927 | Marine | DGNVLSNDDSQIYAMLLASNPQLQQVSRARAEKILRSRFPEYFE* |
| Ga0098036_11798241 | 3300006929 | Marine | SQIFNMLLASNPQLQKVSKQRAEKILRARFPEYFE* |
| Ga0075463_100368551 | 3300007236 | Aqueous | SNDDSQIFNMLLASNPQLQKVSRQRAEKVLRNRFPEYFEG* |
| Ga0099849_12682191 | 3300007539 | Aqueous | SDGNVLSNDDSQIFNMLLASNPQLQKVSKQRAEKILRARFPEYFE* |
| Ga0099849_13282612 | 3300007539 | Aqueous | NDDSQIFNMLLASNPQLQKVSRQRAEKVLRNRFPEYFEG* |
| Ga0099847_10674981 | 3300007540 | Aqueous | SQIYAMLLASNPQLQKVSRQRAEKILRNRFPEYFEG* |
| Ga0099848_10930261 | 3300007541 | Aqueous | TNDDSQIYAMLLAANPQLQKVSRQRAEKILKARFPEYFEG* |
| Ga0075480_102294263 | 3300008012 | Aqueous | DSQIYAMLLASNPQLQKVSKARAEKIMRNRFPEYFEG* |
| Ga0098052_10785393 | 3300008050 | Marine | LSTDDSQIFAMLLAANPQLQKVSKARAEKIMRSRFPEYFE* |
| Ga0098052_12545841 | 3300008050 | Marine | NVLSTDDSQIFAMLLAANPQLQKVSKARAEKIMRARFPEYFE* |
| Ga0098052_12620981 | 3300008050 | Marine | SQIFAMLLAANPQLQKVSKARAMKILRSRFPEYFE* |
| Ga0114904_10282293 | 3300008218 | Deep Ocean | YFLPKESGKILSNDDSRIFAMLLAANPQLQQVSRTRSEKILRNRFPEYFD* |
| Ga0114996_102546951 | 3300009173 | Marine | RSDGNVLSNDDSQIYAMLLASNPQLQKVSRQRAEKVLRNRFPEYFEG* |
| Ga0114996_103786331 | 3300009173 | Marine | NDDSRIFAMLLAANPQLQQVSKTRAERIIRSRFPEYFD* |
| Ga0114994_103519581 | 3300009420 | Marine | TNDDSQIYAMLLASNPQLQKVSRVRAQKIMRNRFPEYFEG* |
| Ga0114994_104627293 | 3300009420 | Marine | GNVLSNDDSQIFNMLLASNPQLQKVSKQRAERILKSRFPEYFEG* |
| Ga0114994_104807481 | 3300009420 | Marine | IYAMLLASNPQLQKVSRVRAQKIMRNRFPEYFEG* |
| Ga0114997_102076791 | 3300009425 | Marine | NDDSQIYAMLLASNPQLQKVSRVRAQKIMRNRFPEYFEG* |
| Ga0115545_11553363 | 3300009433 | Pelagic Marine | TSDGNVLSNDDSQIFNMLLASNPQLQKVSKQRAERILKARFPEYFEG* |
| Ga0115546_11884792 | 3300009435 | Pelagic Marine | VLSNDDSQIYAMLLASNPQLQKVSRQRAEKILRNRFPEYFEG* |
| Ga0115559_11929672 | 3300009438 | Pelagic Marine | SQIYAMLLASNPQLQKVSKARAEKIMRNRFPEYFEG* |
| Ga0115561_10255603 | 3300009440 | Pelagic Marine | SQIFNMLLASNPQLQKVSKQRAERILKARFPEYFEG* |
| Ga0115007_101790871 | 3300009441 | Marine | NDDSQIYAMLLASNPQLQKVSRQRAEKVLRNRFPEYFEG* |
| Ga0114932_100289101 | 3300009481 | Deep Subsurface | VIANDDSQVFSMLLASNPQLQKVSKERAMKILKAKFPEYFE* |
| Ga0114932_103168852 | 3300009481 | Deep Subsurface | SNDDSQIFNMLLASNPQLQKVSRQRAEKIMRNRFPEYFEG* |
| Ga0114932_103297291 | 3300009481 | Deep Subsurface | VIANDDSQVFSMLLASNPQLQKVSKERAMKILKAKFPEYFD* |
| Ga0114932_104606521 | 3300009481 | Deep Subsurface | NDDSRIFAMLLAANPQLQQVSKTRAEKIMRSRFPEYFD* |
| Ga0114932_106272112 | 3300009481 | Deep Subsurface | PKESGKVISNDDSRIFAMLLAANPQLQQVSKTRAEKIMRSRFPEYFD* |
| Ga0115571_11243593 | 3300009495 | Pelagic Marine | SNDDSQIFNMLLASNPQLQKVSKQRAERILKARFPEYFEG* |
| Ga0115572_102269421 | 3300009507 | Pelagic Marine | IFNMLLASNPQLQKVSKQRAERILKARFPEYFEG* |
| Ga0115011_100883933 | 3300009593 | Marine | DGNVLSNDDSQIYAMLLASNPQLQKVSRARAEKILRSRFPEYFE* |
| Ga0114900_10389023 | 3300009602 | Deep Ocean | DSQVMGMLLASNPQLQNVSKARAESILRSRFPDYFA* |
| Ga0114912_11148561 | 3300009620 | Deep Ocean | ILSNDDSRIFSMLLAANPQLQNVSRTRAEKILRNRFPEYFE* |
| Ga0114933_106670352 | 3300009703 | Deep Subsurface | DDSQIFAMLLAANPQLQKVSKARAEKIMRSRFPEYFE* |
| Ga0114933_107490922 | 3300009703 | Deep Subsurface | DDSQIFAMLLASNPQLQNVSKQRAEKILRSRFPEYFE* |
| Ga0115001_102592641 | 3300009785 | Marine | DDSQIYAMLLASNPQLQKVSRVRAQKIMRNRFPEYFEG* |
| Ga0114999_112150811 | 3300009786 | Marine | GNVLSNDDSQIYAMLLASNPQLQKVSRQRAEKVLRNRFPEYFEG* |
| Ga0115012_101177473 | 3300009790 | Marine | VLSNDDSQIYAMLLASNPQLQKVSRTRAEKILRSRFPEYFE* |
| Ga0115012_113409252 | 3300009790 | Marine | LSNDDSKIYAMLLAANPQLQKVSRARSEKILRNRFPEYFE* |
| Ga0098056_10782993 | 3300010150 | Marine | TNDDSQIFSMLLASNPQLQNVSRQRAERILRSRFPEYFE* |
| Ga0098061_11724862 | 3300010151 | Marine | NDDSQIFSMLLASNPQLQNVSRQRAERILRSRFPEYFE* |
| Ga0098059_10765343 | 3300010153 | Marine | HSDGNVLTNDDSQIFSMLLASNPQLQNVSRQRAEKILKSRFPEYFE* |
| Ga0098059_12328711 | 3300010153 | Marine | DSQIFAMLLAANPQLQKVSKARAEKIMRSRFPEYFE* |
| Ga0098047_101020211 | 3300010155 | Marine | RIFAMLLAANPQLQQVSRTRSEKILRNRFPEYFE* |
| Ga0098047_103329682 | 3300010155 | Marine | SNDDSQIYAMLLASNPQLQKVSRARAERILRSRFPEYFE* |
| Ga0129345_13135912 | 3300010297 | Freshwater To Marine Saline Gradient | DDSQIYAMLLAANPQLQKVSRQRAEKILKARFPEYFEG* |
| Ga0129351_13466241 | 3300010300 | Freshwater To Marine Saline Gradient | QIYAMLLAANPQLQKVSRQRAEKILKARFPEYFEG* |
| Ga0129324_102625861 | 3300010368 | Freshwater To Marine Saline Gradient | SDGNVLSNDDSQIYAMLLASNPQLQKVSRQRAEKILRNRFPEYFEG* |
| Ga0133547_119129063 | 3300010883 | Marine | SNDDSRIFAMLLAANPQLQQVSKTRAERIIRSRFPEYFD* |
| Ga0114934_100506301 | 3300011013 | Deep Subsurface | NDDSQIYAMLLASNPQLQKVSRARAEKILRSRFPEYFE* |
| Ga0114934_103134072 | 3300011013 | Deep Subsurface | SQIFAMLLAANPQLQKVSKARAEKIMRSRFPEYFE* |
| Ga0114934_103523192 | 3300011013 | Deep Subsurface | SNDDSRIFAMLLAANPQLQQVSKTRAEKIMRSRFPEYFD* |
| Ga0180120_101550483 | 3300017697 | Freshwater To Marine Saline Gradient | DSQIYAMLLASNPQLQKVSKARAEKIMRNRFPEYFEG |
| Ga0181374_10168403 | 3300017702 | Marine | LSNDDSRIFAMLLTANPQLQQVSRTRAEKILRNRFPEYFE |
| Ga0181391_10437903 | 3300017713 | Seawater | TSDGNVLSNDDSQIFNMLLASNPQLQKVSRQRAEKIMRNRFPEYFEG |
| Ga0181370_10248681 | 3300017715 | Marine | SRSFAMLLAANPEVQNVSRTRSEKILRNRFPEYFE |
| Ga0181381_10535643 | 3300017726 | Seawater | TSDGNVLSNDDSQIFNMLLASNPQLQKVSRQRAEKVLRNRFPEYFEG |
| Ga0181401_10522923 | 3300017727 | Seawater | NVLSNDDSQIFNMLLASNPQLQKVSRQRAEKIMRNRFPEYFEG |
| Ga0181419_10618621 | 3300017728 | Seawater | DSQIYAMLLASNPQLQKVSRQRAEKILRNRFPEYFEG |
| Ga0181415_10656782 | 3300017732 | Seawater | NVLSNDDSQIYAMLLASNPQLQKVSRQRAEKILRNRFPEYFEG |
| Ga0181415_11158472 | 3300017732 | Seawater | SQIYAMLLASNPQLQKVSRQRAEKILRNRFPEYFEG |
| Ga0181426_11282232 | 3300017733 | Seawater | GNVLSNDDSQIYAMLLASNPQLQKVSRQRAEKILRNRFPEYFEG |
| Ga0181428_10370371 | 3300017738 | Seawater | VLSNDDSQLFSMLLASNPQLQKVSRQRAEKIMRNRFPEYFEG |
| Ga0181399_11604831 | 3300017742 | Seawater | SDGNVLSNDDSQIFNMLLASNPQLQKVSRQRAEKIMRNRFPEYFEG |
| Ga0181389_10735781 | 3300017746 | Seawater | SDGNVLSNDDSQIYAMLLASNPQLQKVSRQRAEKILRNRFPEYFEG |
| Ga0181408_11748912 | 3300017760 | Seawater | PTSDGNVLSNDDSQIFSMLLASNPQLQKVSRQRAERVLRNRFPEYFEG |
| Ga0181413_10672843 | 3300017765 | Seawater | SQIFNMLLASNPQLQKVSRQRAEKIMRNRFPEYFEG |
| Ga0181413_11771761 | 3300017765 | Seawater | SNGNVLSNDDSQIFSMLLASNPQLQKVSRQRAEKIMRNKFPEYFEG |
| Ga0187220_11199621 | 3300017768 | Seawater | SNDDSQIFNMLLASNPQLQKVSRQRAEKIMRNRFPEYFEG |
| Ga0187221_10994613 | 3300017769 | Seawater | EESAKVLSNDDSRIFAMLLAANPQLQQVSKTRAEKIIRSRFPEYFD |
| Ga0181380_11037881 | 3300017782 | Seawater | SNDDSQIFNMLLASNPQLQKVSRQRAEKVLRNRFPEYFEG |
| Ga0181379_10168581 | 3300017783 | Seawater | TSDGNVLSNDDSQIFSMLLASNPQLQKVSRQRAEKVLRNRFPEYFEG |
| Ga0181379_10709681 | 3300017783 | Seawater | PTSDGNVLSNDDSQIYAMLLASNPQLQKVSRQRAEKILRNRFPEYFEG |
| Ga0194022_10189902 | 3300019937 | Freshwater | DGNVLTNDDSQIYAMLLAANPQLQKVSRQRAEKILKARFPEYFEG |
| Ga0181603_102957792 | 3300020174 | Salt Marsh | DGNVLSNDDSQIFNMLLASNPQLQKVSRQRAEKVLRSRFPEYFEG |
| Ga0211538_10564443 | 3300020364 | Marine | SGKILSNDDSRIFAMLLAANPQLQQVSRTRSEKILRNRFPEYFE |
| Ga0211500_11370641 | 3300020371 | Marine | PKETGEVVANDDTQVFSMLLAANPQLQKVSKERAMKILKAKFPEYFD |
| Ga0211497_101752232 | 3300020394 | Marine | DGNVLTNDDSQIYAMLLAANPQLQKVSRQRAEKILRNRFPEYFEG |
| Ga0211532_102744692 | 3300020403 | Marine | DGNVLANDDSQIFAMLLAANPNLQKVSRQRAEKILRNRFPEYFE |
| Ga0211699_103099242 | 3300020410 | Marine | DSQIFAMLLAANPQLQKVSKARAEKIMRSRFPEYFE |
| Ga0211528_102637601 | 3300020417 | Marine | ANDDTQVFSMLLAANPQLQKISKDRAMKILKAKFPEYFD |
| Ga0211576_105002691 | 3300020438 | Marine | NDDSQIFNMLLASNPQLQKVSRQRAEKVLRNRFPEYFEG |
| Ga0211546_100108531 | 3300020462 | Marine | SKDDTQVFSMLLASNPQLQKVSKERAMKILKAKFPEYFD |
| Ga0211503_103010951 | 3300020478 | Marine | DDSQIFAMLLAANPQLQKVSKARAEKIMRARFPEYFE |
| Ga0196883_10076903 | 3300022050 | Aqueous | SQIYAMLLAANPQLQKVSRQRAEKILKARFPEYFEG |
| Ga0212024_10070273 | 3300022065 | Aqueous | DDSQIFNMLLASNPQLQKVSRQRAERVLRSRFPEYFEG |
| Ga0212024_10194833 | 3300022065 | Aqueous | EDSQIYAMLLASNPQLQKVSRQRAEKILRNRFPEYFEG |
| Ga0196899_100135223 | 3300022187 | Aqueous | DDSQIYAMLLAANPQLQKVSRQRAEKILKARFPEYFEG |
| Ga0196899_10838871 | 3300022187 | Aqueous | DSQIYAMLLAANPQLQKVSRQRAEKILKARFPEYFEG |
| Ga0196905_10418121 | 3300022198 | Aqueous | NDDSQIYAMLLAANPQLQKVSRQRAEKILKARFPEYFEG |
| Ga0196905_10840102 | 3300022198 | Aqueous | VLTNDDSQIYAMLLAANPQLQKVSRQRAEKILKARFPEYFEG |
| Ga0187833_102126293 | 3300022225 | Seawater | DSRIFAMLLAANPQLQQVSRTRSEKILRNRFPEYFE |
| Ga0187827_105765001 | 3300022227 | Seawater | PKESGKILSNDDSRIFAMLLAANPQLQNVSRTRSEKILRNRFPEYFD |
| Ga0222650_10271503 | 3300023237 | Saline Water | TNDDSQIYAMLLSANPQLQKVSKERAQKIMRSRFPEYFEG |
| Ga0210003_12198722 | 3300024262 | Deep Subsurface | SDGDVLTNDDSQIYAMLLASNPQLQKVSKARAEKIMRNRFPEYFEGE |
| Ga0207887_10204082 | 3300025069 | Marine | DSQVMGMLLASNPQLQNVSKARAESILRSRFPDYFA |
| Ga0208792_10114883 | 3300025085 | Marine | PTSDGNVLSNDDSQIFNMLLASNPQLQKVSRQRAEKIMRNRFPEYFEG |
| Ga0208157_10361961 | 3300025086 | Marine | NVLSNDDSQIFNMLLASNPQLQKVSKQRAEKILRARFPEYFE |
| Ga0208010_10039843 | 3300025097 | Marine | LPKESGKILSNDDSRIFAMLLAANPQLQNVSRTRSEKILRNRFPEYFE |
| Ga0208010_10624611 | 3300025097 | Marine | YFLPKQSGKILSNDDSRIFAMLLTANPQLQQVSRTRAEKILRNRFPEYFE |
| Ga0208010_10736082 | 3300025097 | Marine | SQVMGMLLASNPQLQNVSRPRAESILRSRFPDYFA |
| Ga0208669_10389103 | 3300025099 | Marine | DDSQIFNMLLASNPQLQKVSRQRAEKIMRNRFPEYFEG |
| Ga0208669_10506541 | 3300025099 | Marine | DGNVLSNDDSQIYAMLLASNPQLQKVSRTRAEKILRSRFPEYFE |
| Ga0208666_10910541 | 3300025102 | Marine | QIYAMLLASNPQLQKVSRQRAEKILRNRFPEYFEG |
| Ga0208013_10275391 | 3300025103 | Marine | LSTDDSQIFAMLLAANPQLQKVSKARAEKIMRSRFPEYFE |
| Ga0208793_10702541 | 3300025108 | Marine | DDSKIYAMLLAANPQLQKVSRARSEKILRNRFPEYFE |
| Ga0208790_11223283 | 3300025118 | Marine | NDDSRIFAMLLTANPQLQQVSRTRAEKILRNRFPEYFD |
| Ga0208790_11478561 | 3300025118 | Marine | DDSRIFAMLLSANPQLQQVSRTRAEKILRNRFPEYFE |
| Ga0208790_12149142 | 3300025118 | Marine | HSSGNVLSTDDSQIFAMLLAANPQLQKVSKARAEKIMRSRFPEYFE |
| Ga0209434_11062082 | 3300025122 | Marine | FLPKESGKILSNDDSRIFSMLLAANPQLQNVSRTRSEKILRNRFPEYFE |
| Ga0209434_11806682 | 3300025122 | Marine | DSRIFAMLLTANPQLQQVSRTRAEKILRNRFPEYFD |
| Ga0208299_11502892 | 3300025133 | Marine | VIPRESAKVLSNDDSKIYAMLLAANPQLQKVSRARSEKILRNRFPEYFE |
| Ga0209337_11291443 | 3300025168 | Marine | LSNDDSQIFNMLLASNPQLQKVSRQRAEKIMRNRFPEYFEG |
| Ga0208179_10443073 | 3300025267 | Deep Ocean | NDDSRIFAMLLAANPQLQNVSRTRSEKILRNRFPEYFD |
| Ga0208449_11119541 | 3300025280 | Deep Ocean | EYFLPKESGKILSNDDSRIFAMLLAANPQLQNVSRTRSEKILRNRFPEYFD |
| Ga0208148_10168121 | 3300025508 | Aqueous | NDDSQIYAMLLASNPQLQKVSRQRAEKILRNRFPEYFEG |
| Ga0209504_10607891 | 3300025621 | Pelagic Marine | SDGNVLTNDDSQIFNMLLASNPQLQKVSKQRAERILKARFPEYFEG |
| Ga0208134_10611653 | 3300025652 | Aqueous | SNDDSQIYAMLLASNPQLQKVSRQRAEKILRNRFPEYFEG |
| Ga0208898_10012251 | 3300025671 | Aqueous | SNDDSQIFNMLLASNPQLQKVSKQRAEKILRARFPEYFE |
| Ga0208162_10672763 | 3300025674 | Aqueous | QIYAMLLAANPQLQKVSRQRAEKILKARFPEYFEG |
| Ga0208162_11559572 | 3300025674 | Aqueous | DGNVLSNDDSQIFNMLLASNPQLQKVSKQRAEKILRARFPEYFE |
| Ga0209095_12259341 | 3300025685 | Pelagic Marine | GNVLTNDDSQIFNMLLASNPQLQKVSKQRAERILKARFPEYFEG |
| Ga0208899_10952503 | 3300025759 | Aqueous | LSNDDSQIYAMLLASNPQLQKVSRQRAEKILRNRFPEYFEG |
| Ga0209832_11353511 | 3300025830 | Pelagic Marine | VLSNDDSQIFSMLLASNPQLQKVSRQRAERVLRNRFPEYFEG |
| Ga0209631_101782651 | 3300025890 | Pelagic Marine | DGNVLSNDDSQIFNMLLASNPQLQKVSRQRAEKIMRNRFPEYFEG |
| Ga0208130_10041441 | 3300026258 | Marine | VLSNDDSQIYAMLLASNPQLQKVSRARAEKILRARFPEYFE |
| Ga0209830_101351661 | 3300027791 | Marine | DDSQIYAMLLASNPQLQKVSRVRAQKIMRNRFPEYFEG |
| Ga0209091_102360571 | 3300027801 | Marine | DSQIYAMLLASNPQLQKVSRVRAQKIMRNRFPEYFEG |
| Ga0209501_102543733 | 3300027844 | Marine | NDDSRIFAMLLAANPQLQQVSKTRAERIIRSRFPEYFD |
| Ga0257106_10803923 | 3300028194 | Marine | VLTNDDSQIFSMLLASNPQLQKVSRQRAERVLRNRFPEYFEG |
| (restricted) Ga0247839_13548212 | 3300028553 | Freshwater | SKIINLLLEANPNLKGVSPARAEKILRNRFPDYFE |
| Ga0183755_10244401 | 3300029448 | Marine | NDDSQIFAMLLASNPQLQKVSKQRAERILRARFPEYFE |
| Ga0308025_11476341 | 3300031143 | Marine | GDVLTNDDSQIYAMLLASNPQLQKVSRVRAQKIMRNRFPEYFEG |
| Ga0308010_10260471 | 3300031510 | Marine | VLTNDDSQIYSMLLASNPQLQKVSKQRAEKILRNRFPEYFEG |
| Ga0307489_103873803 | 3300031569 | Sackhole Brine | NDDSQIFNMLLASNPQLQKVSKQRAERILKSRFPEYFEG |
| Ga0308004_100709521 | 3300031630 | Marine | NVLSNDDSQIYSMLLASNPQLQKVSKQRAEKILRNRFPEYFEG |
| Ga0308012_100373163 | 3300031647 | Marine | DDSQIYSMLLASNPQLQKVSKQRAEKILRNRFPEYFEG |
| Ga0307984_10694481 | 3300031658 | Marine | DSQIYAMLLASNPQLQKVSKARAQKIMRNRFPEYFEG |
| Ga0310344_109303383 | 3300032006 | Seawater | SGKVLSNDDSQIFAMLLAANPQLQKVSKARAEKIMRSRFPEYFE |
| Ga0310345_104713793 | 3300032278 | Seawater | SGKILSNDDSRIFSMLLAANPQLQNVSRTRSEKILRNRFPEYFE |
| Ga0310345_117047472 | 3300032278 | Seawater | SQVMGMLLASNPQLQNVSKARAESILRSRFPDYFA |
| Ga0310342_1022816862 | 3300032820 | Seawater | PKESGKVLSNDDSRIFAMLLAANPQLQNVSRTRSEKILRNRFPEYFD |
| Ga0310342_1026500921 | 3300032820 | Seawater | SNDDSRIFSMLLAANPQLQNVSRTRSEKILRNRFPEYFE |
| Ga0310342_1026842471 | 3300032820 | Seawater | NDDSRIFSMLLAANPQLQNVSRTRSEKILRNRFPEYFE |
| Ga0314858_044848_2_112 | 3300033742 | Sea-Ice Brine | SQIFNMLLASNPQLQKVSKQRAERILKSRFPEYFEG |
| ⦗Top⦘ |