| Basic Information | |
|---|---|
| Family ID | F026964 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 196 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VQAATKGQQIKLPSETVLNFTLQAPITVVQASSPDANRQKLTDSQ |
| Number of Associated Samples | 164 |
| Number of Associated Scaffolds | 196 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.43 % |
| % of genes from short scaffolds (< 2000 bps) | 84.18 % |
| Associated GOLD sequencing projects | 157 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.408 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.735 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.408 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.571 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 196 Family Scaffolds |
|---|---|---|
| PF06750 | DiS_P_DiS | 9.18 |
| PF00034 | Cytochrom_C | 7.65 |
| PF06537 | DHOR | 4.59 |
| PF13442 | Cytochrome_CBB3 | 4.59 |
| PF01435 | Peptidase_M48 | 2.55 |
| PF09989 | DUF2229 | 2.04 |
| PF00535 | Glycos_transf_2 | 2.04 |
| PF00873 | ACR_tran | 1.53 |
| PF13432 | TPR_16 | 1.53 |
| PF00180 | Iso_dh | 1.02 |
| PF08448 | PAS_4 | 1.02 |
| PF13620 | CarboxypepD_reg | 1.02 |
| PF11146 | DUF2905 | 1.02 |
| PF10041 | DUF2277 | 0.51 |
| PF00814 | TsaD | 0.51 |
| PF04397 | LytTR | 0.51 |
| PF00326 | Peptidase_S9 | 0.51 |
| PF12715 | Abhydrolase_7 | 0.51 |
| PF07508 | Recombinase | 0.51 |
| PF12681 | Glyoxalase_2 | 0.51 |
| PF00990 | GGDEF | 0.51 |
| PF01174 | SNO | 0.51 |
| PF07700 | HNOB | 0.51 |
| PF02233 | PNTB | 0.51 |
| PF02566 | OsmC | 0.51 |
| PF00903 | Glyoxalase | 0.51 |
| PF13493 | DUF4118 | 0.51 |
| PF00571 | CBS | 0.51 |
| PF04055 | Radical_SAM | 0.51 |
| PF13426 | PAS_9 | 0.51 |
| PF00958 | GMP_synt_C | 0.51 |
| PF00989 | PAS | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 196 Family Scaffolds |
|---|---|---|---|
| COG1989 | Prepilin signal peptidase PulO (type II secretory pathway) or related peptidase | Cell motility [N] | 27.55 |
| COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 4.59 |
| COG0118 | Imidazoleglycerol phosphate synthase glutamine amidotransferase subunit HisH | Amino acid transport and metabolism [E] | 0.51 |
| COG0311 | Pyridoxal 5'-phosphate synthase subunit PdxT (glutamine amidotransferase) | Coenzyme transport and metabolism [H] | 0.51 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.51 |
| COG0533 | tRNA A37 threonylcarbamoyltransferase TsaD | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| COG1214 | tRNA A37 threonylcarbamoyladenosine modification protein TsaB | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| COG1282 | NAD/NADP transhydrogenase beta subunit | Energy production and conversion [C] | 0.51 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.51 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.51 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.41 % |
| Unclassified | root | N/A | 4.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918007|ConsensusfromContig142863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1826 | Open in IMG/M |
| 2162886012|MBSR1b_contig_1485553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1013 | Open in IMG/M |
| 3300000789|JGI1027J11758_12320089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 777 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100186935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1960 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101731847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300004080|Ga0062385_10349477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 866 | Open in IMG/M |
| 3300004092|Ga0062389_101433086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 875 | Open in IMG/M |
| 3300005167|Ga0066672_10085870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1893 | Open in IMG/M |
| 3300005167|Ga0066672_10142563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1497 | Open in IMG/M |
| 3300005172|Ga0066683_10121141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1595 | Open in IMG/M |
| 3300005187|Ga0066675_10209368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1374 | Open in IMG/M |
| 3300005364|Ga0070673_102011139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 548 | Open in IMG/M |
| 3300005435|Ga0070714_101490646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 661 | Open in IMG/M |
| 3300005468|Ga0070707_100844614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 880 | Open in IMG/M |
| 3300005541|Ga0070733_10636562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300005542|Ga0070732_10220075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1135 | Open in IMG/M |
| 3300005559|Ga0066700_10802907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 634 | Open in IMG/M |
| 3300005885|Ga0075284_1015221 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300005921|Ga0070766_10129922 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
| 3300006031|Ga0066651_10301353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 856 | Open in IMG/M |
| 3300006052|Ga0075029_100147747 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
| 3300006052|Ga0075029_100562030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300006102|Ga0075015_100012195 | All Organisms → cellular organisms → Bacteria | 3655 | Open in IMG/M |
| 3300006102|Ga0075015_100418510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300006162|Ga0075030_101552234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 518 | Open in IMG/M |
| 3300006174|Ga0075014_100145011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1154 | Open in IMG/M |
| 3300006358|Ga0068871_101543059 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300006800|Ga0066660_10126288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1858 | Open in IMG/M |
| 3300006893|Ga0073928_11217814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300007788|Ga0099795_10128344 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300009038|Ga0099829_10490705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
| 3300009088|Ga0099830_10144088 | All Organisms → cellular organisms → Bacteria | 1826 | Open in IMG/M |
| 3300009143|Ga0099792_11257158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300009545|Ga0105237_11973697 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300009640|Ga0116126_1019075 | All Organisms → cellular organisms → Bacteria | 3058 | Open in IMG/M |
| 3300009792|Ga0126374_10867278 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300009839|Ga0116223_10406698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
| 3300010048|Ga0126373_11641149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300010048|Ga0126373_13264224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300010336|Ga0134071_10142603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1161 | Open in IMG/M |
| 3300010341|Ga0074045_10397687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
| 3300010343|Ga0074044_10367839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 942 | Open in IMG/M |
| 3300010359|Ga0126376_10663651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 997 | Open in IMG/M |
| 3300010360|Ga0126372_11985865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300010361|Ga0126378_10507444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1321 | Open in IMG/M |
| 3300010361|Ga0126378_11880460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300010366|Ga0126379_11581152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300010398|Ga0126383_11216145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 843 | Open in IMG/M |
| 3300010399|Ga0134127_10294965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1559 | Open in IMG/M |
| 3300011120|Ga0150983_11643537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300011120|Ga0150983_13182390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300011120|Ga0150983_15491950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium AA13 | 924 | Open in IMG/M |
| 3300011271|Ga0137393_10034146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3878 | Open in IMG/M |
| 3300011411|Ga0153933_1123170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300012189|Ga0137388_11936338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300012198|Ga0137364_10151011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1679 | Open in IMG/M |
| 3300012200|Ga0137382_10361184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
| 3300012202|Ga0137363_10473336 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300012206|Ga0137380_10118201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2422 | Open in IMG/M |
| 3300012206|Ga0137380_11322251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300012209|Ga0137379_10240199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1725 | Open in IMG/M |
| 3300012210|Ga0137378_10096342 | All Organisms → cellular organisms → Bacteria | 2711 | Open in IMG/M |
| 3300012211|Ga0137377_10581939 | Not Available | 1057 | Open in IMG/M |
| 3300012285|Ga0137370_10101186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1623 | Open in IMG/M |
| 3300012351|Ga0137386_10203520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1422 | Open in IMG/M |
| 3300012351|Ga0137386_10243520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1293 | Open in IMG/M |
| 3300012354|Ga0137366_10028675 | All Organisms → cellular organisms → Bacteria | 4324 | Open in IMG/M |
| 3300012356|Ga0137371_10193190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1594 | Open in IMG/M |
| 3300012971|Ga0126369_10038230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4008 | Open in IMG/M |
| 3300012971|Ga0126369_12745971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300012971|Ga0126369_12859566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300012987|Ga0164307_11024129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300013100|Ga0157373_10469676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
| 3300014501|Ga0182024_11182028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 896 | Open in IMG/M |
| 3300014657|Ga0181522_10184545 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300014658|Ga0181519_10362780 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300015262|Ga0182007_10109319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 919 | Open in IMG/M |
| 3300016294|Ga0182041_12172354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300016319|Ga0182033_10703466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 885 | Open in IMG/M |
| 3300016341|Ga0182035_12009589 | Not Available | 525 | Open in IMG/M |
| 3300016371|Ga0182034_10525628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 990 | Open in IMG/M |
| 3300016445|Ga0182038_11697056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300017925|Ga0187856_1132263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 957 | Open in IMG/M |
| 3300017943|Ga0187819_10449383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300017943|Ga0187819_10681082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300017944|Ga0187786_10549326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300017955|Ga0187817_10484945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300017970|Ga0187783_10398953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 999 | Open in IMG/M |
| 3300017972|Ga0187781_10234512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1297 | Open in IMG/M |
| 3300018006|Ga0187804_10088761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1258 | Open in IMG/M |
| 3300018007|Ga0187805_10473735 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300018012|Ga0187810_10283258 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300018057|Ga0187858_10113558 | All Organisms → cellular organisms → Bacteria | 1836 | Open in IMG/M |
| 3300018064|Ga0187773_10315894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 877 | Open in IMG/M |
| 3300018085|Ga0187772_10080805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2060 | Open in IMG/M |
| 3300018085|Ga0187772_10153597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1524 | Open in IMG/M |
| 3300018086|Ga0187769_10012857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5394 | Open in IMG/M |
| 3300018088|Ga0187771_10073569 | All Organisms → cellular organisms → Bacteria | 2707 | Open in IMG/M |
| 3300018088|Ga0187771_10084048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2539 | Open in IMG/M |
| 3300018090|Ga0187770_10455090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1009 | Open in IMG/M |
| 3300018090|Ga0187770_11472544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella paludicola | 554 | Open in IMG/M |
| 3300018433|Ga0066667_11351134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 624 | Open in IMG/M |
| 3300018468|Ga0066662_10097466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2070 | Open in IMG/M |
| 3300019786|Ga0182025_1018678 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
| 3300019881|Ga0193707_1104909 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300019887|Ga0193729_1236539 | Not Available | 592 | Open in IMG/M |
| 3300020579|Ga0210407_10104920 | All Organisms → cellular organisms → Bacteria | 2150 | Open in IMG/M |
| 3300020579|Ga0210407_10474073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
| 3300020581|Ga0210399_10078254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2683 | Open in IMG/M |
| 3300020581|Ga0210399_11051979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300020583|Ga0210401_10194037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1888 | Open in IMG/M |
| 3300020583|Ga0210401_10205066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1829 | Open in IMG/M |
| 3300021168|Ga0210406_10325228 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300021170|Ga0210400_10024212 | All Organisms → cellular organisms → Bacteria | 4720 | Open in IMG/M |
| 3300021170|Ga0210400_10235113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1495 | Open in IMG/M |
| 3300021181|Ga0210388_10570194 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300021401|Ga0210393_10928311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
| 3300021402|Ga0210385_10693016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 779 | Open in IMG/M |
| 3300021406|Ga0210386_10207544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1660 | Open in IMG/M |
| 3300021433|Ga0210391_10714271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 785 | Open in IMG/M |
| 3300021478|Ga0210402_10137567 | All Organisms → cellular organisms → Bacteria | 2219 | Open in IMG/M |
| 3300021478|Ga0210402_10630481 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300021478|Ga0210402_10959657 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300021479|Ga0210410_11096297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300024295|Ga0224556_1041789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1140 | Open in IMG/M |
| 3300025506|Ga0208937_1057815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 902 | Open in IMG/M |
| 3300025627|Ga0208220_1048933 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300025903|Ga0207680_11033380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 588 | Open in IMG/M |
| 3300025906|Ga0207699_10435472 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300025915|Ga0207693_10297669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1264 | Open in IMG/M |
| 3300025916|Ga0207663_10667935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
| 3300025922|Ga0207646_10667880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 930 | Open in IMG/M |
| 3300025928|Ga0207700_10037669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3504 | Open in IMG/M |
| 3300025928|Ga0207700_10333903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1316 | Open in IMG/M |
| 3300025939|Ga0207665_10720464 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300026294|Ga0209839_10223657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300026317|Ga0209154_1071412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1509 | Open in IMG/M |
| 3300026322|Ga0209687_1134606 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300026330|Ga0209473_1027730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2589 | Open in IMG/M |
| 3300026331|Ga0209267_1191726 | Not Available | 792 | Open in IMG/M |
| 3300026332|Ga0209803_1036702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2264 | Open in IMG/M |
| 3300026333|Ga0209158_1065466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1444 | Open in IMG/M |
| 3300026333|Ga0209158_1203046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300026514|Ga0257168_1029350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1169 | Open in IMG/M |
| 3300027297|Ga0208241_1083500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300027545|Ga0209008_1026756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1345 | Open in IMG/M |
| 3300027575|Ga0209525_1117269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300027591|Ga0209733_1038132 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300027648|Ga0209420_1003030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7327 | Open in IMG/M |
| 3300027680|Ga0207826_1116055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 734 | Open in IMG/M |
| 3300027748|Ga0209689_1162097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1048 | Open in IMG/M |
| 3300027821|Ga0209811_10376971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300027842|Ga0209580_10345100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300027882|Ga0209590_10830530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300027895|Ga0209624_10094295 | All Organisms → cellular organisms → Bacteria | 1949 | Open in IMG/M |
| 3300027903|Ga0209488_11019836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300027905|Ga0209415_10148584 | All Organisms → cellular organisms → Bacteria | 2363 | Open in IMG/M |
| 3300027905|Ga0209415_10778637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300027905|Ga0209415_10835827 | Not Available | 636 | Open in IMG/M |
| 3300027908|Ga0209006_10284375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1415 | Open in IMG/M |
| 3300027911|Ga0209698_10190545 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300027911|Ga0209698_10832349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300027986|Ga0209168_10472603 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300028036|Ga0265355_1002109 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300029883|Ga0311327_10083099 | All Organisms → cellular organisms → Bacteria | 2411 | Open in IMG/M |
| 3300029999|Ga0311339_11874039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 518 | Open in IMG/M |
| 3300030053|Ga0302177_10365977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300030847|Ga0075405_10964790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300031231|Ga0170824_107769254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300031573|Ga0310915_10853446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300031715|Ga0307476_10067816 | All Organisms → cellular organisms → Bacteria | 2466 | Open in IMG/M |
| 3300031720|Ga0307469_10539705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1031 | Open in IMG/M |
| 3300031740|Ga0307468_101078579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300031788|Ga0302319_10221597 | All Organisms → cellular organisms → Bacteria | 2349 | Open in IMG/M |
| 3300031823|Ga0307478_11444262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300031939|Ga0308174_10159228 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
| 3300031942|Ga0310916_11727978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300031947|Ga0310909_10908299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300032160|Ga0311301_10337728 | All Organisms → cellular organisms → Bacteria | 2370 | Open in IMG/M |
| 3300032783|Ga0335079_10158989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2530 | Open in IMG/M |
| 3300032783|Ga0335079_11171582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300032783|Ga0335079_11230590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300032829|Ga0335070_12133030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300032893|Ga0335069_10076907 | All Organisms → cellular organisms → Bacteria | 4277 | Open in IMG/M |
| 3300032897|Ga0335071_12055044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300032954|Ga0335083_11280531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300032955|Ga0335076_10345227 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300032955|Ga0335076_10742372 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300033004|Ga0335084_11982441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300033158|Ga0335077_11264986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300034163|Ga0370515_0175095 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300034282|Ga0370492_0314465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.73% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.16% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.12% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.12% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.61% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.10% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.08% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.06% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.55% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.04% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.04% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.02% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.02% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.02% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.02% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.02% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.02% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.02% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.02% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.02% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.02% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.02% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.51% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.51% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.51% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.51% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.51% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.51% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.51% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.51% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.51% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.51% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.51% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.51% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005885 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011411 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Host-Associated | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030847 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A_all_C_03000110 | 2140918007 | Soil | GGVQAAGKGQQIKLPSETVLNFTLQAPVSVLPAKNPHEGRPRLEANQNQNQ |
| MBSR1b_0990.00000250 | 2162886012 | Miscanthus Rhizosphere | GGGVQAATHGQQIKLTSETVLNFTLQGPLTVVPTTRGPNEGRPKLEANQNQNQ |
| JGI1027J11758_123200891 | 3300000789 | Soil | GGLGGGVQAATKGQQIKLPSETVLNFTLQGPVTVVATNRGPNENRPRLSDSQ* |
| JGIcombinedJ26739_1001869352 | 3300002245 | Forest Soil | VGGGVQAATKSQQIKLPSETVLNFTLQAPVTVVKAPNPSSNRPRLGDSQ* |
| JGIcombinedJ26739_1017318471 | 3300002245 | Forest Soil | AGAGVGAGAQAASKAHQIKLPSETVLNFTLQAPVTVVKPPAPNASRPKLDDAH* |
| Ga0062385_103494772 | 3300004080 | Bog Forest Soil | QAATKSQQIKLPSETVLSFTLQAPITVVQAPKPDANRQKLGNSQ* |
| Ga0062389_1014330862 | 3300004092 | Bog Forest Soil | SKSQQIKLPSETVLNFTLQAPLTVNRTQDPNAGRQKLGDPQ* |
| Ga0066672_100858701 | 3300005167 | Soil | GVQAATKSQQIKLPSETILNFTLQAPVTVIQSSGSDRQKLPNSQ* |
| Ga0066672_101425634 | 3300005167 | Soil | ATKGQQIKLPSETVLNFTLQAPVTVVATNKGPNSGRRTLDSNQGPN* |
| Ga0066683_101211411 | 3300005172 | Soil | GLGGGVQAATKGQQIKLPSETVLNFTLQAPVTVVATNKGPNSGRPTLDSNQGPN* |
| Ga0066675_102093681 | 3300005187 | Soil | VQAATKGQQIKLPSETVLNFTLQAPVTVVATNKGPNSGRRTLDSNQGPN* |
| Ga0070673_1020111391 | 3300005364 | Switchgrass Rhizosphere | GVQAATKGQQIKLPSETVLNFTLQAPVSVLPAKGPHEGRPKLEANQ* |
| Ga0070714_1014906462 | 3300005435 | Agricultural Soil | ATKSQQIKLPSETILNFTLQAPVTVIQASGSDRQKLPNSQ* |
| Ga0070707_1008446141 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | QAATHGQQIKLPTETVLNFTLQSSLTVIPTTKGPNEGRPTLSTNQ* |
| Ga0070733_106365621 | 3300005541 | Surface Soil | QIKLPSETVLNFLLQAPIEVVKAPPEANRPKLGDAQ* |
| Ga0070732_102200753 | 3300005542 | Surface Soil | KLPSETVLNFTLQAPITVVQTPNPNANRPRLGDSQ* |
| Ga0066700_108029072 | 3300005559 | Soil | VQAATKGQQIKLPSETVLNFTLQAPLTVVATAKTPDEGRPRLERPTDPNQ* |
| Ga0075284_10152212 | 3300005885 | Rice Paddy Soil | AGTGVSAATKGQQILLPSETVLNFQLQGPVSVIPTEHGPNSGRQQLN* |
| Ga0070766_101299221 | 3300005921 | Soil | VGGGVQAATKSQQIKFPSETVLNFTLQAPVTVVQAPSSDANRPKLGNSQ* |
| Ga0066651_103013532 | 3300006031 | Soil | GGGVQAATKGQQIKLPSETVLNFTLQAPVTVVATNKGPNSGRPTLDSNQGPN* |
| Ga0075029_1001477473 | 3300006052 | Watersheds | ATKGQQIKLPSETVLNFVLQAPITVVQAPPPDANRPKLGDSQ* |
| Ga0075029_1005620302 | 3300006052 | Watersheds | AGAGVGGGVQAAGKSQQIKLPSETVLNFTLQQPVTVVQAAPGDADRQKLSSQQ* |
| Ga0075015_1000121956 | 3300006102 | Watersheds | VGGGVQAATKSQQIKLPSETVLNFTLQAPITVVQAQSPDANRQKLGDSQ* |
| Ga0075015_1004185102 | 3300006102 | Watersheds | QQIKLPSETVLNFTLQAPITVVQAPSPDASRQKLGDSQ* |
| Ga0075030_1015522341 | 3300006162 | Watersheds | VQAATKGQQIKLPSETVLNFTLQAPITVVQASSPDANRQKLTDSQ* |
| Ga0075014_1001450113 | 3300006174 | Watersheds | TKGQQIKLPSETVLNFTLQAPITVVQASSPDANRQKLTDSQ* |
| Ga0068871_1015430592 | 3300006358 | Miscanthus Rhizosphere | AATKGQQIKLPSETVLNFTLQAPITVVQAAPADENRQKLVNSQ* |
| Ga0066660_101262883 | 3300006800 | Soil | GGVQAATKGQQIKLPSETVLNFTLQAPLTVVATAKTPDEGRPRLERPTDPNQ* |
| Ga0073928_112178141 | 3300006893 | Iron-Sulfur Acid Spring | LPSETVLNFTLQAPITVVQVSSPDANRPKLGDSQQ* |
| Ga0075426_102165322 | 3300006903 | Populus Rhizosphere | ATKGQQIVLPSETVLNFQLQAPVSVIPTEHGPNSGRQQLN* |
| Ga0099795_101283443 | 3300007788 | Vadose Zone Soil | AAAGGGIGGGVQAATKSQQIKLPSETVLNFTLQAPVTVIQAPNPNSNRQKLGESQ* |
| Ga0099829_104907052 | 3300009038 | Vadose Zone Soil | AGVGGGAQAASKSKPLKLPSETVLNFTLQGPVTVTKPPDPNAGRQKLDSQ* |
| Ga0099830_101440883 | 3300009088 | Vadose Zone Soil | VQAATRGQQIKLPTETVLNFTLQGPLIVIPTTKGPNEGRPTLNTNQ* |
| Ga0099792_112571581 | 3300009143 | Vadose Zone Soil | GGIGGGVQAATKGQQIKLPSETVLNFTLQAPVTVIQAPRPNEKRQKLGDSQ* |
| Ga0105237_119736972 | 3300009545 | Corn Rhizosphere | GGVQAATKGQQIKLPSETVLNFTLQSSLTVTPTTHNPHEGRQKIESQN* |
| Ga0116126_10190751 | 3300009640 | Peatland | AGVGGGAQAASKSQQIKLPSETVLNFTLQAPVTVVQAPNPDSSRPKLGDSQ* |
| Ga0126374_108672781 | 3300009792 | Tropical Forest Soil | GGGVQAATKGQQIKLPSETVLNFTLQGPVTVVATNRAPNENRPRLSDSQ* |
| Ga0116223_104066982 | 3300009839 | Peatlands Soil | GVGGGAQAASKSQQIKLPSETVLNFTLQEPVEVVQAPSPNANRSKLVDSQ* |
| Ga0126373_116411492 | 3300010048 | Tropical Forest Soil | GAGVGGGVQAATKSQQIKLPSETVLNFTLQQPITVVQAQPANANRPKLQNQP* |
| Ga0126373_132642242 | 3300010048 | Tropical Forest Soil | VGGGVQAVTKGQQIKLPSETVLNFTLQAPITVVQARSSDADRQKLSNSQ* |
| Ga0134071_101426032 | 3300010336 | Grasslands Soil | GGGVQAATKGQQIKLPSETVLNFTLQAPVTVVATNKGPNSGRRTLDSNQGPN* |
| Ga0074045_103976871 | 3300010341 | Bog Forest Soil | KSQQIKLPSETVLNFTLQAPVTVVQAPKPDADRPKLSDSQ* |
| Ga0074044_103678391 | 3300010343 | Bog Forest Soil | QIKLPSETVLNFTLQAPIEVVQAPSPDANRPKLPDAQQ* |
| Ga0126376_106636511 | 3300010359 | Tropical Forest Soil | KSQQIKLPSKTVLNFTLQAPITVVQVENTDTNRP* |
| Ga0126372_119858651 | 3300010360 | Tropical Forest Soil | GGVQSATKSQQIKLPSETVLNFTLQAPVTVVATNQGPNAGRQKLDTSQ* |
| Ga0126378_105074441 | 3300010361 | Tropical Forest Soil | GLGGGVQAATKGQQIKLPSETVLNFTLQAPLTVVAANKGPNEGRPRLDTSQ* |
| Ga0126378_118804602 | 3300010361 | Tropical Forest Soil | VQAVTKGQQIKLPSETVLNFTLQAPITVVQARSSDADRQKLSNSQ* |
| Ga0126379_115811522 | 3300010366 | Tropical Forest Soil | GAGVGGGVQAASKSQQIKLPSETVLNFTLQAPITVVQVENTDANRPKLSTSQ* |
| Ga0126383_112161451 | 3300010398 | Tropical Forest Soil | KSEQIKLPSETVLNFVLQQPVTVVQAPSTDANRQKLQGQQ* |
| Ga0134127_102949651 | 3300010399 | Terrestrial Soil | QAATHGQQIKLTSETVLNFTLQGPLTVVPTTHGPNEGRPKLEANQNQNQ* |
| Ga0150983_116435371 | 3300011120 | Forest Soil | QAASKSQQIKLPSETVLNFTLQQPVTVVQAAPSDANRQKLSGQQ* |
| Ga0150983_131823902 | 3300011120 | Forest Soil | GGAQAASKSQQIKLPSETVVNFTLQEPVEVVQVTNPNANRPKVVDSQ* |
| Ga0150983_154919502 | 3300011120 | Forest Soil | LGGGVQAATKGQQIKLASETVLNFTLQNPLTVIPAQGPDSHRHKMDSTDSSNQ* |
| Ga0137393_100341463 | 3300011271 | Vadose Zone Soil | VGGGVQAATKGQQIKLPSETVLNFTLQAPVTVVQAPNPNSNRQKIGDTN* |
| Ga0153933_11231701 | 3300011411 | Attine Ant Fungus Gardens | QQIKLPSETVLNFTLQAPITVVQASSPDANRPKLSDTPQ* |
| Ga0137388_119363381 | 3300012189 | Vadose Zone Soil | GGGVQAATRGQQIKLPTETVLNFTLQGPLIVIPTTKGPNEGRPTLNTNQ* |
| Ga0137364_101510113 | 3300012198 | Vadose Zone Soil | GGRLGIGVQAATKGQQIKLPSETVLNFTLQAPVTVVATSKGPNSGRPTLDSNQGPN* |
| Ga0137382_103611842 | 3300012200 | Vadose Zone Soil | SKSQQIKLPSETVLNFTLQQPVTVVQAAPGDANRQKLSSQQ* |
| Ga0137363_104733361 | 3300012202 | Vadose Zone Soil | VQAATKGQQIKLPSETVLNFTLQGPLTVIPTNRGPNEGRHRLDPKPDNDQQ* |
| Ga0137380_101182014 | 3300012206 | Vadose Zone Soil | GGGVQAATKGQQIKLASETVLNFTLQGPLTVTPTTQTPNSGRQKLETPE* |
| Ga0137380_113222511 | 3300012206 | Vadose Zone Soil | VGGGVQAASKSQQIKLPSETVLNFTLQAPITVVQAPPADANRQKLGDSQ* |
| Ga0137379_102401991 | 3300012209 | Vadose Zone Soil | GGLGGGVQAATKGQQIKLASETVLNFTLQGPLTVTPTTQTPNSGRQKLETPE* |
| Ga0137378_100963421 | 3300012210 | Vadose Zone Soil | GQQIKLPSETVLNFTLQAPITVVQTLPVDANRQKLGESQ* |
| Ga0137377_105819391 | 3300012211 | Vadose Zone Soil | TKGQQIKLPSETVLNFTLQAPVTVVATNKGPNSGRPTLDSNQGPN* |
| Ga0137370_101011861 | 3300012285 | Vadose Zone Soil | KGQQIKLPSETVLNFTLQAPVTVVATNKGPNSGRPTLDSNQGPN* |
| Ga0137386_102035203 | 3300012351 | Vadose Zone Soil | GGVQAATKGQQIKLPSETVLNFTLQAPVTVVATNKGPNSGRPTLDSNQGPN* |
| Ga0137386_102435202 | 3300012351 | Vadose Zone Soil | QAATKGQQIKLPSETVLNFTLQAPVTVVATNKGPNSGRPTLDSNQGPN* |
| Ga0137366_100286756 | 3300012354 | Vadose Zone Soil | GGGVQAATKSQQIKLPSETVLNFTLQAPITVVQASPSDSSRQKLGESQ* |
| Ga0137371_101931902 | 3300012356 | Vadose Zone Soil | AATKGQQIKLPSETVLNFTLQAPVTVVATNKGPNSGRPTLDSNQGPN* |
| Ga0126369_100382305 | 3300012971 | Tropical Forest Soil | AAAGGGVGGGVQAAPHGQQIKLSSETVLNFTLQAPVTVVASKNPNENRHRLDNPNNQ* |
| Ga0126369_127459711 | 3300012971 | Tropical Forest Soil | GVGGGVQAATKSEQIKLPSETVLNFVLQQPVTVVQAPSSDASRQKLQGQQ* |
| Ga0126369_128595661 | 3300012971 | Tropical Forest Soil | ATKSQQIKFPSETVLNFTLQQPITVVQATPSQANRPKLGDTQ* |
| Ga0164304_102836021 | 3300012986 | Soil | ATKGQQIVLPAETVLNFQLQAPISAFVAENPNANRQRVND* |
| Ga0164307_110241291 | 3300012987 | Soil | QQIKLPSETVLNFTLQAPITVVQVVPDANRPKLGNSQ* |
| Ga0157373_104696761 | 3300013100 | Corn Rhizosphere | GGGLQAATKSQQIKLPSETILNFTLQAPVTVVQSSGSDRQKLPNSQ* |
| Ga0182024_111820281 | 3300014501 | Permafrost | QIKLPSETVLNFILQAPITVVQASRPDADRPKLVNSPQ* |
| Ga0181522_101845451 | 3300014657 | Bog | LPSETVLNFTLQQPVTVVKAQNPDGNRPKLGDSQ* |
| Ga0181519_103627801 | 3300014658 | Bog | RPGGFRGGLGGGAQAATKSQQIKLPSETVINFTLQALVTVIANSQNPNASRPKLNQ* |
| Ga0182007_101093191 | 3300015262 | Rhizosphere | LGGGVQAATHGQQIKLTSETVLNFTLQGPLTVVPTTRGPNEGRPKLEANQNQNQ* |
| Ga0182041_121723541 | 3300016294 | Soil | TKSQQIKLPSETVLNFTLQQPITVVQASPDPNRQKLQNQN |
| Ga0182033_107034661 | 3300016319 | Soil | TKGQQIKLPSETVLNFTLQQPITVVQVQPANANRQKLQSQP |
| Ga0182035_120095891 | 3300016341 | Soil | KLPSETVLNFTLTNAVTVTQAVDPNAGRQRMSDSNQ |
| Ga0182034_105256281 | 3300016371 | Soil | TKGQQIKLPSETVLNFTLQQPVTVVQAAPANGNRQKLQTQP |
| Ga0182038_116970561 | 3300016445 | Soil | GGVQAATKGQQIKLSSETVLNFTLQAPVTVVASKNPNENRPRLDSPSNQ |
| Ga0187856_11322633 | 3300017925 | Peatland | VGGGAQAASKSQQIKLPSETILTFTLQAPVTVIKQQDPNAGR |
| Ga0187819_104493832 | 3300017943 | Freshwater Sediment | QQIKLPSETVLNFTLQQPITVVQAPPADANRQKLPAQ |
| Ga0187819_106810821 | 3300017943 | Freshwater Sediment | GGLGGGVQAATKGQQIKLPSETVLNFTLQTPVSVLPTSQGPNSGRQQLGTNQ |
| Ga0187786_105493261 | 3300017944 | Tropical Peatland | GGGVQAATKGQQIELRSETVLTFTLQAPVTVVQNSQRPASSRQPLPEQ |
| Ga0187817_104849452 | 3300017955 | Freshwater Sediment | DQIKLPTETVLNFVLQEPITVMKAPAADTNRQKLDSQ |
| Ga0187783_103989533 | 3300017970 | Tropical Peatland | GVQAASKSQQIKLPSETVLNFTLQAPITVVEAESTDVNRPKLSTSQ |
| Ga0187781_102345121 | 3300017972 | Tropical Peatland | GGVQAASKSQQIKLPSETVLNFTLQAPITVVEAESTDVNRPKLSTSQ |
| Ga0187804_100887611 | 3300018006 | Freshwater Sediment | AATKGQQIKLPSETVLNFTLQAPVTVVATTQGPDSGRQKLNANQ |
| Ga0187805_104737351 | 3300018007 | Freshwater Sediment | GQQIKLPSETVLNFTLQAPVTVIATAQGTDAGRQKLGPNN |
| Ga0187810_102832581 | 3300018012 | Freshwater Sediment | GGGVQAATKSQQIKLPSETVLNFTLQAPITVVQAQGPDANRPKLSNSQQQ |
| Ga0187858_101135584 | 3300018057 | Peatland | SKSQQIKLPSETVLNFTLQAPVTVVQAASPDANRPKLGDSPQ |
| Ga0187773_103158942 | 3300018064 | Tropical Peatland | GGGVQAATKGQQIKLPTETVLNFTLQSPVSVTPTSEGPHSDRQKLDTPQ |
| Ga0187772_100808054 | 3300018085 | Tropical Peatland | GGGIQAATKGQQIKLGSETVLNFTLQAPVTVVATSKGPDAGRQKLGDNSQ |
| Ga0187772_101535973 | 3300018085 | Tropical Peatland | ATKSQQIKLASETVLTFTLQAPVTVVQAPQPDANRPKLSDSQ |
| Ga0187769_100128571 | 3300018086 | Tropical Peatland | KLPSETVLNFTLQQPVTVVATSQGPDSGRQKLNANQ |
| Ga0187771_100735691 | 3300018088 | Tropical Peatland | KSQQIKLPSETVLNFTLQAPVTVVQAPKPDANRPKLGDSQ |
| Ga0187771_100840481 | 3300018088 | Tropical Peatland | KSQQIKLPSETVLTFTLQAPVTVVQAPQPDANRPKLGDSQ |
| Ga0187770_104550901 | 3300018090 | Tropical Peatland | AVTHGQQIKLPSETVLNFALQTPVSILPVQSPNSGP |
| Ga0187770_114725441 | 3300018090 | Tropical Peatland | AGVGGGVQAASKSQQIKLPSETVLNFTLQAPVTVVLAPKPDANRQKLGDSQ |
| Ga0066667_113511342 | 3300018433 | Grasslands Soil | GGLGGGVQAATKGQQIKLPSETVLNFTLQAPLTVVATNKGPNEGRPKMDSNQ |
| Ga0066662_100974661 | 3300018468 | Grasslands Soil | GGLGGGVQAATKGQQIKLPSETVLNFTLQAPVTVVATNKGPNSGRPTLDSNQGPN |
| Ga0182025_10186782 | 3300019786 | Permafrost | GAGVGAGAQASGKGQQIKLPSETVLDFTLQAPVTVVKSADPNAARPKLDDSH |
| Ga0193707_11049091 | 3300019881 | Soil | GGGVQAATKGQQIKLPSETVLNFTLQAPVSVLPAKGPHEGRPKLEANQ |
| Ga0193729_12365391 | 3300019887 | Soil | QQIKLPSETVLNFTLQAPVTVVKAEDPNAVRQKLSDSQ |
| Ga0210407_101049201 | 3300020579 | Soil | VQAAGKSQQIKLPSETVLNFTLQAPVTVVKPQDPNASRQKLGDSQ |
| Ga0210407_104740732 | 3300020579 | Soil | SQQIKLPSETVLNFTLQQPVTVVQAAPSDANRQKLSSQQ |
| Ga0210399_100782541 | 3300020581 | Soil | GGVQAASKSQQIKLPSETVLNFTLQQPVTVVQAVGDPNRLKLSSQQ |
| Ga0210399_110519792 | 3300020581 | Soil | SQQIKLPSETVLNFTLQAPITVVQVSGPDANRPKLADSQ |
| Ga0210401_101940371 | 3300020583 | Soil | IKLPSETVLNFVLQEPIEVVPAPPADPNRPKLGDSQ |
| Ga0210401_102050662 | 3300020583 | Soil | AGVGGGAQAASKGQQIKLPSETVLNFTLQAPLTVSKPPNSNPTRPKLSASP |
| Ga0210406_103252281 | 3300021168 | Soil | KSQQIKLPSETVLNFTLQQPVTVVQAAPSDANRQKLSSQQ |
| Ga0210400_100242121 | 3300021170 | Soil | GGVQAATKGQQIKLPSETVLNFTLQGPLTVVPTTQGSNATRSRAANQ |
| Ga0210400_102351131 | 3300021170 | Soil | SIKLPSETVLNFTLQAPVTVLKAPERNGERQKLSESQ |
| Ga0210388_105701942 | 3300021181 | Soil | QAATKGQQIKLPSETVLNFTLQAPVTVIATSQGLDAGRQKLGPNN |
| Ga0210393_109283112 | 3300021401 | Soil | SQQIKLPSETVLNFTLQEPVEVVQAPSPNANRPKLIDSQ |
| Ga0210385_106930161 | 3300021402 | Soil | AAAGAGVGGGVQAATKSQQIKFPSETVLNFTLQAPVTVVQAPSSDANRPKLGNSQ |
| Ga0210386_102075441 | 3300021406 | Soil | GAQAASKSQQVKLPSETVLTFTLQAPVTVIKPPDTNSARPKLDDSH |
| Ga0210391_107142712 | 3300021433 | Soil | VGGGVQAASKSQQIKLPSETVLNFTLQAPITVVQVSGPDANRPKLADSQ |
| Ga0210402_101375671 | 3300021478 | Soil | GAQAITKGQQIKLPSETVLNFTLQAPLTVIPTQGPNAGRPTLNP |
| Ga0210402_106304813 | 3300021478 | Soil | GVGGGVQAATKGQQIKLPSETVLNFTLQAPITVVEAQGPNSSRPKLGN |
| Ga0210402_109596571 | 3300021478 | Soil | GGLGGGIQAATKGQQIKLPSETVLNFTLQAPVTVIATTEGPDAGRQKLGPNNQ |
| Ga0210410_110962971 | 3300021479 | Soil | GGVIGGGVQAASKGQQIKLPSETVMNFTLQAPVTVVATNQGPNAGRQKLDISQ |
| Ga0224556_10417891 | 3300024295 | Soil | AVTKGQQIKLPSETVLTFTLQAPVTVLPTQSPDSGRPKLGSGQ |
| Ga0208937_10578152 | 3300025506 | Peatland | GVGGGAQAASKSQQIKLPSETILTFTLQAPVTVIKQQDPNAGRQKLGDSP |
| Ga0208220_10489331 | 3300025627 | Arctic Peat Soil | GGVQAATKSKQIKLPSETVLNFTLQAPVTVIKTSEGPHANRPKADTNQDVPLQQ |
| Ga0207680_110333802 | 3300025903 | Switchgrass Rhizosphere | LGGGVQAATKGQQIKLPSETVLNFTLQAPVSVLPAKGPHEGRPKLEANQ |
| Ga0207699_104354721 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | GVQAATKGQQIKLPSETVLNFTLQAPITVVQARNADANRQKLNESQQQ |
| Ga0207699_108455541 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VSAATKGQQINLASETVLNFQLQSPVSVLPTSQGRNAGRQEVE |
| Ga0207699_112535642 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | TGVSAATKGQQIVLPSETVLNFQLQAPLSVIPTNGGPNAGRQQLN |
| Ga0207693_102976691 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GAGVGGGVQAATKSQQIKLPSETILNFTLQAPVTVVQSSGSDRQKLPNAQ |
| Ga0207663_106679352 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VFPQGGGVQAATKSQQIKLASETVLNFTLQGPVTVLPTSKGPNADRPKLEQQ |
| Ga0207646_106678801 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | KSQQIKLPSETVLNFTLQAPVTVIQAPNPNANRQKLGESQ |
| Ga0207700_100376695 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | KSDQIQLPSETILNFTLQAPITVVQALNVDANRPRLADSPR |
| Ga0207700_103339033 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GGGVQAVTKGQQIKLPSETVLNFTLQAPITVIEAQGPGANRPKLGNQQ |
| Ga0207665_107204642 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | GAAAGAGVGGGVQAATKSQQIKLPSETILNFTLQAPVTVIQSSGSDRQKLPNSQ |
| Ga0209839_102236572 | 3300026294 | Soil | AASKSEQIKLPSETVLNFVLQAPIEVVKAPQADTNRPKLDSQ |
| Ga0209154_10714123 | 3300026317 | Soil | GVQAATKGQQIKLPSETVLNFTLQAPVTVVATNKGPNSGRRTLDSNQGPN |
| Ga0209687_11346061 | 3300026322 | Soil | VQAATKGQQIKLPTETVLNFTLQTPLTVVATSKAPDEGRPRLERPTDPNQ |
| Ga0209473_10277301 | 3300026330 | Soil | ATKGQQIKLPSETVLNFTLQAPVTVVATNKGPNSGRPTLDSNQSPN |
| Ga0209267_11917261 | 3300026331 | Soil | KGQQIKLPSETVLNFTLQAPVTVVATNKGPNSGRPTLDSNQGPN |
| Ga0209803_10367022 | 3300026332 | Soil | GGGVQAATKGQQIKLPSETVLNFTLQAPVTVVATNKGPNSGRPTLDSNQGPN |
| Ga0209158_10654663 | 3300026333 | Soil | GLGGGVQAATKGQQIKLPSETVLNFTLQAPVTVVATNKGPNSGRPTLDSNQGPN |
| Ga0209158_12030461 | 3300026333 | Soil | QQIKLPSETVLNFTLQQPVTVVQAAPGDANRQKLSSQQ |
| Ga0257168_10293501 | 3300026514 | Soil | GGVGGGVQAATKSQQIKLPSETVLNFTLQAPVTVVKAPNPGSNRPKLGDSQ |
| Ga0208241_10835002 | 3300027297 | Forest Soil | GTAAGAGVGGGAQAASKSQQIKLPSETVVNFTLQEPVEVVQVTNPNANRPKVVDSQ |
| Ga0209008_10267561 | 3300027545 | Forest Soil | HQIKLPSETVLNFTLQAPVTVVKPPAPNASRPKLDDAH |
| Ga0209525_11172691 | 3300027575 | Forest Soil | QIKLPSETVLNFTLQAPITVVQVSGPDANRPKLADSQ |
| Ga0209733_10381321 | 3300027591 | Forest Soil | ASKSQQIKLPSETVLNFTLQAPVTVTRSQDPDAERQKLGDSH |
| Ga0209420_10030301 | 3300027648 | Forest Soil | GGGAQAASKSPPIKLPAETVLNFTLQAPITVVEAASPNANRPKLGDTPQ |
| Ga0207826_11160552 | 3300027680 | Tropical Forest Soil | GVQAATKGQQIKLPSETVLNFTLQGPLTVVPAGAPHEDRQKMDASQ |
| Ga0209689_11620971 | 3300027748 | Soil | GGVQAATKGQQIKLPSETVLNFTLQAPVTVVATNKGPNSGRPTLDSNQGPN |
| Ga0209811_103769712 | 3300027821 | Surface Soil | QQIKLPPETVLNFTLQQPITVVQAAPADNNREKLSSQQ |
| Ga0209580_103451002 | 3300027842 | Surface Soil | KLPSETVLNFTLQAPITVVQTPNPNANRPRLGDSQ |
| Ga0209590_108305301 | 3300027882 | Vadose Zone Soil | KLPSETVLNFTLQAPVTVVQAPNPNSNRQKMGDTN |
| Ga0209624_100942951 | 3300027895 | Forest Soil | QAATKAHQIKLPSETVLNFTLQAPVTVVKPPVPNASRTKLDDAH |
| Ga0209488_110198362 | 3300027903 | Vadose Zone Soil | GGIGGGVQAATKGQQIKLPSETVLNFTLQAPVTVIQAPSPNEKRQKLGDSQ |
| Ga0209415_101485841 | 3300027905 | Peatlands Soil | AGVGAGAQEVSKSQQIKLPSETVLNFTLQAPVTVVQAASPDANRPKLGDSPQ |
| Ga0209415_107786372 | 3300027905 | Peatlands Soil | WGGGVQAASKSQQIKLPSETVLNFTLQAPVEVVQATSPDADRQKLVSQ |
| Ga0209415_108358271 | 3300027905 | Peatlands Soil | GAQAASKSQQIKLPSETILTFTLQAPVTVIKQQDPNAGR |
| Ga0209006_102843752 | 3300027908 | Forest Soil | ASKSQQIKLPSETVLNFTLQAPITVVQVSGPDANRPKLADSQ |
| Ga0209698_101905454 | 3300027911 | Watersheds | GQQIKLPSETVLNFTLQAPLTVVPAAGPNSGRQRLDANN |
| Ga0209698_108323491 | 3300027911 | Watersheds | SEQIKLPSETVLNFTLQQPVTVVLAAPGDANRQKLSGQP |
| Ga0209168_104726032 | 3300027986 | Surface Soil | AVTKGQQIKLPTETVLNFTLQAPVTVVQTSQGPNAGRPQLNNPNQ |
| Ga0265355_10021093 | 3300028036 | Rhizosphere | GGGAQAASKSQQIKLPSETVLNFTLQAPVTIIKPTGDDAARPRLGDAQ |
| Ga0311327_100830991 | 3300029883 | Bog | KLPSETVLNFTLQAPLTVVRPPDPNAGRQKLVDSK |
| Ga0311339_118740391 | 3300029999 | Palsa | GTAAGAGVGAGAQASGKSQQIKLPSETVLNFTLQAPLTVLRAPDPNAGRPKLDESH |
| Ga0302177_103659771 | 3300030053 | Palsa | AVQAASKSQQIKLPSETVLNFTLQAPITVVQAPSPNADRQKLSDSQ |
| Ga0075405_109647901 | 3300030847 | Soil | GGVQAAGKGQQIKLPSETVLNFTLQAPVTVLKPQDPNAGRQKLGASQ |
| Ga0170824_1077692542 | 3300031231 | Forest Soil | GAGVGGGVQAAGKGQQIKLPSETVLNFTLQAPVTVLKPQDPNAGRQKLGASQ |
| Ga0310915_108534462 | 3300031573 | Soil | AATKGQQIKLPSETVLNFTLQQPVTVVQAAPANGNRQKLQTQP |
| Ga0307476_100678163 | 3300031715 | Hardwood Forest Soil | GGGVQAASKGQQIKLPSETVMNFTLQAPVTVMATSRGPNAGRQKLDISQ |
| Ga0307469_105397051 | 3300031720 | Hardwood Forest Soil | KSQQIKLPAETVLNFSLQAPVTVLQAPSPNGNRPKLGNSQ |
| Ga0307468_1010785791 | 3300031740 | Hardwood Forest Soil | KLPPETVLNFRLQQPITVVQAAPADRNREKLSSQQ |
| Ga0302319_102215971 | 3300031788 | Bog | AGVGGGAQAASKSQQIKLPSETILNFTLQAPVTVVRPPAANPPRPKLEDPH |
| Ga0307478_114442622 | 3300031823 | Hardwood Forest Soil | GAAGGVIGGGVQAASKGQQIKLPSETVMNFTLQAPVTVVATNQGPNAGRQKLDISQ |
| Ga0308174_101592283 | 3300031939 | Soil | VGGGVQAATKSQQIKLPSETILNFTLQAPVTVVQASGSDRQKLPTPQ |
| Ga0310916_117279782 | 3300031942 | Soil | QIKLPSETVLNFTLQQPVTVVQAAPANGNRQKLQTQP |
| Ga0310909_109082991 | 3300031947 | Soil | LPSETVLNFTLTNAVTVTQAVDPNAGRQRMSDSNQ |
| Ga0311301_103377281 | 3300032160 | Peatlands Soil | VQAATKSQQIKLPSETVLNFTLQAPVTVTQAPKPDANRQKLTDSQ |
| Ga0335079_101589891 | 3300032783 | Soil | AASKSEPIKLPSETVLSFTLQEPITVYKPAESDRQKLGESQ |
| Ga0335079_111715822 | 3300032783 | Soil | AATKGQQIKLPSETVLNFTLQAPLTVVATTKGPDEGRPKLMRNQ |
| Ga0335079_112305901 | 3300032783 | Soil | GGGVQAATKGQQIKLPSETVLNFTLQAPVTVVATTQGPNEGRPRLSPNQ |
| Ga0335070_121330301 | 3300032829 | Soil | GQQIEFPSETVLNFTLQQSLTVVEAPSANRNRQKLGE |
| Ga0335069_100769075 | 3300032893 | Soil | VGGGVQAATKAQQIKLPSETVLNFTLQAPITVVQAKAPDSERTKLPDSQ |
| Ga0335071_120550442 | 3300032897 | Soil | GGVQAATKAQQIKLPSETVLNFTLQAPITVVQAKAPDSERTKLPDSQ |
| Ga0335083_112805311 | 3300032954 | Soil | GAGVGGGVQAASKSQQIKLPSETILNFTLQQPVTVVQATPSDPNRPKLQDQK |
| Ga0335076_103452271 | 3300032955 | Soil | GGVAGAGVGGGVQAASKSQQVKLPSETVLNFTLQAPITVVEAPKPDANRPKLTDSQ |
| Ga0335076_107423721 | 3300032955 | Soil | QAATKSQQIKLPSETVLNFTLQQPITVVQATPSDADRPKLPNQN |
| Ga0335084_119824411 | 3300033004 | Soil | VQAATKGQQIKLPSETVLNFTLQAPITVVEAQAPNGNRPKLGNSQ |
| Ga0335077_112649862 | 3300033158 | Soil | LPSETVLNFTLQAPVTVVEARNSSNRQKLSDSQQPQQ |
| Ga0370515_0175095_2_145 | 3300034163 | Untreated Peat Soil | GAQAVTKGQQIKLPTETVLNFTLQSPVTVVETSQGPNANRPQLNNNQ |
| Ga0370492_0314465_2_142 | 3300034282 | Untreated Peat Soil | VQGASKSQQIKLPPETVLNFTLQAPIIVTKTPNPDANRPKLGDSQP |
| ⦗Top⦘ |