NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F026958

Metagenome / Metatranscriptome Family F026958

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F026958
Family Type Metagenome / Metatranscriptome
Number of Sequences 196
Average Sequence Length 73 residues
Representative Sequence MADQAERVILEAEDQVTPIVDKANAGLDSFEKKAESSHGKVIRISDQTRTSVQRLIASLEKQAETYGKSGV
Number of Associated Samples 127
Number of Associated Scaffolds 196

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 90.82 %
% of genes near scaffold ends (potentially truncated) 97.45 %
% of genes from short scaffolds (< 2000 bps) 91.84 %
Associated GOLD sequencing projects 124
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.286 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog
(15.816 % of family members)
Environment Ontology (ENVO) Unclassified
(52.041 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(41.837 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 68.69%    β-sheet: 0.00%    Coil/Unstructured: 31.31%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 196 Family Scaffolds
PF01954AF2212-like 1.53
PF00805Pentapeptide 0.51
PF07883Cupin_2 0.51
PF16277DUF4926 0.51
PF13676TIR_2 0.51
PF09907HigB_toxin 0.51
PF13414TPR_11 0.51
PF02535Zip 0.51
PF03864Phage_cap_E 0.51
PF13560HTH_31 0.51
PF02452PemK_toxin 0.51
PF04343DUF488 0.51
PF09954DUF2188 0.51
PF07719TPR_2 0.51
PF03235DUF262 0.51
PF00069Pkinase 0.51

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 196 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.04
COG0428Zinc transporter ZupTInorganic ion transport and metabolism [P] 0.51
COG1357Uncharacterized conserved protein YjbI, contains pentapeptide repeatsFunction unknown [S] 0.51
COG1479DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domainsDefense mechanisms [V] 0.51
COG2337mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin moduleDefense mechanisms [V] 0.51
COG3189Uncharacterized conserved protein YeaO, DUF488 familyFunction unknown [S] 0.51


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.80 %
UnclassifiedrootN/A10.20 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004152|Ga0062386_100093969All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42299Open in IMG/M
3300004152|Ga0062386_100596632All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4902Open in IMG/M
3300005529|Ga0070741_10287093All Organisms → cellular organisms → Bacteria1550Open in IMG/M
3300006174|Ga0075014_100684785All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4595Open in IMG/M
3300009500|Ga0116229_11529768All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4527Open in IMG/M
3300009552|Ga0116138_1157155All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4628Open in IMG/M
3300009623|Ga0116133_1130288All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4651Open in IMG/M
3300009630|Ga0116114_1170555All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4549Open in IMG/M
3300009637|Ga0116118_1281216Not Available505Open in IMG/M
3300009638|Ga0116113_1157094Not Available572Open in IMG/M
3300009639|Ga0116122_1191145All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4643Open in IMG/M
3300009641|Ga0116120_1271664All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4530Open in IMG/M
3300009643|Ga0116110_1023815All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42345Open in IMG/M
3300009644|Ga0116121_1233902All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4587Open in IMG/M
3300009665|Ga0116135_1423088All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4543Open in IMG/M
3300009665|Ga0116135_1427176All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4541Open in IMG/M
3300009672|Ga0116215_1402593Not Available592Open in IMG/M
3300009764|Ga0116134_1027990All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42250Open in IMG/M
3300009839|Ga0116223_10228462All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41129Open in IMG/M
3300010339|Ga0074046_10795033All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4553Open in IMG/M
3300010379|Ga0136449_100366868All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42576Open in IMG/M
3300010379|Ga0136449_102059944All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4840Open in IMG/M
3300010379|Ga0136449_102148315All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4817Open in IMG/M
3300014151|Ga0181539_1227552All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4705Open in IMG/M
3300014153|Ga0181527_1169308All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4938Open in IMG/M
3300014156|Ga0181518_10411005All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4653Open in IMG/M
3300014156|Ga0181518_10449369All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4616Open in IMG/M
3300014158|Ga0181521_10037460All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA43548Open in IMG/M
3300014158|Ga0181521_10431895All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4642Open in IMG/M
3300014160|Ga0181517_10267890All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4907Open in IMG/M
3300014161|Ga0181529_10056666All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42713Open in IMG/M
3300014161|Ga0181529_10193428All Organisms → cellular organisms → Bacteria1199Open in IMG/M
3300014161|Ga0181529_10294372All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4908Open in IMG/M
3300014161|Ga0181529_10620762All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4563Open in IMG/M
3300014161|Ga0181529_10621911All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4562Open in IMG/M
3300014162|Ga0181538_10626192Not Available560Open in IMG/M
3300014164|Ga0181532_10074027All Organisms → cellular organisms → Bacteria2175Open in IMG/M
3300014165|Ga0181523_10060729All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42321Open in IMG/M
3300014165|Ga0181523_10759372All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4529Open in IMG/M
3300014169|Ga0181531_10425554All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4817Open in IMG/M
3300014169|Ga0181531_10576266All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4697Open in IMG/M
3300014169|Ga0181531_10854839All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4568Open in IMG/M
3300014169|Ga0181531_11045616All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4513Open in IMG/M
3300014199|Ga0181535_10092394All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41961Open in IMG/M
3300014200|Ga0181526_10293495All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41035Open in IMG/M
3300014200|Ga0181526_10626496All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4679Open in IMG/M
3300014200|Ga0181526_11084322All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4503Open in IMG/M
3300014490|Ga0182010_10624324All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4603Open in IMG/M
3300014491|Ga0182014_10602870All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4530Open in IMG/M
3300014492|Ga0182013_10389083All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4751Open in IMG/M
3300014493|Ga0182016_10593460All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4631Open in IMG/M
3300014496|Ga0182011_11028893All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4510Open in IMG/M
3300014498|Ga0182019_10549264All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300014498|Ga0182019_11035259All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4597Open in IMG/M
3300014499|Ga0182012_10094805All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2255Open in IMG/M
3300014501|Ga0182024_10515377All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1517Open in IMG/M
3300014501|Ga0182024_11424636All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4796Open in IMG/M
3300014501|Ga0182024_12803606Not Available519Open in IMG/M
3300014502|Ga0182021_10941216All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41039Open in IMG/M
3300014657|Ga0181522_10598098All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4669Open in IMG/M
3300014657|Ga0181522_10985566Not Available522Open in IMG/M
3300014658|Ga0181519_10782294All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4590Open in IMG/M
3300014838|Ga0182030_10500519All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41213Open in IMG/M
3300014838|Ga0182030_10712983All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4937Open in IMG/M
3300014838|Ga0182030_11556057All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4543Open in IMG/M
3300014839|Ga0182027_10696274All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41077Open in IMG/M
3300014839|Ga0182027_12067233All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4544Open in IMG/M
3300017938|Ga0187854_10074441All Organisms → cellular organisms → Bacteria → Acidobacteria1635Open in IMG/M
3300017940|Ga0187853_10488163All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4538Open in IMG/M
3300017941|Ga0187850_10386058All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4612Open in IMG/M
3300017946|Ga0187879_10811735All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4522Open in IMG/M
3300017948|Ga0187847_10579834Not Available626Open in IMG/M
3300017948|Ga0187847_10699856All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4570Open in IMG/M
3300017966|Ga0187776_10942035All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4630Open in IMG/M
3300017970|Ga0187783_10500073All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4881Open in IMG/M
3300017972|Ga0187781_10680911All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4743Open in IMG/M
3300017988|Ga0181520_10374640All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41040Open in IMG/M
3300017988|Ga0181520_10491192All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4871Open in IMG/M
3300017988|Ga0181520_10639088All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300017988|Ga0181520_10817019All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4627Open in IMG/M
3300017996|Ga0187891_1143596All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4855Open in IMG/M
3300018013|Ga0187873_1327009Not Available561Open in IMG/M
3300018014|Ga0187860_1106365All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41266Open in IMG/M
3300018019|Ga0187874_10411737Not Available545Open in IMG/M
3300018022|Ga0187864_10081165All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1726Open in IMG/M
3300018023|Ga0187889_10086132All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41580Open in IMG/M
3300018023|Ga0187889_10323879All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4678Open in IMG/M
3300018024|Ga0187881_10303830All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4661Open in IMG/M
3300018025|Ga0187885_10475779Not Available557Open in IMG/M
3300018033|Ga0187867_10033353All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA43193Open in IMG/M
3300018033|Ga0187867_10452942All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4708Open in IMG/M
3300018034|Ga0187863_10171089All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix aarhusiensis1211Open in IMG/M
3300018034|Ga0187863_10312259All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4874Open in IMG/M
3300018035|Ga0187875_10654645All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4553Open in IMG/M
3300018035|Ga0187875_10670045All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4545Open in IMG/M
3300018038|Ga0187855_10525784All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4689Open in IMG/M
3300018038|Ga0187855_10582784All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4651Open in IMG/M
3300018038|Ga0187855_10612833All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4634Open in IMG/M
3300018038|Ga0187855_10699396All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4591Open in IMG/M
3300018040|Ga0187862_10052750All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42949Open in IMG/M
3300018042|Ga0187871_10127785All Organisms → cellular organisms → Bacteria1447Open in IMG/M
3300018042|Ga0187871_10370871All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4791Open in IMG/M
3300018043|Ga0187887_10920677Not Available518Open in IMG/M
3300018044|Ga0187890_10259263All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4978Open in IMG/M
3300018047|Ga0187859_10530764All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4657Open in IMG/M
3300018090|Ga0187770_10614095All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4865Open in IMG/M
3300018090|Ga0187770_11601620Not Available531Open in IMG/M
3300018090|Ga0187770_11641846Not Available525Open in IMG/M
3300019785|Ga0182022_1217783All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41505Open in IMG/M
3300019785|Ga0182022_1303142All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41835Open in IMG/M
3300019788|Ga0182028_1057869All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4747Open in IMG/M
3300019788|Ga0182028_1289530All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4842Open in IMG/M
3300021858|Ga0213852_1208905All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4882Open in IMG/M
3300021858|Ga0213852_1221365All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4515Open in IMG/M
3300021860|Ga0213851_1260977All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4627Open in IMG/M
3300021861|Ga0213853_10040286All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4705Open in IMG/M
3300021861|Ga0213853_10607045All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4542Open in IMG/M
3300022516|Ga0224542_1025917All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4750Open in IMG/M
3300022555|Ga0212088_10671942All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4623Open in IMG/M
3300023101|Ga0224557_1275435Not Available545Open in IMG/M
3300025576|Ga0208820_1059306All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41038Open in IMG/M
3300026474|Ga0247846_1062697All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4659Open in IMG/M
3300027745|Ga0209908_10079961All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4778Open in IMG/M
3300027905|Ga0209415_10900941All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4601Open in IMG/M
3300027908|Ga0209006_10793480All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4768Open in IMG/M
3300028565|Ga0302145_10281645All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4551Open in IMG/M
3300028788|Ga0302189_10126830All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41125Open in IMG/M
3300029889|Ga0246001_1076666All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4638Open in IMG/M
3300029913|Ga0311362_10787907All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4790Open in IMG/M
3300029915|Ga0311358_10983517All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4582Open in IMG/M
3300029922|Ga0311363_11145649All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4663Open in IMG/M
3300029922|Ga0311363_11553591All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4526Open in IMG/M
3300029943|Ga0311340_11047382All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4667Open in IMG/M
3300029953|Ga0311343_11360421All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4531Open in IMG/M
3300029984|Ga0311332_10384543All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41088Open in IMG/M
3300030007|Ga0311338_11040346All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4791Open in IMG/M
3300030007|Ga0311338_12086623All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4501Open in IMG/M
3300030011|Ga0302270_10652331Not Available536Open in IMG/M
3300030020|Ga0311344_11020803All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4643Open in IMG/M
3300030509|Ga0302183_10265636All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4665Open in IMG/M
3300030518|Ga0302275_10393286All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4727Open in IMG/M
3300030519|Ga0302193_10582224All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4542Open in IMG/M
3300030688|Ga0311345_10427013All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41175Open in IMG/M
3300030906|Ga0302314_11370400All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4649Open in IMG/M
3300031232|Ga0302323_103164003All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4525Open in IMG/M
3300031232|Ga0302323_103425715All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4505Open in IMG/M
3300031236|Ga0302324_100443889All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41916Open in IMG/M
3300031236|Ga0302324_100970517All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41159Open in IMG/M
3300031236|Ga0302324_101862393All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4762Open in IMG/M
3300031236|Ga0302324_102297506All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4665Open in IMG/M
3300031249|Ga0265339_10316205All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4742Open in IMG/M
3300031258|Ga0302318_10224314All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4913Open in IMG/M
3300031261|Ga0302140_10913124All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4613Open in IMG/M
3300031261|Ga0302140_11075696All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4547Open in IMG/M
3300031524|Ga0302320_10093042All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA44910Open in IMG/M
3300031708|Ga0310686_111563806All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4872Open in IMG/M
3300031708|Ga0310686_113309080All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4601Open in IMG/M
3300031726|Ga0302321_100248588All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41882Open in IMG/M
3300031788|Ga0302319_10323953All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41784Open in IMG/M
3300031788|Ga0302319_10378904All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41594Open in IMG/M
3300031788|Ga0302319_11622229All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4569Open in IMG/M
3300031788|Ga0302319_11847756All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4520Open in IMG/M
3300032160|Ga0311301_11444582All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4853Open in IMG/M
3300032160|Ga0311301_11482474All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4838Open in IMG/M
3300032160|Ga0311301_12286456All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4616Open in IMG/M
3300032770|Ga0335085_10785842All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41049Open in IMG/M
3300032770|Ga0335085_11456147All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4715Open in IMG/M
3300032783|Ga0335079_11244293All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4746Open in IMG/M
3300032783|Ga0335079_11305382All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4725Open in IMG/M
3300032783|Ga0335079_11574004All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4647Open in IMG/M
3300032805|Ga0335078_10026822All Organisms → cellular organisms → Bacteria8544Open in IMG/M
3300032805|Ga0335078_10081910All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA44699Open in IMG/M
3300032805|Ga0335078_10152907All Organisms → cellular organisms → Bacteria3262Open in IMG/M
3300032805|Ga0335078_10887309Not Available1073Open in IMG/M
3300032805|Ga0335078_11395714All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4791Open in IMG/M
3300032805|Ga0335078_11517704All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4748Open in IMG/M
3300032828|Ga0335080_11130089All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4791Open in IMG/M
3300032829|Ga0335070_11836974All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4548Open in IMG/M
3300032892|Ga0335081_10336574All Organisms → cellular organisms → Bacteria1975Open in IMG/M
3300032892|Ga0335081_11078719All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4928Open in IMG/M
3300032895|Ga0335074_10801300All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4879Open in IMG/M
3300033158|Ga0335077_10043772All Organisms → cellular organisms → Bacteria5489Open in IMG/M
3300033158|Ga0335077_10423982All Organisms → Viruses → Predicted Viral1424Open in IMG/M
3300033402|Ga0326728_10313098All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41419Open in IMG/M
3300033402|Ga0326728_10510098All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4973Open in IMG/M
3300033402|Ga0326728_10576254Not Available886Open in IMG/M
3300033402|Ga0326728_10629166All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4827Open in IMG/M
3300033402|Ga0326728_11045153Not Available560Open in IMG/M
3300033405|Ga0326727_10608215All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4907Open in IMG/M
3300033561|Ga0371490_1064527All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41044Open in IMG/M
3300033818|Ga0334804_118882All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4673Open in IMG/M
3300033887|Ga0334790_160244All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4670Open in IMG/M
3300033891|Ga0334811_144963All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4589Open in IMG/M
3300034065|Ga0334827_245738Not Available523Open in IMG/M
3300034091|Ga0326724_0376927All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4760Open in IMG/M
3300034091|Ga0326724_0575319Not Available564Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland15.82%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog15.82%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil9.18%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog9.18%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland6.63%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen5.61%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.59%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.59%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil4.59%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog3.57%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil3.57%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.06%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen3.06%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds2.55%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.53%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.02%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.02%
Freshwater Lake HypolimnionEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion0.51%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.51%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.51%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.51%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.51%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.51%
PeatEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat0.51%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.51%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated0.51%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300009500Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009637Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40EnvironmentalOpen in IMG/M
3300009638Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019785Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300021858Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022516Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 30-34EnvironmentalOpen in IMG/M
3300022555Alinen_combined assemblyEnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300025576Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes)EnvironmentalOpen in IMG/M
3300026474Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T0EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028565Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3EnvironmentalOpen in IMG/M
3300028788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2EnvironmentalOpen in IMG/M
3300029889Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cmEnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029953II_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030011Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3EnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030518Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2EnvironmentalOpen in IMG/M
3300030519Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3EnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031258Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1EnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033561Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fractionEnvironmentalOpen in IMG/M
3300033818Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-MEnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M
3300033891Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-DEnvironmentalOpen in IMG/M
3300034065Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5EnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062386_10009396933300004152Bog Forest SoilMADQAERVILEAEDLVTPVVDKANAGLDSFEKKAESSHSKVVRISDQTRSSVQRLIASLEKQAE
Ga0062386_10059663213300004152Bog Forest SoilMGDQAERVVLEAEDQVSPVVDQANAGLDSFEKKAESAHSKVIRITDQTRSSVQRLVASLEKQAEVYGKTGVERLI
Ga0070741_1028709313300005529Surface SoilMADQAERVVLEAEDQVNPVVDKANAGLERFENKAESAHGKVIRITDQTRTSIQRLIASLEKQAETYGKSGVERLIAQRDQLLQRYA
Ga0075014_10068478523300006174WatershedsMADQAERVILEAEDQVTPITDKANTALDSFEKKAESSHSKVIRISDQTRSSVQRLIASLEKQAETYGKS
Ga0116229_1152976823300009500Host-AssociatedMADQAERVILEAEETPVLESVGRANTALDSFEKKSESSHGKVIRISDQTRTSVQRLVASLEKQAETYGKS
Ga0116138_115715523300009552PeatlandMADQAERVILEAEDQVTPIVDKANAGLDSFEKKAESSHGKVIRISDQTRTSVQRLIASLEKQAETYG
Ga0116133_113028813300009623PeatlandMADQAERVILEAEDQVTPIVDKANAGLDSFEKKAESSHGKVIRISDQTRTSVQRLIASLEKQAETYGKSGVDRLITQREQLL*
Ga0116114_117055513300009630PeatlandMADQAERVILEAEDQVTPVVDKANAGLDSFEKKAESSHGKVIRISDQTRTSVQRLIAS
Ga0116118_128121623300009637PeatlandMADQAERVILEAEDQVTPIVGKANDGLESFEKKAESSHGKVIRITDQTRSSVQRLISSLEKQAETYGKSGVEKLITQRDQLFQRYSK
Ga0116113_115709423300009638PeatlandMPAAEKVILEAEDTTAGPVRSANQNLQNFERQAEGTHGKVIRITDQTRTSIQRLISSLEKQAETYGKSGVDRLIAQRDSLL
Ga0116122_119114523300009639PeatlandMADQAERVILEAEDQVTPITDKANAALDGFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYG
Ga0116120_127166413300009641PeatlandMADQAERVILEAEDQVTPVVDKANAGLDSFEKKAESSHGKVIRISDQTRTSVQRLIASLEKQAETY
Ga0116110_102381513300009643PeatlandMADQAERVILEAEDQVTPITDKANAALDGFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYGKSGVDRLITQREQLLQR
Ga0116121_123390223300009644PeatlandMADQAERVILEAEDQVSPVVDKANAGLDSFEKKAESSHSKVIRISDQTRSSVQRLIASLEKQ
Ga0116135_142308823300009665PeatlandMADQAERVILEAEDQVTPITDKANAALDGFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETY
Ga0116135_142717623300009665PeatlandMADQAERVILEAEDQVTPIVDKANAGLDSFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAE
Ga0116215_140259313300009672Peatlands SoilMGDQAERVVLEAEDQVNPVVDKANAGLDSFEKKAESAHGKVIRITDQTRSSVQRLIASLEKQAETYGKSGVDRLISQRDQLLQRYAKEP
Ga0116134_102799043300009764PeatlandMADQAERVILEAEDQVTPVVDKANAGLDRFEKQAESSHGKVIRISDQTRSSVQRLIASLE
Ga0116223_1022846213300009839Peatlands SoilMADQAERVILEAEDLVTPVVDKANAGLDSFEKKAESAHGKVIRITDQTRSSVQRLIASLEKQAE
Ga0074046_1079503313300010339Bog Forest SoilMADQAERVILEAEETPVLESVGRANTALDSFEKKSESSHGKVIRISDQTRTSVQRLVASLEKQAETYGKSGVDKLISQRDQL
Ga0136449_10036686813300010379Peatlands SoilMADQAERVILEAEETPVLESVGRANTALDSFEKRSESSHGKVIRISDQTRTSVQRLVASLEKQAETYGK
Ga0136449_10205994413300010379Peatlands SoilMPDQAERVILEAEDQVSPQVDKANAGLQRFEQKAETTHTRVTRITDQTRTSIQRLITSLEKQAEVYGKSGVEKLI
Ga0136449_10214831523300010379Peatlands SoilMPQAERVILEAEDEVTPVVNKANAGLDSFEKKAESSHGKVIRITDQTRSSIQRLITSLEKQAE
Ga0181539_122755213300014151BogMADQAERVILEAEDQVTPVVGQANAGLDSFEKKAELAHGKVIRITDQTRSSIQRLIASLEKQAETYGKSGVDRLVSQRDQ
Ga0181527_116930813300014153BogMADQAERVILEAEDQVTPIVDKANAGLDSFEKKAESSHAKVIRISDQTRSSVQRLIASLEKQAETYGKSGVDR
Ga0181518_1041100523300014156BogMADQAERVILEAEDQVSPVVDKANAGLDSFEKKAESSHSKVIRISDQTRSSVQRLIASLEKQAETYGKSGVDRLITQRDQLLQRYNR
Ga0181518_1044936923300014156BogMADQAERVILEAEDQVTPVVDKANAGLDSFEKKAESSHGKVIRISDQTRTSVQRLIASLEKQAETYGK
Ga0181521_1003746013300014158BogMADQAERVILEAEDQVTPIVDKANAGLDSFEKKAESSHGKVIRISDQTRTSVQRLIASLEKQAETYGKSGV
Ga0181521_1043189513300014158BogMPQAERVILEAEDEVTPVVNKANAGLASFEQKAESSHGKVIRITDQTRSSIQRLIASLEK
Ga0181517_1026789023300014160BogMSDQAEKIILEAEDQVTPIVGKANTSLGAFETKAESSHGKVIRITDQTRSSVQRLIASLEKQAETYGKSGVEKLIAQRDQ
Ga0181529_1005666663300014161BogMADQAERVILEAEDQVTPITDKANAALDGFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYGKSGVDRLITQRD
Ga0181529_1019342843300014161BogMPQSEKVILEAEDEVTPVVEKANASLGRFEEKAESSHGKVVRITDQTRTSIQRLIS
Ga0181529_1029437233300014161BogMADQAERVILEAEETPVLESVGRANAGLDSFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETY
Ga0181529_1062076223300014161BogMADQAERVILEAEDQVTPITDRANAALDGFEKKAESSHGKVIRISDQTRSSAQRLIASLEKQAETYGKSGVDRLITQRD
Ga0181529_1062191123300014161BogMADQAERVILEAEDQVTPIVDKANAGLDSFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYGKSGVDRLITQRDQLLQRYN
Ga0181538_1062619213300014162BogMGDQAERVVLEAEDAVSPVVDKANTSLDGFEKKATTAHDKVVRITDQTRTSVQRLISSLEKQDDTFGKSGVEKLVVQRDQ
Ga0181532_1007402713300014164BogMADQAERVILEAEDEVTPVVNKANTGLDSFEKKAESSHGKVIRITDQTRSSIQRLIASLEKQAET
Ga0181523_1006072943300014165BogMADQAERVILEAEDQVTPVVDKANAGLDSFEKKAESSHGKVIRISDQTRTSVQRLIASLEKQ
Ga0181523_1075937223300014165BogVADQAERVILEAEDQVTPVVDKANAGLDRFEKQAESSHGKVIRISDQTRTSVQRLIASLEKQAETYGKSGVERLITQRDQLL
Ga0181531_1042555423300014169BogMPQAERVILEAEDEVTPVVGKANAGLESFEQKAESSHGKVIRITDQTRSSIQRLIASLEKQAETYGKSGVDRLIAQRDSLLQRYA
Ga0181531_1057626613300014169BogMADQAERIILEAEDEVTPVVNKANAGLQKFEGQAESSHGKVIRITDQTRSSIQRLIASLEKQAETYGKSGVDKLIAQRDSLLQRY
Ga0181531_1085483913300014169BogMADQIERVILEAEDQVTPITDKANASLDSFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYGKSGVDRLIVQRDSLLQ
Ga0181531_1104561613300014169BogMADQAERVILEAEETPVLESVGRANTALDSFEKKSESSHGKVIRISDQTRTSVQRLVASLEKQAETYGKSGVDKLISQ
Ga0181535_1009239443300014199BogMADQAERVILEAEETPVLESVGRANAGLDSFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYGKSGVDRL
Ga0181526_1029349523300014200BogVADQAERVILEAEDEVTPVVNKANAGLQKFEGQAESSHGKVIRITDQTRSSIQRLIASLERQAETYGKSGVDK
Ga0181526_1062649623300014200BogMADQAERVILEAEDQVSPVVDKANAGLDSFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQTETY
Ga0181526_1108432223300014200BogMADQAERVILEAEDQVTPIVDKANAGLDSFEKKSESSHGKVIRISDQTRTSVQRLIASLE
Ga0182010_1062432413300014490FenMADQAERVILEAEDNVTPIVARANAGLESFEKKAESSHGKVIRITDQTRTSIQRLIASLEKQAEVYGKSG
Ga0182014_1060287023300014491BogMADQAERVILEAEDQVTPVVGQANAGLDSFEKKAESAHGKVIRITDQTRTSIQRLIASLEKQAEVYGKSGVDRLISQRDQLLQ
Ga0182013_1038908313300014492BogMADQAERVILEAEDQVTPIVGKANSALGSFENKAESSHGKVIRITDQTRTSVQRLIASLEKQAETYGKSGVEK
Ga0182016_1059346023300014493BogMADQAERVILEAEETPVLESVGRANTALDSFEKKSESSHGKVIRISDQTRTSVQRLVASLEKQAETYGKSGVDKLISQRDQLLQRYSREPQA
Ga0182011_1102889313300014496FenMADQAERVILEAEDQVTPVVGQANAGLDSFEKKAESAHGKVIRITDQTRTSIQRLIASLEKQAEVYGKSGAERLISQ
Ga0182019_1054926423300014498FenMSDQAEKIILEAEDQVTPVVGQANAGLDSFEKKAESSHGKVIRITDQTRTSIQRLIASLEKQAEVYG
Ga0182019_1103525923300014498FenMADQAERVILEAEDMVTPVVAQANAGLDAFEKKAESAHGKVIRITDQTRTSIQRLITSLEKQAEVYGKSG
Ga0182012_1009480543300014499BogLKWRTRQNAVILEAEETPALESVGRANCALASFEKKSESSHGKVIRISDQTRSSVQRLIASLEKQAETYGKSGVDKLIA
Ga0182024_1051537743300014501PermafrostMADQAERVILEAEETPVLESVGRANTALDSFEKKSESSHGKVIRISDQTRTSVQRLVASLEKQAETYGKSGVDKLISQRDQLLQRY
Ga0182024_1142463623300014501PermafrostMADQAERVILEAEDQVTPVVDKANTGLDSFEKKAESSHGKVIRISDQTRTSVQRLIASLEKQAETYGKSGV
Ga0182024_1280360613300014501PermafrostMADQAERVILEAEDQVSPVVDKANAGLDRFEKQAESSHGKVIRISDQTRTSVQRLIASLEKQADTYGKSGVDRLITQRDQLLQR
Ga0182021_1094121623300014502FenMSDQAEKIILEAEDQVTPVVGQANAGLDSFEKKAESSHGKVIRITDQTRTSIQRLIASLEKQAEVYGK
Ga0181522_1059809823300014657BogMADQAERVILEAEETPVLESVGRANTALDSFEKKSESSHGKVIRISDQTRTSVQRLVASLEKQAETYGKSGVD
Ga0181522_1098556623300014657BogMGDQAERVVLEAEDQVSPVVDKANASLDGFEKKATTAHDKVVRITDQTRTSVQRLVASLEKQAETFGKTGVEKLIVQRDQLL
Ga0181519_1078229413300014658BogMADQAERVILEAEDLVTPVVDKANAGLDSFEKKAESSHGKVIRITDQTRTSVQRLISSLEKQSETYGKSG
Ga0182030_1050051933300014838BogMADQAERVILEAEDQVTPVVDKANAGLDRFEKQAESSHGKVIRISDQTRSSVQRLIASLEKQ
Ga0182030_1071298313300014838BogMADQAERVILEAEETPVLEAVGRANTALDSFEKKSESSHGKVIRISDQTRTSVQRL
Ga0182030_1155605713300014838BogMADQVERVILEAEDQVTPITDKANASLDSFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYGKS
Ga0182027_1069627413300014839FenMADQAERVILEAEDQVSPVVDKANAGLDSFEKKAESSHAKVIRISDQTRSSVQRLIASLEKQAETYGKS
Ga0182027_1206723323300014839FenMADQAERVILEAEDQVTPVVGQANAGLDSFEKKAESAHGKVIRITDQTRSSIQRLIASLEKQAEVYGKSGAERLISQRDQLLQ
Ga0187854_1007444113300017938PeatlandMADQAERVILEAEDQVTPITDKANAALDGFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYGKSG
Ga0187853_1048816323300017940PeatlandMADQAERVILEAEDQVAPVVDKANAGLDTFNKKAESSHGRVIRISDQTRSSVQRLIASLEKQAETYAKSGVDRLIT
Ga0187850_1038605823300017941PeatlandMADQAERVILEAEDQVTPIVDKANAGLDSFEKKAESSHGKVIRISDQTRTSVQRLIASLEKQAETYGKSGVDRLIT
Ga0187879_1081173523300017946PeatlandMADQAERVILEAEDQVTPVVEKANAGLDSFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYG
Ga0187847_1057983423300017948PeatlandMGDQAERVVLEAEDQVSPVVDQANSSLDSFEKKATTAHDKVVRITDQTRTSVQRLISSLEKQADTFGKSGVEKLVVQRDQLLQRYAK
Ga0187847_1069985613300017948PeatlandMADQAERVILEAEDQVTPIVDKANAGLDSFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYGKSGVDRLITQ
Ga0187776_1094203523300017966Tropical PeatlandMADQAERVILEAEETPVLESVGRANTALDSFEKKSEASHAKVIRISDQTRSSVQRLIASLEKQAE
Ga0187783_1050007323300017970Tropical PeatlandMGDQAERVVLEADDQVTPITSKANAALDSFERKATSSGEKVVRINDQTRTSVQRLIASLEKQTETYG
Ga0187781_1068091113300017972Tropical PeatlandMADQAERVILEAEDLVTPVVDKANAGLDSFEKKAESSHSKVIRISDQTRSSVQRLIASLEKQAETYGKSG
Ga0181520_1037464013300017988BogMADQAERVILEAEDQVTPVVDKANAGLDRFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYGKSGVDRLITQRDQLLQR
Ga0181520_1049119213300017988BogMADQAERVILEAEDQVTPITDKANTALDSFEKKAESSHSKVIRISDQTRSSVQRLIASLEKQAETYGKSGVDRLI
Ga0181520_1063908823300017988BogMPQSEKVILEAEDEVTPVVGKANASLESFEQKAESSHGKVIRITDQTRTSIQRLISSLEKQAET
Ga0181520_1081701923300017988BogMGDQAEKIILEAEDLVTPVVDKANAGLDSFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQADIY
Ga0187891_114359623300017996PeatlandMADQAERVILEAEDQVTPITDKANAALDGFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAE
Ga0187873_132700923300018013PeatlandMGDQAERVVLEAEDQVSPVVDQANSSLDSFEKKATTAHDKVVRITDQTRTSVQRLISSLEKQADTFGK
Ga0187860_110636513300018014PeatlandMADQAERVILEAEDQVTPITDKANAALDGFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYGKSGVD
Ga0187874_1041173723300018019PeatlandMPAAEKVILEAEDTTAGPVRSANQNLQNFERQAEGTHGKVIRITDQTRTSIQRLISSLEKQAETYGKSGVDRLIAQRDSLLQRYAK
Ga0187864_1008116553300018022PeatlandMGDQAEKIILEAEDLVTPVVDKANAGLDSFEKKAESSHGKVIRISDQTRTSVQRLIAPLEKQAETYG
Ga0187889_1008613213300018023PeatlandMPAAEKVILEAEDTTAGPVRSANQNLQNFERQAEGTHGKVIRITDQTRTSIQRLISSLEKQAETYGKSG
Ga0187889_1032387923300018023PeatlandMADQAERVILEAEDQVTPITDKANAGLDSFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYGKS
Ga0187881_1030383013300018024PeatlandMADQAERVILEAEDQVTPIVDKANAGLDSFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYGKSGVERLITQRDQL
Ga0187885_1047577923300018025PeatlandMADQAERVILEAEDEVTPVVNKANAGLDSFEKKAESSHGKVIRITDQTRSSIQRLIASLEKQAETYGKSGVDRLIAQRD
Ga0187867_1003335313300018033PeatlandMADQAERVILEAEDQVTPITDKANAALDGFEKKAESSHGKVIRISDQTRSSVQRLIASLE
Ga0187867_1045294223300018033PeatlandMADQAERVILEAEDQVTPVVDKANAGLDSFEKKAESSHGKVIRISDQTRTSVQRLIASLEKQAETYGKSGVERLITQREQLLQRYNREP
Ga0187863_1017108913300018034PeatlandMADQAERVILEAEDQVTPITDKANAALDGFEKKAESSHGTVIRISDQTRSSVQRLIASLEKQAETYGKSGVDRLIVQR
Ga0187863_1031225913300018034PeatlandMADQAERVILEAEDEVTPVVNKANTGLDSFEKKAESSHGKVIRITDQTRSSIQRLIASLEKQAETYGKS
Ga0187875_1065464513300018035PeatlandMADQAERVILEAEDQVTPIVDKANVGLDSFEKKAESSHSKVIRISDQTRTSVQRLIASLEKQAETYGKSGVDRLITQREQL
Ga0187875_1067004523300018035PeatlandVILEAEDQVTPIVDKANAGLDSFEKKAESSHGKVIRISDQTRTSVQRLIASLEKQAETYGKS
Ga0187855_1052578413300018038PeatlandMADQVERVILEAEDQVSPVVDKANTSLDGFEKKATTAHDKVVRITDQTRSSVQRLVASLEKQAETFGKTGVDKLITQRDQLLQRYAK
Ga0187855_1058278423300018038PeatlandMGDQAERVVLEAEDQVSPVVNQANSSLDSFEKKATTAHDKVVRITDQTRTSVQRLVASLEKQAETFGKTGVERLISQRDQLLQ
Ga0187855_1061283323300018038PeatlandMADQAERVILEAEDQVTPIVDKANAGLDSFERKAESSHGKVIRISDQTRSSVQRLISSLEKQAET
Ga0187855_1069939623300018038PeatlandMGDQAERVVLEAEDQVSPVVDKANTSLDGFEKKATTAHDKVVRITDQTRTSVQRLVASLEKQAE
Ga0187862_1005275053300018040PeatlandMADQAERVILEAEDQVSPVVDKANSGLDSFEKKAESSHSKVIRISDQTRSSVQRLIASLEKQAETYNKSGVERLITQRD
Ga0187871_1012778513300018042PeatlandMGDQAERVVLEAEDQVSPVVDQANSSLDSFEKKATTAHDKVVRITDQTRTSVQRLISS
Ga0187871_1037087113300018042PeatlandMADQAERVILEAEETPVLEAVGRANTALDSFEKKSESSHGKVIRISDQTRTSVQRLVASLEKQAETYGKS
Ga0187887_1092067723300018043PeatlandMADQVERVILEAEDQVSPVVDKANTSLDGFEKKATTAHDKVVRITDQTRTSVQRLVASLEKQAETFGKTGVEKLIVQRDQLLQRYSREP
Ga0187890_1025926333300018044PeatlandMGDQAERVILEAEDEVTPVVNKANAGLDSFEKKAESSHGKVIRITDQTRSSIQRLIASLEKQ
Ga0187859_1053076413300018047PeatlandMADQAERVILEAEDQVTPIVDKANAGLDSFEKKAESSHGKVIRISDQTRTSVQRLIASLEKQA
Ga0187770_1061409513300018090Tropical PeatlandMGDQAERVVLEAEDLVTPVTTKANSSLEGFENKAESVHGKVVRITDQTRNSVQRLIASMEKQ
Ga0187770_1160162023300018090Tropical PeatlandMGDQAERVVLEAEDLVTPVIGQANASMGSFEKQTESTHGKVVRITDQTRTSIQRLISSLEKQADMYG
Ga0187770_1164184623300018090Tropical PeatlandMADQAERVILEAEETPVLESVGRANTALDSFEKKSESSHAKVIRISDQTRSSVQRLIASLEKQAETYGKSGVDRLIAQRDQLLQRY
Ga0182022_121778323300019785FenMADQAERVILEAEDQVTPITDKANAALDGFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQPRPTVRAAWTG
Ga0182022_130314243300019785FenMADQAERVILEAEDMVTPVVAQANAGLDAFEKKAESAHGKVIRITDQTRTSIQRLIASLEKQAEVYGKSGVDR
Ga0182028_105786913300019788FenMADQAERVILEAEDQVTPITDKANAALDGFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYGKSGVDRLITQRDQLL
Ga0182028_128953023300019788FenMADQSERVILEAEDQVTPITDKANAALDGFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYGKAAWTG
Ga0213852_120890523300021858WatershedsMADQAERVILEAEDQVTPITDKANAALDGFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYGKSGVDRLITQRDQLLQRYN
Ga0213852_122136513300021858WatershedsMADQAERVILEAEDQVTPITDKANAALDSFEKKAESSHAKVIRISDQTRSSVQRLIASLEKQAETYGKSGVDRLITQRDQ
Ga0213851_126097723300021860WatershedsMADQAERVILEAEDQVTPITDKANAALDGFEKKAESSHSKVIRISDQTRSSVHRLISSLEKQAE
Ga0213853_1004028623300021861WatershedsMADQAERVILEAEETPVLESVGRANTALDSFEKKSEASHAKVIRISDQTRSSVQRLIASLEKQAET
Ga0213853_1060704513300021861WatershedsMADQAERVILEAEETPVLEAVGRANTALDSFEKKSESSHGKVIRISDQTRTSVQRLVASLEKQAETYGKSGV
Ga0224542_102591713300022516SoilMADQAERVILEAEDNVTPIVARANAGLESFEKKAESSHGKVIRITDQTRTSIQRLIASLEKQAEVYGKSGVDRLISQR
Ga0212088_1067194213300022555Freshwater Lake HypolimnionMADQAERVILEAEDLVTPVVDKANAGLDSFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYG
Ga0224557_127543523300023101SoilMPQAERVILEAEDEVTPVVNKANAGLDSFEKKAESSHGKVIRITDQTRSSIQRLITSLEKQAETYGKSGVDRLIAQRDSLLQR
Ga0208820_105930633300025576PeatlandMGDQAEKIILEAEDQVTPIVANANAGLDSFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYGKSGVDKLVAQRDQLLQRYNRE
Ga0247846_106269723300026474SoilMADQAERVILEAEDQVTPVVGQANAGLDSFEKKAESAHGKVIRITDQTRSSIQRLIASLEKQAETYGKS
Ga0209908_1007996113300027745Thawing PermafrostMGDQAERVVLEAEDQVSPVVNQANSSLDSFEKKATTAHDKVVRITDQTRTSVQRLISSLEKQADTFGKTGVD
Ga0209415_1090094123300027905Peatlands SoilMADQAERVILEAEDLVTPVVDKANAGLDSFEKKAESSHSKVIRISDQTRSSVQRLIASLEKQAETYGKSGVD
Ga0209006_1079348013300027908Forest SoilMADQAERVILEAEDQVSPVVDKANAGLDRFEKQAESSHGKVIRISDQTRSSVQRLITSLEKQ
Ga0302145_1028164523300028565BogMADQAERVILEAEETPVLEAVGRANTALDSFEKKSESSHGKVIRISDQTRSSVQRLVASLEKQAETYGKSGVDKLISQRDQ
Ga0302189_1012683013300028788BogMADQAERVILEAEETPVLEAVGRANTALDSFEKKSESSHGKVIRISDQTRTSVQRLVASLEKQAE
Ga0246001_107666623300029889PeatMADQAERVILEAEDQVTPVVEKANAGLDSFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYGKSGVERLITQRDQLLQL
Ga0311362_1078790723300029913BogMADQAERVILEAEDQVTPITDKANAALDGFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQA
Ga0311358_1098351723300029915BogMADQAERVILEAEDQVTPITDKANAALDGFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYGKSGVDRL
Ga0311363_1114564913300029922FenMADQAERVILEAEETPVLESVGRANTALDSFEKKSESSHGKVIRISDQTRTSVQRLVASLEKQAETYGKSGVDKLISQRDQLLQ
Ga0311363_1155359123300029922FenMADQAERVILEAEDQVTPITDKANAALDGFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYGKSGVDR
Ga0311340_1104738213300029943PalsaMADQAERVILEAEDQVTPITDKANAALDGFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYGKSGVDRLI
Ga0311343_1136042123300029953BogMADQAERVILEAEETPVLEAVGRANTALDSFEKKSESSHGKVIRISDQTRTSVQRLVASLEKQAETYG
Ga0311332_1038454313300029984FenMADQAERVILEAEDQVTPVVGQANAGLDSFEKKAESAHGKVIRITDQTRTSIQRLIASLEKQAEVYGKSGVDRLISQRDQL
Ga0311338_1104034613300030007PalsaMADQAERVILEAEDTPVLEAVGRANTALDSFEKKSESSHGKVIRIWDQTRSSVQRLIASLEKQAETYGKSGVEKLISQRDQLLQRYSREP
Ga0311338_1208662313300030007PalsaMADQAERVILEAEDQVTPITDKANAALDGFEKKAESSHGKVIRISDQTRTSVQRLIASL
Ga0302270_1065233113300030011BogMGDQAERVILEAEDQVTPVVNKANAGLDSFEKKAESSNLKVIRITDQTRTSIQRLITSLEKQAEMYGKSGVDRLIAQ
Ga0311344_1102080323300030020BogMGDQAERVILEAEDQVTPVVNKANAGLDSFEKKAESSNLKVIRITDQTRTSIQRLITSLE
Ga0302183_1026563623300030509PalsaMADQAERVILEAEDTPVLEAVGRANTALDSFEKKSESSHGKVIRIWDQTRSSVQRLIASLEKQAETYGKSGVEKLISQRD
Ga0302275_1039328623300030518BogMGDQAERVILEAEDQVTPVVNKANAGLDSFEKKAESSNLKVIRITDQTRTSIQRLITSLEKQAEMYGKSGVDRLIAQRDSLLQRYAKEPPA
Ga0302193_1058222423300030519BogMADQAERVILEAEETPVLEAVGRANTALDSFEKKSESSHGKVIRISDQTRSSVQRLVASLEKQAETYGKSGVDKLISQRDQLLQR
Ga0311345_1042701313300030688BogMPQAERVILEAEDEVTPVVNKANAGLDSFEKKAESSHGKVIRITDQTRSSIQRLITSLEKQAETYGKSGVDRLIAQRDSLLQ
Ga0302314_1137040013300030906PalsaMADQAERVILEAEETPVLESVGRANTALDSFEKKSESSHGKVIRISDQTRTSVQRLVASLEKQAETYGKSGVDKLISQRDQLLQR
Ga0302323_10316400323300031232FenMADQAERVILEAEDQVTPVVGQANAGLDSFEKKAESAHGKVIRITDQTRSSIQRLIASLEKQAEVYGKSGAERLISQRDQ
Ga0302323_10342571523300031232FenMADQAERVILEAEDMVTPVVAQANAGLDSFEKKAESAHGKVIRITDQTLSSIQRLIASL
Ga0302324_10044388933300031236PalsaMADQAERVILEAEDQVTPIVDKANAGLDSFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAET
Ga0302324_10097051733300031236PalsaMADQAERVILEAEETPVLESVGRANTALDSFEKKSESSHGKVIRISDQTRTSVQRLVASLEKQAET
Ga0302324_10186239313300031236PalsaMADQVERVILEAEDQVTPITDKANASLDSFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYGKSGVDRLIVQRDSLLQRYAKEP
Ga0302324_10229750623300031236PalsaMADQAERVILEAEDQVTPVVDRANAGLDSFEKKAESSHGKVIRISDQTRTSVQRLITSL
Ga0265339_1031620513300031249RhizosphereMADQAERVILEAEDEVTPVVNKANSGLDSFEKKAESSHGKVIRITDQTRSSIQRLIASLEKQAETYGKSGVDRLIAQRD
Ga0302318_1022431433300031258BogMGDQAERVILEAEDQVTPVVNKANAGLDSFEKKAESSNLKVIRITDQTRTSIQRLITSLEKQAEMYGKSGVDRLIAQR
Ga0302140_1091312423300031261BogMADQAERVILEAEETPVLEAVGRANTALDSFEKKSESSHGKVIRISDQTRSSVQRLVASLEKQAETYGKSGVDKLISQRDQLLQRYSREPQAI
Ga0302140_1107569613300031261BogMADQAERVILEAEETPVLESVGRANTALDSFEKKSESSHGKVIRISDQTRTSVQRLVASLEKQ
Ga0302320_1009304213300031524BogMPQAERVILEAEDEVTPVVNKANAGLDSFEKKAESSHGKVIRITDQTRSSIQRLITSLEKQAETYGKS
Ga0310686_11156380623300031708SoilMADQAERVILEAEDQVSAVVDKANAGLDRFEKQAESSHGKVIRISDQTRTSVQRLISSLEKQAETYGKSGVDRLITQRDQLLQRYNR
Ga0310686_11330908013300031708SoilMADQAERVILEAEDQVSPVVDKANAGLDRFEKQAESSHGKVIRISDQTRSSVQRLISSLEKQAETYGKSGVDRLITQRDQLLQRYNR
Ga0302321_10024858853300031726FenMADQAERVILEAEDQVTPVVGQANAGLDSFEKKAESAHGKVIRITDQTRSSIQRLIASLEKQAEVYGKSGAD
Ga0302319_1032395343300031788BogMPQAERVILEAEDEVTPVVNKANAGLDSFEKKAESSHGKVIRITDQTRSSIQRLITSLEKQAETYGKSGVDRLIAQR
Ga0302319_1037890413300031788BogMADQAERVILEAEDQVTPITDKANAALDGFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYGKSGVDRLIT
Ga0302319_1162222923300031788BogMADQAERVILEAEETPVLESVGRANTALDSFEKKSESSHGRVIRISDQTRTSVQRLVASLEKQAETYGKSGVDKLISQRDQL
Ga0302319_1184775623300031788BogMADQVERVVLEAEDQVTPITDKANASLDSFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETY
Ga0311301_1144458213300032160Peatlands SoilMGDQAEKVVLEAEDQVSPVVDRANAGLERFEQKAESAHGKVIRITDQTRSSVQRLIASLEKQAETYGKS
Ga0311301_1148247423300032160Peatlands SoilMGDQAERVVLEAEDQVSPVVDKANAGLDSFEKKAESSHGKVIRITDQTRSSVQRLIASLEKQAETYGKSGVDRLVVQ
Ga0311301_1228645623300032160Peatlands SoilMADQAERVILEAEDEVTPVVNKANAGLDSFEKKAESSHGKVIRITDQTRSSIQRLIASLEKQAETYGKSG
Ga0335085_1078584213300032770SoilMADQAERVILEAEDQVSPVVDKANAGLDSFEKKAESSHGKVIRSSDQTRSSVQRLIASLEKQA
Ga0335085_1145614713300032770SoilMSDQAERIILEAEETPVLESVGRANAALDSFEKKSEATHGKVIRISDQTRSSVQRLIASLEKQAETYG
Ga0335079_1124429323300032783SoilMADQAERVILEAEETPVLESVGRANTALDSFEKKSEASHAKVIRISDQTRSSVQRLIASLEKQAETYGKSGVERLITQRDQLLQR
Ga0335079_1130538213300032783SoilMADQAERVILEAEDQVTPVVDKANAGLDSFEKKAESSHAKVIRISDQTRSSVQRLIASLEKQAETYGKSG
Ga0335079_1157400413300032783SoilMADQAERVVLEAEDQVNPVVDKANAGLDSFEKKAESAHGKVIRITDQTRSSVQRLIASLEKQAETYGK
Ga0335078_10026822163300032805SoilMADQAERVILEAEETPVLESVGRANTALDSFEKKSEASHAKVIRISDQTRSSVQRLIASLEKQAETYGKSGVERLI
Ga0335078_1008191013300032805SoilMADQAERVILEAEDQVTPVVDKANASLDSFEKKAESSHSKVIRISDQTRSSVQRLIASLEKQAETYGKSGVDRLIT
Ga0335078_1015290723300032805SoilMADQAERVILEAEDEVSPVVKKANAGLDSFEEKAESSHGKVIQITDQTRSSIQRLIASLEKQAEIYG
Ga0335078_1088730913300032805SoilMSDQAERVILEAEDEVTPVVGKANAGLVSFEKQAESSHGKVIRITDQTRSSVQRLISSLEKQAETYGKSGVEKLV
Ga0335078_1139571423300032805SoilMGDQAERVVLEAEDLVTPVTTKANSSLEGFENKAESVHGKVVRITDQTRNSVQRLIASMEKQAETYGKSGVERLISQRDQLLQRY
Ga0335078_1151770413300032805SoilMADQAERVVLEAEDQVNPVVDKANAGLDSFEKKAESAHGKVIRITDQTRSSVQRLIASLEKQAETYGKSGVERL
Ga0335080_1113008923300032828SoilMADQAERVILEAEDQVTPVVDKANAGLDSFEKKAESSHAKVIRISDQTRSSVQRLIASLEKQAETYGKSGVDRL
Ga0335070_1183697413300032829SoilMGDQAEKVILEAEDQVSPAVDQANSSLDGFEKKAESSHAKVIRITDQTRSSVQRLI
Ga0335081_1033657443300032892SoilMADQAERVVLEAEDQVNPIVDKANAGLERFENKAESAHGKVIRITDQTRTSIQRLIASLEKQAETYGKS
Ga0335081_1107871913300032892SoilMPDQAERVILEAEDQVNPVVDKANAGLDRFEKKATDTHTRVTRITDQTRSSIQRLITTLERQAEVYGKTGVEKLITQRD
Ga0335074_1080130013300032895SoilMADKAERVVLEADDQVTPITSKANASLENFERKATSSGEKIVRINDQTRTSVQRLIASLEKQTETYGKSGVEKLIAQRDQLLQRYQRE
Ga0335077_1004377213300033158SoilMADQAERVVLEAEDQVNPIVDKANAGLERFENKAESAHGKVIRITDQTRTSIQRLIASLEKQAETYGKSGVERLIAQRDQLLQRY
Ga0335077_1042398213300033158SoilMADQAERVILEAEDQVTPIVDKANAGLDRFEKQAESSHGKVIRISDQTRSSVQRLISSLEKQAETYGKSGVDRLITQRDQ
Ga0326728_1031309833300033402Peat SoilMADQAERVILEAEDQVTPVVGQANAGLDSFEKKAESAHGKVIRITDQTRSSIQRLIAS
Ga0326728_1051009813300033402Peat SoilMADQAERVILEAEDQVTPVVGQANAGLDSFEKKAESTHGKIIRITDQTRSSIQRLIASLEKQAEVYGKSGAERLISQRDQLL
Ga0326728_1057625413300033402Peat SoilMADQAERVILEAEDNVTPITSKANSALDSFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAEVYGKSGVDRLIAQRDQLLQRYA
Ga0326728_1062916613300033402Peat SoilMADQAERIILEAEDEVTPVVNKANAGLDSFEKKAESSHGKVIRITDQTRSSIQRLIAS
Ga0326728_1104515323300033402Peat SoilMPEAERVILEAEDQVTPITEKANASLGRFEEKAESAHGKVIRITDQTRTSIQRLISSLEKQAETYGKSGVEKLITQ
Ga0326727_1060821523300033405Peat SoilMPAAEKVILEAEDTTAGPVRSANQNLQNFERQAEGTHGKVIRITDQTRTSIQRLISSLEKQAETYGKSGVDRLIAQRDSLLARYAKEPQA
Ga0371490_106452733300033561Peat SoilMADQAERVILEAEDQVTPIVDKANAGLDSFEKKAESSHGKVIRISDQTRTSVQRLIASLEKQ
Ga0334804_118882_469_6723300033818SoilMADQAERVILEAEDQVTPITDKANAALDGFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYGK
Ga0334790_160244_1_2373300033887SoilMADQAERVILEAEDTPVLESVGRANTALDSFEKKSESSHGKVIRISDQTRTSVQRLVASLEKQAETYGKSGVDKLISQR
Ga0334811_144963_3_2063300033891SoilMADQAERVILEAEDQVTPVVGQANAGLDSFEKKAESAHGKVIRITDQTRSSIQRLIASLEKQAEVYGK
Ga0334827_245738_3_2513300034065SoilMGDQAERVILEAEDQVTPVVNKANAGLDSFEKKAESSNLKVIRITDQTRTSIQRLITSLEKQAEMYGKSGVDRLIAQRDSLLQ
Ga0326724_0376927_2_2143300034091Peat SoilMADQAERVILEAEDQVTPVVGQANAGLDSFEKKAESAHGKVIRITDQTRTSIQRLIASLEKQAEVYGKSGA
Ga0326724_0575319_1_2643300034091Peat SoilMGDQAERVVLEAEDQVTPVVGQANAGLDSFEKKAESAHGKVIRITDQTRSSVQRLIASLEKQAETYGKSGVDRLISQRDQLLQRYSRE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.