Basic Information | |
---|---|
Family ID | F026865 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 196 |
Average Sequence Length | 43 residues |
Representative Sequence | VSVATGISPKDLLEVDPAIYSAIKAILQERYYNNKKATVRRK |
Number of Associated Samples | 124 |
Number of Associated Scaffolds | 196 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 20.92 % |
% of genes near scaffold ends (potentially truncated) | 48.98 % |
% of genes from short scaffolds (< 2000 bps) | 67.86 % |
Associated GOLD sequencing projects | 115 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (95.408 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (23.980 % of family members) |
Environment Ontology (ENVO) | Unclassified (74.490 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (72.959 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.62% β-sheet: 0.00% Coil/Unstructured: 52.38% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 196 Family Scaffolds |
---|---|---|
PF05135 | Phage_connect_1 | 4.59 |
PF05065 | Phage_capsid | 3.57 |
PF13539 | Peptidase_M15_4 | 3.06 |
PF09250 | Prim-Pol | 2.04 |
PF03354 | TerL_ATPase | 1.02 |
PF04860 | Phage_portal | 1.02 |
PF01370 | Epimerase | 0.51 |
PF04586 | Peptidase_S78 | 0.51 |
COG ID | Name | Functional Category | % Frequency in 196 Family Scaffolds |
---|---|---|---|
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 3.57 |
COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 1.02 |
COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.51 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.98 % |
Unclassified | root | N/A | 1.02 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002408|B570J29032_109203962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
3300002408|B570J29032_109316608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
3300002408|B570J29032_109339603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
3300002408|B570J29032_109470769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
3300002408|B570J29032_109926402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2870 | Open in IMG/M |
3300002471|metazooDRAFT_1424081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300002835|B570J40625_100013215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14714 | Open in IMG/M |
3300003277|JGI25908J49247_10017289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2178 | Open in IMG/M |
3300003277|JGI25908J49247_10024487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1768 | Open in IMG/M |
3300003277|JGI25908J49247_10133287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300003393|JGI25909J50240_1015829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1784 | Open in IMG/M |
3300003393|JGI25909J50240_1025329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1336 | Open in IMG/M |
3300003490|JGI25926J51410_1000013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19085 | Open in IMG/M |
3300003491|JGI25924J51412_1004745 | All Organisms → cellular organisms → Bacteria | 2635 | Open in IMG/M |
3300004054|Ga0063232_10027652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1395 | Open in IMG/M |
3300004096|Ga0066177_10478536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300004096|Ga0066177_10546397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300004128|Ga0066180_10100384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1063 | Open in IMG/M |
3300004240|Ga0007787_10022319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2669 | Open in IMG/M |
3300005517|Ga0070374_10044001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2319 | Open in IMG/M |
3300005517|Ga0070374_10334579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
3300005527|Ga0068876_10169779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1276 | Open in IMG/M |
3300005527|Ga0068876_10479925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
3300005528|Ga0068872_10026269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3838 | Open in IMG/M |
3300005528|Ga0068872_10564573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
3300005581|Ga0049081_10001260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9606 | Open in IMG/M |
3300005581|Ga0049081_10085722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1180 | Open in IMG/M |
3300005581|Ga0049081_10088158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1162 | Open in IMG/M |
3300005582|Ga0049080_10015515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2650 | Open in IMG/M |
3300005582|Ga0049080_10132124 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 841 | Open in IMG/M |
3300005584|Ga0049082_10035388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1749 | Open in IMG/M |
3300005662|Ga0078894_10955909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
3300005805|Ga0079957_1022632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4339 | Open in IMG/M |
3300005805|Ga0079957_1225478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 886 | Open in IMG/M |
3300005805|Ga0079957_1229178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 876 | Open in IMG/M |
3300005805|Ga0079957_1338278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
3300006639|Ga0079301_1012050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3190 | Open in IMG/M |
3300006802|Ga0070749_10032571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3240 | Open in IMG/M |
3300006805|Ga0075464_10067197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2013 | Open in IMG/M |
3300006805|Ga0075464_10137072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1430 | Open in IMG/M |
3300006805|Ga0075464_10249699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1061 | Open in IMG/M |
3300006805|Ga0075464_10518676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
3300006805|Ga0075464_10870286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
3300007363|Ga0075458_10133888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
3300007734|Ga0104986_1646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20828 | Open in IMG/M |
3300007734|Ga0104986_1652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21064 | Open in IMG/M |
3300008055|Ga0108970_11260158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6329 | Open in IMG/M |
3300008114|Ga0114347_1005814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8507 | Open in IMG/M |
3300008264|Ga0114353_1018918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9390 | Open in IMG/M |
3300008266|Ga0114363_1017442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3220 | Open in IMG/M |
3300008266|Ga0114363_1030583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2277 | Open in IMG/M |
3300008266|Ga0114363_1053832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1590 | Open in IMG/M |
3300008266|Ga0114363_1077117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1251 | Open in IMG/M |
3300008266|Ga0114363_1081540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1205 | Open in IMG/M |
3300008266|Ga0114363_1132527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 850 | Open in IMG/M |
3300008266|Ga0114363_1235375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300008450|Ga0114880_1013807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3904 | Open in IMG/M |
3300008450|Ga0114880_1044760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1901 | Open in IMG/M |
3300008450|Ga0114880_1103436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1097 | Open in IMG/M |
3300008450|Ga0114880_1104626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1088 | Open in IMG/M |
3300008450|Ga0114880_1150294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 839 | Open in IMG/M |
3300008450|Ga0114880_1153683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
3300008450|Ga0114880_1203682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
3300008450|Ga0114880_1259791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
3300009068|Ga0114973_10128395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1422 | Open in IMG/M |
3300009068|Ga0114973_10295714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 864 | Open in IMG/M |
3300009075|Ga0105090_10097935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1836 | Open in IMG/M |
3300009085|Ga0105103_10858051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
3300009152|Ga0114980_10000845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21868 | Open in IMG/M |
3300009155|Ga0114968_10009338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7106 | Open in IMG/M |
3300009155|Ga0114968_10030084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3647 | Open in IMG/M |
3300009158|Ga0114977_10685912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300009160|Ga0114981_10661446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
3300009163|Ga0114970_10095855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1842 | Open in IMG/M |
3300009163|Ga0114970_10434125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
3300009168|Ga0105104_10377287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
3300009181|Ga0114969_10457377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
3300009183|Ga0114974_10140187 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1520 | Open in IMG/M |
3300009183|Ga0114974_10174532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1329 | Open in IMG/M |
3300010160|Ga0114967_10011501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6600 | Open in IMG/M |
3300010160|Ga0114967_10024896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4114 | Open in IMG/M |
3300010354|Ga0129333_10125300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2365 | Open in IMG/M |
3300010885|Ga0133913_10128514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6784 | Open in IMG/M |
3300010885|Ga0133913_10822742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2418 | Open in IMG/M |
3300010885|Ga0133913_13119298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1099 | Open in IMG/M |
3300011113|Ga0151517_1466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14850 | Open in IMG/M |
3300012012|Ga0153799_1003733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3911 | Open in IMG/M |
3300012725|Ga0157610_1095686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10089218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2210 | Open in IMG/M |
(restricted) 3300013130|Ga0172363_10627571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10093085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2312 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10025056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6629 | Open in IMG/M |
(restricted) 3300013133|Ga0172362_10186098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1517 | Open in IMG/M |
3300013372|Ga0177922_10221300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1407 | Open in IMG/M |
3300013372|Ga0177922_11221679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2295 | Open in IMG/M |
3300017723|Ga0181362_1051301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 857 | Open in IMG/M |
3300017736|Ga0181365_1123240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
3300017761|Ga0181356_1244771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
3300017761|Ga0181356_1246924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
3300017774|Ga0181358_1026040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2308 | Open in IMG/M |
3300017774|Ga0181358_1066372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1337 | Open in IMG/M |
3300017777|Ga0181357_1069320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1358 | Open in IMG/M |
3300017778|Ga0181349_1098800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1094 | Open in IMG/M |
3300017778|Ga0181349_1182594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
3300017780|Ga0181346_1051400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1667 | Open in IMG/M |
3300017784|Ga0181348_1225624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
3300017784|Ga0181348_1318836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
3300017788|Ga0169931_10199785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1706 | Open in IMG/M |
3300017788|Ga0169931_10578262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
3300018420|Ga0181563_10570545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
3300019784|Ga0181359_1000210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12268 | Open in IMG/M |
3300019784|Ga0181359_1003090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5015 | Open in IMG/M |
3300019784|Ga0181359_1015667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2807 | Open in IMG/M |
3300019784|Ga0181359_1079963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1226 | Open in IMG/M |
3300019784|Ga0181359_1221545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
3300020048|Ga0207193_1173120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1759 | Open in IMG/M |
3300020161|Ga0211726_10727404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 892 | Open in IMG/M |
3300020183|Ga0194115_10128988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1354 | Open in IMG/M |
3300020183|Ga0194115_10184764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1046 | Open in IMG/M |
3300020506|Ga0208091_1000694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5923 | Open in IMG/M |
3300020506|Ga0208091_1006054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1614 | Open in IMG/M |
3300020506|Ga0208091_1014033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 967 | Open in IMG/M |
3300020536|Ga0207939_1020206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 938 | Open in IMG/M |
3300020549|Ga0207942_1000640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7915 | Open in IMG/M |
3300020551|Ga0208360_1002245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3438 | Open in IMG/M |
3300020556|Ga0208486_1031814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
3300021962|Ga0222713_10143492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1656 | Open in IMG/M |
3300022190|Ga0181354_1116570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
3300022190|Ga0181354_1124903 | Not Available | 824 | Open in IMG/M |
3300022190|Ga0181354_1243332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300022407|Ga0181351_1083781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1265 | Open in IMG/M |
3300022407|Ga0181351_1227729 | Not Available | 599 | Open in IMG/M |
3300022752|Ga0214917_10006121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12618 | Open in IMG/M |
3300023174|Ga0214921_10002785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 27791 | Open in IMG/M |
3300023174|Ga0214921_10586674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300023179|Ga0214923_10002770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 22781 | Open in IMG/M |
3300025896|Ga0208916_10003226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6575 | Open in IMG/M |
3300027581|Ga0209651_1010952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2963 | Open in IMG/M |
3300027679|Ga0209769_1022367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2225 | Open in IMG/M |
3300027689|Ga0209551_1123748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
(restricted) 3300027728|Ga0247836_1193965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
(restricted) 3300027728|Ga0247836_1254771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
3300027734|Ga0209087_1038132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2259 | Open in IMG/M |
3300027754|Ga0209596_1023169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3663 | Open in IMG/M |
3300027754|Ga0209596_1077270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1635 | Open in IMG/M |
3300027759|Ga0209296_1068009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1796 | Open in IMG/M |
3300027770|Ga0209086_10158712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1085 | Open in IMG/M |
3300027785|Ga0209246_10071408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1349 | Open in IMG/M |
3300027785|Ga0209246_10170843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 854 | Open in IMG/M |
3300027892|Ga0209550_10235175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1222 | Open in IMG/M |
3300027963|Ga0209400_1032075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2910 | Open in IMG/M |
(restricted) 3300027970|Ga0247837_1053180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2381 | Open in IMG/M |
(restricted) 3300028114|Ga0247835_1032263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2550 | Open in IMG/M |
3300028394|Ga0304730_1247756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
(restricted) 3300028553|Ga0247839_1254544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
(restricted) 3300028557|Ga0247832_1041552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2572 | Open in IMG/M |
(restricted) 3300028569|Ga0247843_1032669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3439 | Open in IMG/M |
(restricted) 3300028569|Ga0247843_1170499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 866 | Open in IMG/M |
(restricted) 3300028571|Ga0247844_1038080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3081 | Open in IMG/M |
(restricted) 3300028571|Ga0247844_1241551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
3300029930|Ga0119944_1020789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 892 | Open in IMG/M |
3300031707|Ga0315291_11094740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
3300031746|Ga0315293_10397025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1086 | Open in IMG/M |
3300031758|Ga0315907_10251705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1465 | Open in IMG/M |
3300031787|Ga0315900_10932223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
3300031857|Ga0315909_10439604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 921 | Open in IMG/M |
3300031857|Ga0315909_10540907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
3300031857|Ga0315909_10834967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300031951|Ga0315904_10107619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2915 | Open in IMG/M |
3300031951|Ga0315904_10495901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1078 | Open in IMG/M |
3300031963|Ga0315901_10340306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1226 | Open in IMG/M |
3300032093|Ga0315902_10329060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1426 | Open in IMG/M |
3300032116|Ga0315903_10744672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
3300032156|Ga0315295_10751198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 982 | Open in IMG/M |
3300032156|Ga0315295_11642467 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
3300032173|Ga0315268_12263624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300032342|Ga0315286_10888736 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 895 | Open in IMG/M |
3300032401|Ga0315275_10738937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1093 | Open in IMG/M |
3300033521|Ga0316616_100595449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1297 | Open in IMG/M |
3300033980|Ga0334981_0415772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
3300034012|Ga0334986_0020163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4559 | Open in IMG/M |
3300034062|Ga0334995_0132967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1823 | Open in IMG/M |
3300034064|Ga0335001_0127566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1447 | Open in IMG/M |
3300034071|Ga0335028_0581232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
3300034092|Ga0335010_0674064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
3300034095|Ga0335022_0012275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 5498 | Open in IMG/M |
3300034095|Ga0335022_0367342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
3300034101|Ga0335027_0174501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1552 | Open in IMG/M |
3300034104|Ga0335031_0836413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
3300034106|Ga0335036_0001789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19015 | Open in IMG/M |
3300034106|Ga0335036_0010181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7715 | Open in IMG/M |
3300034106|Ga0335036_0276092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1127 | Open in IMG/M |
3300034118|Ga0335053_0169216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1460 | Open in IMG/M |
3300034200|Ga0335065_0149292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1556 | Open in IMG/M |
3300034283|Ga0335007_0003682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12308 | Open in IMG/M |
3300034283|Ga0335007_0275235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1118 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 23.98% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 18.88% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 12.24% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.10% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.10% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.59% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.59% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.08% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.57% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.57% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.06% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.06% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 2.04% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.53% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.51% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.51% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.51% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.51% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.51% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.51% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.51% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.51% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.51% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002471 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAY 2013 | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
3300004128 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2) | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011113 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Sep | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012725 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J29032_1092039622 | 3300002408 | Freshwater | VSVATGISPKDLLEVDPAIYSAIKAILQEKHYNTKKATVRRK* |
B570J29032_1093166082 | 3300002408 | Freshwater | VAVSTGISPKDLLEVDPAIYSAIKAILQERHYQNKKATVRRK* |
B570J29032_1093396032 | 3300002408 | Freshwater | VSVATGISPKDLLEVDPAIYAAIKAILQERQFKNKKATVRRK* |
B570J29032_1094707692 | 3300002408 | Freshwater | VSVATGISPKDLLEVDPAIYSAIKAILQERHYNSKKATVRRK* |
B570J29032_1099264023 | 3300002408 | Freshwater | VAVATGISPKDLLEVDPAIYLAIKAILQERHYNNKKATVRRK* |
metazooDRAFT_14240812 | 3300002471 | Lake | VATGISPKDLLEVDPAIYSAIKAILQEKYYQNKKATVRRK* |
B570J40625_10001321525 | 3300002835 | Freshwater | VAVATGISPKDLLEVDPAIYAAIKAILQERHYNNKKATVRRK* |
JGI25908J49247_100172891 | 3300003277 | Freshwater Lake | VSVATGISPKDLLEVDPAIYLAIKAILQERSQQSKTMRRK* |
JGI25908J49247_100244874 | 3300003277 | Freshwater Lake | VSVATGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR* |
JGI25908J49247_101332872 | 3300003277 | Freshwater Lake | VSVRTGISPKDLLEVDPAVYMAIKAILXEQDAKTKGTVRRR* |
JGI25909J50240_10158291 | 3300003393 | Freshwater Lake | VSVRTGISPKDLLEVDPAVYMAIKAILQEQDAKTKGTVRRR* |
JGI25909J50240_10253293 | 3300003393 | Freshwater Lake | SVSVATGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR* |
JGI25926J51410_100001321 | 3300003490 | Freshwater Lake | VSVATGISPKDLLEVDPAIYSAIKAILQERYYNNKKATVRRK* |
JGI25924J51412_10047453 | 3300003491 | Freshwater Lake | VATGISPKDLLEVDPAIYSAIKAILQERYYNNKKATVRRK* |
Ga0063232_100276525 | 3300004054 | Freshwater Lake | VAVATGISPKDLLEVDPAIYLAIKAILQERQYNNKKATVRRK |
Ga0066177_104785362 | 3300004096 | Freshwater Lake | VATGISPKDLLEVDPAIYLAIKAILQEKYYNNKKATVRRK* |
Ga0066177_105463972 | 3300004096 | Freshwater Lake | VATGISPKDLLEVDPAIYLAIKAILQERQYNNKKATVRRK* |
Ga0066180_101003841 | 3300004128 | Freshwater Lake | VAVATGISPKDLLEVDPAIYLAIKAILQERQYNNKKATVRR |
Ga0007787_100223191 | 3300004240 | Freshwater Lake | VAVATGISPKDLLEVDPAIYLAIKAILQERNYNNKKATVRR |
Ga0070374_100440015 | 3300005517 | Freshwater Lake | VAVATGISPKDLLEVDPAIYLAIKAILQERQYNNKKATVRRK* |
Ga0070374_103345792 | 3300005517 | Freshwater Lake | ISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR* |
Ga0068876_101697793 | 3300005527 | Freshwater Lake | SPKDLLEVDPAIYSAIKAILQEKYYNNKKATVRRK* |
Ga0068876_104799251 | 3300005527 | Freshwater Lake | VSVATGISPKDLLEVDPAIYSAIKAILQERSYNNKKATVRRK* |
Ga0068872_100262693 | 3300005528 | Freshwater Lake | VATGISPKDLLEVDPAIYAAIKAILQERHYNNKKATVRRK* |
Ga0068872_105645731 | 3300005528 | Freshwater Lake | VSVATGISPKDLLEVDPAIYSAIKAILQERYYNNKKATVRR |
Ga0049081_1000126013 | 3300005581 | Freshwater Lentic | VSVATGISPKDLLEVDPAIYSAIKAILQEKYYNNKKATVRRK* |
Ga0049081_100857221 | 3300005581 | Freshwater Lentic | VSVATGISPKDLLEVDPAIYLAIKAILQERAQQSKTMRRK* |
Ga0049081_100881583 | 3300005581 | Freshwater Lentic | SIYEVASVSVATGISPKDLLEVDPAIYLAIKAILQEKYYNNKKATVRRK* |
Ga0049080_100155153 | 3300005582 | Freshwater Lentic | HGQIWEIASVSVATGISPKDLLEVDPAIYLAIKAILQERSQQSKTMRRK* |
Ga0049080_101321241 | 3300005582 | Freshwater Lentic | SPKDLLEVDPAIYSAIKAILQERYYNNKKATVRRK* |
Ga0049082_100353882 | 3300005584 | Freshwater Lentic | VSVRTGISPKDLLEVDPAIYMAIKAILIEQDAKTKGTVRRR* |
Ga0078894_109559092 | 3300005662 | Freshwater Lake | VAVSTGISPKDLLEVDPAIYSAIKAILQERYYNNKKATVRRK* |
Ga0079957_10226326 | 3300005805 | Lake | VSVRTGISPKDLLEVDPAIYMAIKAILVEQDAKTKGTVRRR* |
Ga0079957_12254781 | 3300005805 | Lake | IYEVATVSVATGISPKDLLEVDPAIYSAIKAILQERHYNSKKATVRRK* |
Ga0079957_12291781 | 3300005805 | Lake | VSVATGISPKDLLEVDPAIYAAIKAILQERTLNSKKATVRRK* |
Ga0079957_13382781 | 3300005805 | Lake | WIDRHGSIYEVATVSVATGISPKDLLEVDPAIYSAIKAILQERHYQSKKATVRRK* |
Ga0079301_10120506 | 3300006639 | Deep Subsurface | VATGISPKDLLEVDPAVYMAIKAILQERAKQTKTVRRR* |
Ga0070749_100325713 | 3300006802 | Aqueous | VATGISPKDLLEVDPAIYSAIKAILQEKYYNNKKATVRRK* |
Ga0075464_100671973 | 3300006805 | Aqueous | VAVATGISPKDLLEVDPAIYLAIKAILQERNYNNKKATVRRK* |
Ga0075464_101370723 | 3300006805 | Aqueous | VAVATGISPKDLLEVDPAIYSAIKAILQERHFNNKKATVRRK* |
Ga0075464_102496994 | 3300006805 | Aqueous | VSVATGISPKDLLEVDPAIYAAIKAILQERHYNNKKATVRRK* |
Ga0075464_105186763 | 3300006805 | Aqueous | VATGISPKDLLEVDPAIYSAIKAILQEKYFKNKKATVRRK* |
Ga0075464_108702862 | 3300006805 | Aqueous | VSVATGISPKDLLEVDPAIYLAIKAILQEKYYNNKKATVRRK* |
Ga0075458_101338883 | 3300007363 | Aqueous | VATGISPKDLLEVDPAIYSAIKAILQERHYNNKKATVRRK* |
Ga0104986_164613 | 3300007734 | Freshwater | MSVATGISPKDLLEVDPAIYMAIKAILQEQAAKTKGTVRRR* |
Ga0104986_165224 | 3300007734 | Freshwater | VSVATGISPKDLLEVDPAIYAAIKAILQEKYYNNKKATVRRK* |
Ga0108970_112601588 | 3300008055 | Estuary | VAVATGISPKDLLEVDPAIYSAIKAILQEKYYNNKKATVRRK* |
Ga0114347_100581412 | 3300008114 | Freshwater, Plankton | VAVSTGISPKDLLEVDPAIYSAIKAILQERHYNNKKATVRRK* |
Ga0114353_10189189 | 3300008264 | Freshwater, Plankton | VSVATGISPKDLLEVDPAIYSAIKAILQERSYNNKKATVRRKF* |
Ga0114363_10174421 | 3300008266 | Freshwater, Plankton | YEVATVSVATGISPKDLLEVDPAIYSAIKAILQEKYYNNKKATVRRK* |
Ga0114363_10305833 | 3300008266 | Freshwater, Plankton | VSVATGISPKDLLEVDPAIYAAIKAILQERYYNNKKATVRRK* |
Ga0114363_10538323 | 3300008266 | Freshwater, Plankton | VATGISPKDLLEVDPAIYSAIKAILQEKHYQNKKATVRRK* |
Ga0114363_10771173 | 3300008266 | Freshwater, Plankton | IYEVATVSVATGISPKDLLEVDPAIYSAIKAILQERSYNNKKATVRRK* |
Ga0114363_10815401 | 3300008266 | Freshwater, Plankton | ATVSVATGISPKDLLEVDPAIYAAIKAILQERHYNNKKATVRRK* |
Ga0114363_11325272 | 3300008266 | Freshwater, Plankton | VAVSTGISPKDLLEVDPAIYSAIKAILQERSFNNKKATVRRK* |
Ga0114363_12353751 | 3300008266 | Freshwater, Plankton | VATVSVATGISPKDLLEVDPAIYSAIKAILQERSFNNKKATVRRK* |
Ga0114880_10138071 | 3300008450 | Freshwater Lake | GSIYEVATVSVATGISPKDLLEVDPAIYSAIKAILQEKYYNNKKATVRRK* |
Ga0114880_10447603 | 3300008450 | Freshwater Lake | VATGISPKDLLEVDPAIYAAIKAILQERYYNNKKATVRRK* |
Ga0114880_11034361 | 3300008450 | Freshwater Lake | VATGISPKDLLEVDPAIYAAIKAILQERYYSNKKATVRRK* |
Ga0114880_11046263 | 3300008450 | Freshwater Lake | VATGISPKDLLEVDPAICSAIKAILQEKYYNNKKATVRRK* |
Ga0114880_11502941 | 3300008450 | Freshwater Lake | VATGISPKDLLEVDPAIYSAIKAILQERHYNSKKATVRRK* |
Ga0114880_11536832 | 3300008450 | Freshwater Lake | PKDLLEVDPAIYSAIKAILQERHYQNKKATVRRK* |
Ga0114880_12036822 | 3300008450 | Freshwater Lake | VAVATGISPKDLLEVDPAIYSAIKAILQEKHYNNKKATVRRK* |
Ga0114880_12597911 | 3300008450 | Freshwater Lake | EVATVSVATGISPKDLLEVDPAIYSAIKAILQERSFNNKKATVRRK* |
Ga0114973_101283952 | 3300009068 | Freshwater Lake | VAVATGISPKDLLEVDPAIYSAINAILQERHFNNKKATVRRK* |
Ga0114973_102957141 | 3300009068 | Freshwater Lake | RHGQIWEVAAISVSTGISPKDLLEVDPAVYMAIKAILQEQDAKSKGTVRRR* |
Ga0105090_100979352 | 3300009075 | Freshwater Sediment | VATGISPKDLLEIDPAIYSAIKAILQERHYQSKKATVRRK* |
Ga0105103_108580512 | 3300009085 | Freshwater Sediment | VSVATGISPKDLLEVDPAIYSAIKAILQERHYQSKKATVRRK* |
Ga0114980_100008453 | 3300009152 | Freshwater Lake | VATGISPKDLLEVDPAIYSAIKAILQERHFNNKKATVRRK* |
Ga0114968_1000933810 | 3300009155 | Freshwater Lake | VSVRTGISPKDLLEVDPAVYMAIKAILQEQDAKSKGTVRRR* |
Ga0114968_100300844 | 3300009155 | Freshwater Lake | VATGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVKRR* |
Ga0114977_106859122 | 3300009158 | Freshwater Lake | YEVATVSVATGISPKDLLEVDPAIYSAIKAILQERHFNNKKATVRRK* |
Ga0114981_106614462 | 3300009160 | Freshwater Lake | YEVASVSVATGISPKDLLEVDPAIYSAIKAILQERYYNNKKATVRRK* |
Ga0114970_100958553 | 3300009163 | Freshwater Lake | VATGISPKDLLEVDPAVYMAIKAILQEQATKTKGTVKRR* |
Ga0114970_104341251 | 3300009163 | Freshwater Lake | ISPKDLLEVDPAVYMAIKAILQEQDAKSKGTVRRR* |
Ga0105104_103772873 | 3300009168 | Freshwater Sediment | VATGISPKDLLEVDPAIYSAIKAILQERHYQSKKATVRRK* |
Ga0114969_104573771 | 3300009181 | Freshwater Lake | TGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR* |
Ga0114974_101401871 | 3300009183 | Freshwater Lake | ISPKDLLEVDPEIYLAIKAILQERSQQSKTMRRK* |
Ga0114974_101745321 | 3300009183 | Freshwater Lake | HGQIWEVAAISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR* |
Ga0114967_100115011 | 3300010160 | Freshwater Lake | KKWIDRHGSIYEVASVSVATGISPKDLLEVDPAIYSAIKAILQERYYNNKKATVRRK* |
Ga0114967_100248964 | 3300010160 | Freshwater Lake | VATGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR* |
Ga0129333_101253003 | 3300010354 | Freshwater To Marine Saline Gradient | VSVRTGISPKDLLEVDPAVYMAIKAILHEQDAKTKGTVRRR* |
Ga0133913_101285149 | 3300010885 | Freshwater Lake | ISPKDLLEVDPAIYSAIKAILQERHFNNKKATVRRK* |
Ga0133913_108227422 | 3300010885 | Freshwater Lake | VSVATGISPKDLLEVDPAIYMAIKAILQEQAAKTKGTVRRR* |
Ga0133913_131192981 | 3300010885 | Freshwater Lake | KWIDRHGQIYEIASVAVATGISPKDLLEVDPAIYLAIKAILQERNYNNKKATVRRK* |
Ga0151517_146625 | 3300011113 | Freshwater | VSVATGISPKDLLEVDPAIYSAIKAILQERHYQNKKATVRRK* |
Ga0153799_10037336 | 3300012012 | Freshwater | VAVATGISPKDLLEVDPAIYLAIKAILQEKYYNNKKATVRRK* |
Ga0157610_10956863 | 3300012725 | Freshwater | MSVSTGISPKDLLEVDPAVYMAIKAILQERAQATKTVRRK* |
(restricted) Ga0172367_100892183 | 3300013126 | Freshwater | VATGISPKDLLEVDPAVYMAIKAILQEKAKQTKTVRRR* |
(restricted) Ga0172363_106275712 | 3300013130 | Sediment | GISPKDLLEVDPAVYMAIKAILQERAKQTKTVRRR* |
(restricted) Ga0172373_100930853 | 3300013131 | Freshwater | MSVATGISPKDLLEIDPAIYLAIKAILQERAKETKTMRRR* |
(restricted) Ga0172372_1002505611 | 3300013132 | Freshwater | MSVATGISPKDLLEVDPAIYLAIKAILQERAKETKTMRRR* |
(restricted) Ga0172362_101860981 | 3300013133 | Sediment | HGQIWELASVSVATGISPKDLLEVDPAVYMAIKAILQEKAKQTKTVRRR* |
Ga0177922_102213001 | 3300013372 | Freshwater | GISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR* |
Ga0177922_112216793 | 3300013372 | Freshwater | VATGISPKDLLEVDPAIYMAIKAILQERAQATKTVRRK* |
Ga0181362_10513013 | 3300017723 | Freshwater Lake | ASVSVATGISPKDLLEVDPAIYLAIKAILQERSQQSKTMRRK |
Ga0181365_11232402 | 3300017736 | Freshwater Lake | SVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR |
Ga0181356_12447711 | 3300017761 | Freshwater Lake | KKWLDRHGQIWEVAAISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRK |
Ga0181356_12469242 | 3300017761 | Freshwater Lake | WIDRHGQIYEIASVAVATGISPKDLLEVDPAIYLAIKAILQEKYYNNKKATVRRK |
Ga0181358_10260403 | 3300017774 | Freshwater Lake | KVAAISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR |
Ga0181358_10663721 | 3300017774 | Freshwater Lake | KWLDRHGQIWEIASVSVRTGISPKDLLEVDPAIYMAIKAILQEQAAKTKGTVRRR |
Ga0181357_10693201 | 3300017777 | Freshwater Lake | LDRHGQIWEIASVSVAAGISPKDLLEVDPAIYLAIKAILQERSQQSKTMRRK |
Ga0181349_10988003 | 3300017778 | Freshwater Lake | KKWLDRHGQIWEIAAVSVRTGISPKDLLEVDPAVYMAIKAILQEQDAKSKGTVRRR |
Ga0181349_11825941 | 3300017778 | Freshwater Lake | ATGISPKDLLEVDPAIYLAIKAILQERSQQSKTMRRK |
Ga0181346_10514001 | 3300017780 | Freshwater Lake | RHGQIWEIASVSVATGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR |
Ga0181348_12256242 | 3300017784 | Freshwater Lake | DRHGQIWEVAAISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR |
Ga0181348_13188361 | 3300017784 | Freshwater Lake | VAVATGISPKDLLEVDPAIYAAIKAILQERYYSNKKATVRRK |
Ga0169931_101997853 | 3300017788 | Freshwater | SVSVATGISPKDLLEVDPAVYMAIKAILQEKAKQTKTVRRR |
Ga0169931_105782622 | 3300017788 | Freshwater | MSVATGISPKDLLEIDPAIYLAIKAILQERAKETKTMRRR |
Ga0181563_105705452 | 3300018420 | Salt Marsh | VATGISPKDLLEVDPAIYSAIKAILQEKYYQNKKATVRRK |
Ga0181359_10002106 | 3300019784 | Freshwater Lake | VATGISPKDLLEVDPAIYSAIKAILQERYYNNKKATVRRK |
Ga0181359_10030906 | 3300019784 | Freshwater Lake | RHGQIYEIASVAVATGISPKDLLEVDPAIYLAIKAILQERQYNNKKATVRRK |
Ga0181359_10156674 | 3300019784 | Freshwater Lake | DRHGQIYEIASVAVATGISPKDLLEVDPAIYLAIKAILQEKYYNNKKATVRRK |
Ga0181359_10799633 | 3300019784 | Freshwater Lake | VSVATGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR |
Ga0181359_12215451 | 3300019784 | Freshwater Lake | EVAAISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR |
Ga0207193_11731203 | 3300020048 | Freshwater Lake Sediment | VAVATGISPKDLLEVDPAIYLAIKAILQEKYYNNKKATVRRK |
Ga0211726_107274042 | 3300020161 | Freshwater | VAVATGISPKDLLEVDPAIYSAIKAILQERHYNNKKATVRRK |
Ga0194115_101289883 | 3300020183 | Freshwater Lake | HKPICRCGSFVRTKKWLDRHGQIWEVASVSVATGISPKDLLEVDPAIYLAIKAILQERAKETKTMRRR |
Ga0194115_101847641 | 3300020183 | Freshwater Lake | KPICRCGSFVRTKKWLDRHGQIWEVASMSVATGISPKDLLEVDPAIYLAIKAILQERAKETKTMRRR |
Ga0208091_10006945 | 3300020506 | Freshwater | VATGISPKDLLEVDPAVYMAIKAILQERAKQTKTVRRR |
Ga0208091_10060543 | 3300020506 | Freshwater | VATGISPKDLLEVDPAIYSAIKAILQERHYQSKKATVRRK |
Ga0208091_10140333 | 3300020506 | Freshwater | HGQIWEIASVSVATGISPKDLLEVDPAIYLAIKAILQERSQQSKTMRRK |
Ga0207939_10202063 | 3300020536 | Freshwater | TGISPKDLLEVDPAIYSAIKAILQERHYQSKKATVRRK |
Ga0207942_10006401 | 3300020549 | Freshwater | VATGISPKDLLEVDPAVYMAIKAILQERAKQTKTVR |
Ga0208360_10022455 | 3300020551 | Freshwater | VSVATGISPKDLLEVDPAIYAAIKAILQERQFKNKKATVRRK |
Ga0208486_10318142 | 3300020556 | Freshwater | VATGISPKDLLEVDPAIYAAIKAILQERHYNNKKATVRRK |
Ga0222713_101434921 | 3300021962 | Estuarine Water | STGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR |
Ga0181354_11165702 | 3300022190 | Freshwater Lake | KWLDRHGQIWEVAAISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR |
Ga0181354_11249031 | 3300022190 | Freshwater Lake | AAISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR |
Ga0181354_12433321 | 3300022190 | Freshwater Lake | KKWLDRHGQIWEVAAISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR |
Ga0181351_10837812 | 3300022407 | Freshwater Lake | VSVRTGISPKDLLEVDPAVYMAIKAILQEQDAKTKGTVRRR |
Ga0181351_12277291 | 3300022407 | Freshwater Lake | VAAISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR |
Ga0214917_1000612113 | 3300022752 | Freshwater | VSVATGISPKDLLEVDPAIYSAIKAILQEKYYNNKKATVRRK |
Ga0214921_1000278538 | 3300023174 | Freshwater | VAVATGISPKDLLEVDPAIYSAIKAILQERHFNNKKATVRRK |
Ga0214921_105866742 | 3300023174 | Freshwater | YEVASVSVATGISPKDLLEVDPAIYSAIKAILQERYYNNKKATVRRK |
Ga0214923_100027701 | 3300023179 | Freshwater | GSIYEVATVSVATGISPKDLLEVDPAIYSAIKAILQEKYYNNKKATVRRK |
Ga0208916_100032265 | 3300025896 | Aqueous | VSVRTGISPKDLLEVDPAVYMAIKAILHEQDAKTKGTVRRR |
Ga0209651_10109522 | 3300027581 | Freshwater Lake | VSVRTGISPKDLLEVDPAIYMAIKAILIEQDAKTKGTVRRR |
Ga0209769_10223673 | 3300027679 | Freshwater Lake | ASVAVATGISPKDLLEVDPAIYLAIKAILQERQYNNKKATVRRK |
Ga0209551_11237481 | 3300027689 | Freshwater Lake | TGISPKDLLEVDPAIYLAIKAILQERQYNNKKATVRRK |
(restricted) Ga0247836_11939653 | 3300027728 | Freshwater | VSVRTGISPKDLLEVDPAVYMAIKAILQEQDAKSKGTVRRR |
(restricted) Ga0247836_12547712 | 3300027728 | Freshwater | MSVATGISPKDLLEVDPAIYLAIKAILQERAQQSKTMRRK |
Ga0209087_10381322 | 3300027734 | Freshwater Lake | VATGISPKDLLEVDPAIYSAIKAILQERHFNNKKATVRRK |
Ga0209596_10231694 | 3300027754 | Freshwater Lake | GISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR |
Ga0209596_10772702 | 3300027754 | Freshwater Lake | VSVATGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVKRR |
Ga0209296_10680092 | 3300027759 | Freshwater Lake | VATGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR |
Ga0209086_101587123 | 3300027770 | Freshwater Lake | TGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR |
Ga0209246_100714083 | 3300027785 | Freshwater Lake | SVSVATGISPKDLLEVDPAIYLAIKAILQERSQQSKTMRRK |
Ga0209246_101708432 | 3300027785 | Freshwater Lake | TKKWLDRHGQIWEIASVSVATGISPKDLLEVDPAIYLAIKAILQERAQQSKTMRRK |
Ga0209550_102351753 | 3300027892 | Freshwater Lake | YEIASVAVATGISPKDLLEVDPAIYLAIKAILQEKYYNNKKATVRRK |
Ga0209400_10320754 | 3300027963 | Freshwater Lake | VATGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVKRR |
(restricted) Ga0247837_10531803 | 3300027970 | Freshwater | HGQIWEIASVSVRTGISPKDLLEVDPAIYMAIKAILIEQDAKTKGTVRRR |
(restricted) Ga0247835_10322633 | 3300028114 | Freshwater | RTGISPKDLLEVDPAIYMAIKAILIEQDAKTKGTVRRR |
Ga0304730_12477561 | 3300028394 | Freshwater Lake | SPKDLLEVDPAIYLAIKAILQEKYYNNKKATVRRK |
(restricted) Ga0247839_12545441 | 3300028553 | Freshwater | SVRTGISPKDLLEVDPAIYMAIKAILIEQDAKTKGTVRRR |
(restricted) Ga0247832_10415523 | 3300028557 | Freshwater | GISPKDLLEVDPAIYMAIKAILIEQDAKTKGTVRRR |
(restricted) Ga0247843_10326694 | 3300028569 | Freshwater | VATGISPKDLLEVDPAVYIAIKAILQERAKQTKTVRRR |
(restricted) Ga0247843_11704991 | 3300028569 | Freshwater | QIWEIASVSVRTGISPKDLLEVDPAIYMAIKAILIEQDAKTKGTVRRR |
(restricted) Ga0247844_10380804 | 3300028571 | Freshwater | ASVSVRTGISPKDLLEVDPAIYMAIKAILIEQDAKTKGTVRRR |
(restricted) Ga0247844_12415511 | 3300028571 | Freshwater | MAIATGISPKDLLEVDPAIYLAMKAILQERAANNKTVRRK |
Ga0119944_10207893 | 3300029930 | Aquatic | VATGISPKDLLEVDPAIYAAIKAILQEKYYNNKKATVRRK |
Ga0315291_110947403 | 3300031707 | Sediment | VSVQTGISPKDLLEVDPNIYMAIKAILQEQAAKTKGTVRRR |
Ga0315293_103970251 | 3300031746 | Sediment | ISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR |
Ga0315907_102517052 | 3300031758 | Freshwater | VAVSTGISPKDLLEVDPAIYSAIKAILQERHYNNKKATVRRK |
Ga0315900_109322231 | 3300031787 | Freshwater | ASVSVATGISPKDLLEVDPAIYSAIKAILQEKYYNNKKATVRRK |
Ga0315909_104396042 | 3300031857 | Freshwater | VSVATGISPKDLLEVDPAIYAAIKAILQERYYNNKKATVRRK |
Ga0315909_105409071 | 3300031857 | Freshwater | ISPKDLLEVDPAIYSAIKAILQERSYNNKKATVRRK |
Ga0315909_108349671 | 3300031857 | Freshwater | SIYEVATVSVATGISPKDLLEVDPAIYSAIKAILQERSYNNKKATVRRK |
Ga0315904_101076193 | 3300031951 | Freshwater | VAVSTGISPKDLLEVDPAIYSAIKAILQERSFNNKKATVRRK |
Ga0315904_104959011 | 3300031951 | Freshwater | SIYEVASVSVATGISPKDLLEVDPAIYSAIKAILQEKYYNNKKATVRRK |
Ga0315901_103403063 | 3300031963 | Freshwater | VATGISPKDLLEVDPAIYAAIKAILQERYYNNKKATVRRK |
Ga0315902_103290603 | 3300032093 | Freshwater | WIDRHGSIYEVASVSVATGISPKDLLEVDPAIYSAIKAILQEKYYNNKKATVRRK |
Ga0315903_107446721 | 3300032116 | Freshwater | VATVSVATGISPKDLLEVDPAIYSAIKAILQEKHYQNKKATVRRK |
Ga0315295_107511983 | 3300032156 | Sediment | WEVAAISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR |
Ga0315295_116424672 | 3300032156 | Sediment | VATGISPKDLLEVDPAIYMAIKAILQEQAAKTKGTVRRR |
Ga0315268_122636241 | 3300032173 | Sediment | TKKWLDRHGQIWEVAAISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR |
Ga0315286_108887362 | 3300032342 | Sediment | VSVATGISPKDLLEVDPAIYMAIKAILQEQAAKTKGTVRRR |
Ga0315275_107389371 | 3300032401 | Sediment | IASVSVATGISPKDLLEVDPAIYLAIKAILQERSQQSKTMRRK |
Ga0316616_1005954491 | 3300033521 | Soil | RHGQIYEIASVSVATGISPKDLLEVDPAIYQAIKAILQERSFGQKKATTRRK |
Ga0334981_0415772_210_332 | 3300033980 | Freshwater | MSVSTGISPKDLLEVDPAVYMAIKAILQERAQATKTVRRK |
Ga0334986_0020163_1616_1741 | 3300034012 | Freshwater | VSVRTGISPKDLLEVDPAVYMAIKAILVEQDAKTKGTVRRK |
Ga0334995_0132967_182_310 | 3300034062 | Freshwater | VSVATGISPKDLLEVDPAIYSAIKAILQEKHYNTKKATVRRK |
Ga0335001_0127566_1299_1445 | 3300034064 | Freshwater | IYEIASVAVSTGISPKDLLEVDPAIYSAIKAILQERHYQNKKATVRRK |
Ga0335028_0581232_334_459 | 3300034071 | Freshwater | VAVATGISPKDLLEVDPAVYMAIKAILQEQDAKSKGTVRRR |
Ga0335010_0674064_130_252 | 3300034092 | Freshwater | VATGISPKDLLEVDPAIYSAIKAILQERHYNNKKATVRRK |
Ga0335022_0012275_2_118 | 3300034095 | Freshwater | VATGISPKDLLEVDPAIYMAIKAILQERAQATKTVRRK |
Ga0335022_0367342_2_124 | 3300034095 | Freshwater | VATGISPKDLLEVDPAIYAAIKAILQERTLNNKKATVRRK |
Ga0335027_0174501_2_163 | 3300034101 | Freshwater | DRHGSIYEVATVSVATGISPKDLLEVDPAIYSAIKAILQERHYNSKKATVRRK |
Ga0335031_0836413_355_510 | 3300034104 | Freshwater | RHGQIWEIAAVSVRTGISPKDLLEVDPAVYMAIKAILQEQDAKSKGTVRRR |
Ga0335036_0001789_11381_11503 | 3300034106 | Freshwater | VATGISPKDLLEVDPAIYAAIKAILQERTLNSKKATVRRK |
Ga0335036_0010181_7237_7365 | 3300034106 | Freshwater | VAVSTGISPKDLLEVDPAIYSAIKAILQEKYYNNKKATVRRK |
Ga0335036_0276092_983_1126 | 3300034106 | Freshwater | IWEVAAISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR |
Ga0335053_0169216_1345_1458 | 3300034118 | Freshwater | TGISPKDLLEVDPAIYMAIKAILVEQDAKTKGTVRRR |
Ga0335065_0149292_1_114 | 3300034200 | Freshwater | MATGISPKDLLEVDPAIYAAIKAILQERTLNSKKATVR |
Ga0335007_0003682_4602_4724 | 3300034283 | Freshwater | MAIATGISPKDLLEVDPAIYLAMKAILQERAATNKTVRRK |
Ga0335007_0275235_206_334 | 3300034283 | Freshwater | VAVSTGISPKDLLEVDPAIYSAIKAILQEKYYSNKKATVRRK |
⦗Top⦘ |