NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F026865

Metagenome / Metatranscriptome Family F026865

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F026865
Family Type Metagenome / Metatranscriptome
Number of Sequences 196
Average Sequence Length 43 residues
Representative Sequence VSVATGISPKDLLEVDPAIYSAIKAILQERYYNNKKATVRRK
Number of Associated Samples 124
Number of Associated Scaffolds 196

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 20.92 %
% of genes near scaffold ends (potentially truncated) 48.98 %
% of genes from short scaffolds (< 2000 bps) 67.86 %
Associated GOLD sequencing projects 115
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (95.408 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(23.980 % of family members)
Environment Ontology (ENVO) Unclassified
(74.490 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(72.959 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 47.62%    β-sheet: 0.00%    Coil/Unstructured: 52.38%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 196 Family Scaffolds
PF05135Phage_connect_1 4.59
PF05065Phage_capsid 3.57
PF13539Peptidase_M15_4 3.06
PF09250Prim-Pol 2.04
PF03354TerL_ATPase 1.02
PF04860Phage_portal 1.02
PF01370Epimerase 0.51
PF04586Peptidase_S78 0.51

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 196 Family Scaffolds
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 3.57
COG4626Phage terminase-like protein, large subunit, contains N-terminal HTH domainMobilome: prophages, transposons [X] 1.02
COG3740Phage head maturation proteaseMobilome: prophages, transposons [X] 0.51


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.98 %
UnclassifiedrootN/A1.02 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002408|B570J29032_109203962All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage634Open in IMG/M
3300002408|B570J29032_109316608All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage688Open in IMG/M
3300002408|B570J29032_109339603All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage700Open in IMG/M
3300002408|B570J29032_109470769All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage789Open in IMG/M
3300002408|B570J29032_109926402All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2870Open in IMG/M
3300002471|metazooDRAFT_1424081All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage538Open in IMG/M
3300002835|B570J40625_100013215All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14714Open in IMG/M
3300003277|JGI25908J49247_10017289All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2178Open in IMG/M
3300003277|JGI25908J49247_10024487All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1768Open in IMG/M
3300003277|JGI25908J49247_10133287All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage584Open in IMG/M
3300003393|JGI25909J50240_1015829All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1784Open in IMG/M
3300003393|JGI25909J50240_1025329All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1336Open in IMG/M
3300003490|JGI25926J51410_1000013All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage19085Open in IMG/M
3300003491|JGI25924J51412_1004745All Organisms → cellular organisms → Bacteria2635Open in IMG/M
3300004054|Ga0063232_10027652All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1395Open in IMG/M
3300004096|Ga0066177_10478536All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage549Open in IMG/M
3300004096|Ga0066177_10546397All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage516Open in IMG/M
3300004128|Ga0066180_10100384All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1063Open in IMG/M
3300004240|Ga0007787_10022319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2669Open in IMG/M
3300005517|Ga0070374_10044001All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2319Open in IMG/M
3300005517|Ga0070374_10334579All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage766Open in IMG/M
3300005527|Ga0068876_10169779All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1276Open in IMG/M
3300005527|Ga0068876_10479925All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage685Open in IMG/M
3300005528|Ga0068872_10026269All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3838Open in IMG/M
3300005528|Ga0068872_10564573All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage606Open in IMG/M
3300005581|Ga0049081_10001260All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9606Open in IMG/M
3300005581|Ga0049081_10085722All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1180Open in IMG/M
3300005581|Ga0049081_10088158All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1162Open in IMG/M
3300005582|Ga0049080_10015515All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2650Open in IMG/M
3300005582|Ga0049080_10132124All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage841Open in IMG/M
3300005584|Ga0049082_10035388All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1749Open in IMG/M
3300005662|Ga0078894_10955909All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage740Open in IMG/M
3300005805|Ga0079957_1022632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4339Open in IMG/M
3300005805|Ga0079957_1225478All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage886Open in IMG/M
3300005805|Ga0079957_1229178All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage876Open in IMG/M
3300005805|Ga0079957_1338278All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage664Open in IMG/M
3300006639|Ga0079301_1012050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3190Open in IMG/M
3300006802|Ga0070749_10032571All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3240Open in IMG/M
3300006805|Ga0075464_10067197All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2013Open in IMG/M
3300006805|Ga0075464_10137072All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1430Open in IMG/M
3300006805|Ga0075464_10249699All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1061Open in IMG/M
3300006805|Ga0075464_10518676All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage730Open in IMG/M
3300006805|Ga0075464_10870286All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage562Open in IMG/M
3300007363|Ga0075458_10133888All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage769Open in IMG/M
3300007734|Ga0104986_1646All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage20828Open in IMG/M
3300007734|Ga0104986_1652All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage21064Open in IMG/M
3300008055|Ga0108970_11260158All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6329Open in IMG/M
3300008114|Ga0114347_1005814All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8507Open in IMG/M
3300008264|Ga0114353_1018918All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9390Open in IMG/M
3300008266|Ga0114363_1017442All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3220Open in IMG/M
3300008266|Ga0114363_1030583All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2277Open in IMG/M
3300008266|Ga0114363_1053832All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1590Open in IMG/M
3300008266|Ga0114363_1077117All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1251Open in IMG/M
3300008266|Ga0114363_1081540All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1205Open in IMG/M
3300008266|Ga0114363_1132527All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage850Open in IMG/M
3300008266|Ga0114363_1235375All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage529Open in IMG/M
3300008450|Ga0114880_1013807All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3904Open in IMG/M
3300008450|Ga0114880_1044760All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1901Open in IMG/M
3300008450|Ga0114880_1103436All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1097Open in IMG/M
3300008450|Ga0114880_1104626All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1088Open in IMG/M
3300008450|Ga0114880_1150294All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage839Open in IMG/M
3300008450|Ga0114880_1153683All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage825Open in IMG/M
3300008450|Ga0114880_1203682All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage661Open in IMG/M
3300008450|Ga0114880_1259791All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage535Open in IMG/M
3300009068|Ga0114973_10128395All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1422Open in IMG/M
3300009068|Ga0114973_10295714All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage864Open in IMG/M
3300009075|Ga0105090_10097935All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1836Open in IMG/M
3300009085|Ga0105103_10858051All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage530Open in IMG/M
3300009152|Ga0114980_10000845All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage21868Open in IMG/M
3300009155|Ga0114968_10009338All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7106Open in IMG/M
3300009155|Ga0114968_10030084All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3647Open in IMG/M
3300009158|Ga0114977_10685912All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage546Open in IMG/M
3300009160|Ga0114981_10661446All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage553Open in IMG/M
3300009163|Ga0114970_10095855All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1842Open in IMG/M
3300009163|Ga0114970_10434125All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage725Open in IMG/M
3300009168|Ga0105104_10377287All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage786Open in IMG/M
3300009181|Ga0114969_10457377All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage721Open in IMG/M
3300009183|Ga0114974_10140187All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1520Open in IMG/M
3300009183|Ga0114974_10174532All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1329Open in IMG/M
3300010160|Ga0114967_10011501All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6600Open in IMG/M
3300010160|Ga0114967_10024896All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4114Open in IMG/M
3300010354|Ga0129333_10125300All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2365Open in IMG/M
3300010885|Ga0133913_10128514All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6784Open in IMG/M
3300010885|Ga0133913_10822742All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2418Open in IMG/M
3300010885|Ga0133913_13119298All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1099Open in IMG/M
3300011113|Ga0151517_1466All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14850Open in IMG/M
3300012012|Ga0153799_1003733All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3911Open in IMG/M
3300012725|Ga0157610_1095686All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage812Open in IMG/M
(restricted) 3300013126|Ga0172367_10089218All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2210Open in IMG/M
(restricted) 3300013130|Ga0172363_10627571All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage678Open in IMG/M
(restricted) 3300013131|Ga0172373_10093085All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2312Open in IMG/M
(restricted) 3300013132|Ga0172372_10025056All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6629Open in IMG/M
(restricted) 3300013133|Ga0172362_10186098All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1517Open in IMG/M
3300013372|Ga0177922_10221300All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1407Open in IMG/M
3300013372|Ga0177922_11221679All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2295Open in IMG/M
3300017723|Ga0181362_1051301All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage857Open in IMG/M
3300017736|Ga0181365_1123240All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage621Open in IMG/M
3300017761|Ga0181356_1244771All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage513Open in IMG/M
3300017761|Ga0181356_1246924All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage510Open in IMG/M
3300017774|Ga0181358_1026040All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2308Open in IMG/M
3300017774|Ga0181358_1066372All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1337Open in IMG/M
3300017777|Ga0181357_1069320All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1358Open in IMG/M
3300017778|Ga0181349_1098800All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1094Open in IMG/M
3300017778|Ga0181349_1182594All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage735Open in IMG/M
3300017780|Ga0181346_1051400All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1667Open in IMG/M
3300017784|Ga0181348_1225624All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage659Open in IMG/M
3300017784|Ga0181348_1318836All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage515Open in IMG/M
3300017788|Ga0169931_10199785All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1706Open in IMG/M
3300017788|Ga0169931_10578262All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage769Open in IMG/M
3300018420|Ga0181563_10570545All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage631Open in IMG/M
3300019784|Ga0181359_1000210All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage12268Open in IMG/M
3300019784|Ga0181359_1003090All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5015Open in IMG/M
3300019784|Ga0181359_1015667All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2807Open in IMG/M
3300019784|Ga0181359_1079963All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1226Open in IMG/M
3300019784|Ga0181359_1221545All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage594Open in IMG/M
3300020048|Ga0207193_1173120All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1759Open in IMG/M
3300020161|Ga0211726_10727404All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage892Open in IMG/M
3300020183|Ga0194115_10128988All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1354Open in IMG/M
3300020183|Ga0194115_10184764All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1046Open in IMG/M
3300020506|Ga0208091_1000694All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5923Open in IMG/M
3300020506|Ga0208091_1006054All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1614Open in IMG/M
3300020506|Ga0208091_1014033All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage967Open in IMG/M
3300020536|Ga0207939_1020206All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage938Open in IMG/M
3300020549|Ga0207942_1000640All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7915Open in IMG/M
3300020551|Ga0208360_1002245All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3438Open in IMG/M
3300020556|Ga0208486_1031814All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage794Open in IMG/M
3300021962|Ga0222713_10143492All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1656Open in IMG/M
3300022190|Ga0181354_1116570All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage861Open in IMG/M
3300022190|Ga0181354_1124903Not Available824Open in IMG/M
3300022190|Ga0181354_1243332All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage516Open in IMG/M
3300022407|Ga0181351_1083781All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1265Open in IMG/M
3300022407|Ga0181351_1227729Not Available599Open in IMG/M
3300022752|Ga0214917_10006121All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage12618Open in IMG/M
3300023174|Ga0214921_10002785All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage27791Open in IMG/M
3300023174|Ga0214921_10586674All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage503Open in IMG/M
3300023179|Ga0214923_10002770All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage22781Open in IMG/M
3300025896|Ga0208916_10003226All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6575Open in IMG/M
3300027581|Ga0209651_1010952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2963Open in IMG/M
3300027679|Ga0209769_1022367All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2225Open in IMG/M
3300027689|Ga0209551_1123748All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage824Open in IMG/M
(restricted) 3300027728|Ga0247836_1193965All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage819Open in IMG/M
(restricted) 3300027728|Ga0247836_1254771All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage655Open in IMG/M
3300027734|Ga0209087_1038132All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2259Open in IMG/M
3300027754|Ga0209596_1023169All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3663Open in IMG/M
3300027754|Ga0209596_1077270All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1635Open in IMG/M
3300027759|Ga0209296_1068009All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1796Open in IMG/M
3300027770|Ga0209086_10158712All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1085Open in IMG/M
3300027785|Ga0209246_10071408All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1349Open in IMG/M
3300027785|Ga0209246_10170843All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage854Open in IMG/M
3300027892|Ga0209550_10235175All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1222Open in IMG/M
3300027963|Ga0209400_1032075All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2910Open in IMG/M
(restricted) 3300027970|Ga0247837_1053180All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2381Open in IMG/M
(restricted) 3300028114|Ga0247835_1032263All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2550Open in IMG/M
3300028394|Ga0304730_1247756All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage644Open in IMG/M
(restricted) 3300028553|Ga0247839_1254544All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage682Open in IMG/M
(restricted) 3300028557|Ga0247832_1041552All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2572Open in IMG/M
(restricted) 3300028569|Ga0247843_1032669All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3439Open in IMG/M
(restricted) 3300028569|Ga0247843_1170499All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage866Open in IMG/M
(restricted) 3300028571|Ga0247844_1038080All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3081Open in IMG/M
(restricted) 3300028571|Ga0247844_1241551All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage651Open in IMG/M
3300029930|Ga0119944_1020789All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage892Open in IMG/M
3300031707|Ga0315291_11094740All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage661Open in IMG/M
3300031746|Ga0315293_10397025All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1086Open in IMG/M
3300031758|Ga0315907_10251705All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1465Open in IMG/M
3300031787|Ga0315900_10932223All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage579Open in IMG/M
3300031857|Ga0315909_10439604All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage921Open in IMG/M
3300031857|Ga0315909_10540907All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage793Open in IMG/M
3300031857|Ga0315909_10834967All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage577Open in IMG/M
3300031951|Ga0315904_10107619All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2915Open in IMG/M
3300031951|Ga0315904_10495901All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1078Open in IMG/M
3300031963|Ga0315901_10340306All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1226Open in IMG/M
3300032093|Ga0315902_10329060All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1426Open in IMG/M
3300032116|Ga0315903_10744672All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage725Open in IMG/M
3300032156|Ga0315295_10751198All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage982Open in IMG/M
3300032156|Ga0315295_11642467All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage615Open in IMG/M
3300032173|Ga0315268_12263624All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage557Open in IMG/M
3300032342|Ga0315286_10888736All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage895Open in IMG/M
3300032401|Ga0315275_10738937All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1093Open in IMG/M
3300033521|Ga0316616_100595449All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1297Open in IMG/M
3300033980|Ga0334981_0415772All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage573Open in IMG/M
3300034012|Ga0334986_0020163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4559Open in IMG/M
3300034062|Ga0334995_0132967All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1823Open in IMG/M
3300034064|Ga0335001_0127566All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1447Open in IMG/M
3300034071|Ga0335028_0581232All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage606Open in IMG/M
3300034092|Ga0335010_0674064All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage513Open in IMG/M
3300034095|Ga0335022_0012275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae5498Open in IMG/M
3300034095|Ga0335022_0367342All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage789Open in IMG/M
3300034101|Ga0335027_0174501All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1552Open in IMG/M
3300034104|Ga0335031_0836413All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage511Open in IMG/M
3300034106|Ga0335036_0001789All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage19015Open in IMG/M
3300034106|Ga0335036_0010181All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7715Open in IMG/M
3300034106|Ga0335036_0276092All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1127Open in IMG/M
3300034118|Ga0335053_0169216All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1460Open in IMG/M
3300034200|Ga0335065_0149292All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1556Open in IMG/M
3300034283|Ga0335007_0003682All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage12308Open in IMG/M
3300034283|Ga0335007_0275235All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1118Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake23.98%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater18.88%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake12.24%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake5.10%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater5.10%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton4.59%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment4.59%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.08%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater3.57%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.57%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater3.06%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic3.06%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake2.04%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.53%
LakeEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake0.51%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.51%
AquaticEnvironmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic0.51%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.51%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.51%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.51%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.51%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.51%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.51%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002471Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAY 2013EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003393Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DDEnvironmentalOpen in IMG/M
3300003490Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SNEnvironmentalOpen in IMG/M
3300003491Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300004054Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2)EnvironmentalOpen in IMG/M
3300004096Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2)EnvironmentalOpen in IMG/M
3300004128Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2)EnvironmentalOpen in IMG/M
3300004240Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300005584Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006639Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11EnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007734Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015JanEnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008264Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTREnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009075Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011113Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015SepEnvironmentalOpen in IMG/M
3300012012Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012725Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013130 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2EnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300013132 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5mEnvironmentalOpen in IMG/M
3300013133 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2EnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020506Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020536Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020549Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020551Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300020556Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300023174Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505EnvironmentalOpen in IMG/M
3300023179Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027581Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027679Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027689Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027728 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14mEnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027770Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027970 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5mEnvironmentalOpen in IMG/M
3300028114 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5mEnvironmentalOpen in IMG/M
3300028394Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300028553 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16mEnvironmentalOpen in IMG/M
3300028557 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4mEnvironmentalOpen in IMG/M
3300028569 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8mEnvironmentalOpen in IMG/M
3300028571 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1EnvironmentalOpen in IMG/M
3300029930Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033980Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034064Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054EnvironmentalOpen in IMG/M
3300034071Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034095Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
B570J29032_10920396223300002408FreshwaterVSVATGISPKDLLEVDPAIYSAIKAILQEKHYNTKKATVRRK*
B570J29032_10931660823300002408FreshwaterVAVSTGISPKDLLEVDPAIYSAIKAILQERHYQNKKATVRRK*
B570J29032_10933960323300002408FreshwaterVSVATGISPKDLLEVDPAIYAAIKAILQERQFKNKKATVRRK*
B570J29032_10947076923300002408FreshwaterVSVATGISPKDLLEVDPAIYSAIKAILQERHYNSKKATVRRK*
B570J29032_10992640233300002408FreshwaterVAVATGISPKDLLEVDPAIYLAIKAILQERHYNNKKATVRRK*
metazooDRAFT_142408123300002471LakeVATGISPKDLLEVDPAIYSAIKAILQEKYYQNKKATVRRK*
B570J40625_100013215253300002835FreshwaterVAVATGISPKDLLEVDPAIYAAIKAILQERHYNNKKATVRRK*
JGI25908J49247_1001728913300003277Freshwater LakeVSVATGISPKDLLEVDPAIYLAIKAILQERSQQSKTMRRK*
JGI25908J49247_1002448743300003277Freshwater LakeVSVATGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR*
JGI25908J49247_1013328723300003277Freshwater LakeVSVRTGISPKDLLEVDPAVYMAIKAILXEQDAKTKGTVRRR*
JGI25909J50240_101582913300003393Freshwater LakeVSVRTGISPKDLLEVDPAVYMAIKAILQEQDAKTKGTVRRR*
JGI25909J50240_102532933300003393Freshwater LakeSVSVATGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR*
JGI25926J51410_1000013213300003490Freshwater LakeVSVATGISPKDLLEVDPAIYSAIKAILQERYYNNKKATVRRK*
JGI25924J51412_100474533300003491Freshwater LakeVATGISPKDLLEVDPAIYSAIKAILQERYYNNKKATVRRK*
Ga0063232_1002765253300004054Freshwater LakeVAVATGISPKDLLEVDPAIYLAIKAILQERQYNNKKATVRRK
Ga0066177_1047853623300004096Freshwater LakeVATGISPKDLLEVDPAIYLAIKAILQEKYYNNKKATVRRK*
Ga0066177_1054639723300004096Freshwater LakeVATGISPKDLLEVDPAIYLAIKAILQERQYNNKKATVRRK*
Ga0066180_1010038413300004128Freshwater LakeVAVATGISPKDLLEVDPAIYLAIKAILQERQYNNKKATVRR
Ga0007787_1002231913300004240Freshwater LakeVAVATGISPKDLLEVDPAIYLAIKAILQERNYNNKKATVRR
Ga0070374_1004400153300005517Freshwater LakeVAVATGISPKDLLEVDPAIYLAIKAILQERQYNNKKATVRRK*
Ga0070374_1033457923300005517Freshwater LakeISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR*
Ga0068876_1016977933300005527Freshwater LakeSPKDLLEVDPAIYSAIKAILQEKYYNNKKATVRRK*
Ga0068876_1047992513300005527Freshwater LakeVSVATGISPKDLLEVDPAIYSAIKAILQERSYNNKKATVRRK*
Ga0068872_1002626933300005528Freshwater LakeVATGISPKDLLEVDPAIYAAIKAILQERHYNNKKATVRRK*
Ga0068872_1056457313300005528Freshwater LakeVSVATGISPKDLLEVDPAIYSAIKAILQERYYNNKKATVRR
Ga0049081_10001260133300005581Freshwater LenticVSVATGISPKDLLEVDPAIYSAIKAILQEKYYNNKKATVRRK*
Ga0049081_1008572213300005581Freshwater LenticVSVATGISPKDLLEVDPAIYLAIKAILQERAQQSKTMRRK*
Ga0049081_1008815833300005581Freshwater LenticSIYEVASVSVATGISPKDLLEVDPAIYLAIKAILQEKYYNNKKATVRRK*
Ga0049080_1001551533300005582Freshwater LenticHGQIWEIASVSVATGISPKDLLEVDPAIYLAIKAILQERSQQSKTMRRK*
Ga0049080_1013212413300005582Freshwater LenticSPKDLLEVDPAIYSAIKAILQERYYNNKKATVRRK*
Ga0049082_1003538823300005584Freshwater LenticVSVRTGISPKDLLEVDPAIYMAIKAILIEQDAKTKGTVRRR*
Ga0078894_1095590923300005662Freshwater LakeVAVSTGISPKDLLEVDPAIYSAIKAILQERYYNNKKATVRRK*
Ga0079957_102263263300005805LakeVSVRTGISPKDLLEVDPAIYMAIKAILVEQDAKTKGTVRRR*
Ga0079957_122547813300005805LakeIYEVATVSVATGISPKDLLEVDPAIYSAIKAILQERHYNSKKATVRRK*
Ga0079957_122917813300005805LakeVSVATGISPKDLLEVDPAIYAAIKAILQERTLNSKKATVRRK*
Ga0079957_133827813300005805LakeWIDRHGSIYEVATVSVATGISPKDLLEVDPAIYSAIKAILQERHYQSKKATVRRK*
Ga0079301_101205063300006639Deep SubsurfaceVATGISPKDLLEVDPAVYMAIKAILQERAKQTKTVRRR*
Ga0070749_1003257133300006802AqueousVATGISPKDLLEVDPAIYSAIKAILQEKYYNNKKATVRRK*
Ga0075464_1006719733300006805AqueousVAVATGISPKDLLEVDPAIYLAIKAILQERNYNNKKATVRRK*
Ga0075464_1013707233300006805AqueousVAVATGISPKDLLEVDPAIYSAIKAILQERHFNNKKATVRRK*
Ga0075464_1024969943300006805AqueousVSVATGISPKDLLEVDPAIYAAIKAILQERHYNNKKATVRRK*
Ga0075464_1051867633300006805AqueousVATGISPKDLLEVDPAIYSAIKAILQEKYFKNKKATVRRK*
Ga0075464_1087028623300006805AqueousVSVATGISPKDLLEVDPAIYLAIKAILQEKYYNNKKATVRRK*
Ga0075458_1013388833300007363AqueousVATGISPKDLLEVDPAIYSAIKAILQERHYNNKKATVRRK*
Ga0104986_1646133300007734FreshwaterMSVATGISPKDLLEVDPAIYMAIKAILQEQAAKTKGTVRRR*
Ga0104986_1652243300007734FreshwaterVSVATGISPKDLLEVDPAIYAAIKAILQEKYYNNKKATVRRK*
Ga0108970_1126015883300008055EstuaryVAVATGISPKDLLEVDPAIYSAIKAILQEKYYNNKKATVRRK*
Ga0114347_1005814123300008114Freshwater, PlanktonVAVSTGISPKDLLEVDPAIYSAIKAILQERHYNNKKATVRRK*
Ga0114353_101891893300008264Freshwater, PlanktonVSVATGISPKDLLEVDPAIYSAIKAILQERSYNNKKATVRRKF*
Ga0114363_101744213300008266Freshwater, PlanktonYEVATVSVATGISPKDLLEVDPAIYSAIKAILQEKYYNNKKATVRRK*
Ga0114363_103058333300008266Freshwater, PlanktonVSVATGISPKDLLEVDPAIYAAIKAILQERYYNNKKATVRRK*
Ga0114363_105383233300008266Freshwater, PlanktonVATGISPKDLLEVDPAIYSAIKAILQEKHYQNKKATVRRK*
Ga0114363_107711733300008266Freshwater, PlanktonIYEVATVSVATGISPKDLLEVDPAIYSAIKAILQERSYNNKKATVRRK*
Ga0114363_108154013300008266Freshwater, PlanktonATVSVATGISPKDLLEVDPAIYAAIKAILQERHYNNKKATVRRK*
Ga0114363_113252723300008266Freshwater, PlanktonVAVSTGISPKDLLEVDPAIYSAIKAILQERSFNNKKATVRRK*
Ga0114363_123537513300008266Freshwater, PlanktonVATVSVATGISPKDLLEVDPAIYSAIKAILQERSFNNKKATVRRK*
Ga0114880_101380713300008450Freshwater LakeGSIYEVATVSVATGISPKDLLEVDPAIYSAIKAILQEKYYNNKKATVRRK*
Ga0114880_104476033300008450Freshwater LakeVATGISPKDLLEVDPAIYAAIKAILQERYYNNKKATVRRK*
Ga0114880_110343613300008450Freshwater LakeVATGISPKDLLEVDPAIYAAIKAILQERYYSNKKATVRRK*
Ga0114880_110462633300008450Freshwater LakeVATGISPKDLLEVDPAICSAIKAILQEKYYNNKKATVRRK*
Ga0114880_115029413300008450Freshwater LakeVATGISPKDLLEVDPAIYSAIKAILQERHYNSKKATVRRK*
Ga0114880_115368323300008450Freshwater LakePKDLLEVDPAIYSAIKAILQERHYQNKKATVRRK*
Ga0114880_120368223300008450Freshwater LakeVAVATGISPKDLLEVDPAIYSAIKAILQEKHYNNKKATVRRK*
Ga0114880_125979113300008450Freshwater LakeEVATVSVATGISPKDLLEVDPAIYSAIKAILQERSFNNKKATVRRK*
Ga0114973_1012839523300009068Freshwater LakeVAVATGISPKDLLEVDPAIYSAINAILQERHFNNKKATVRRK*
Ga0114973_1029571413300009068Freshwater LakeRHGQIWEVAAISVSTGISPKDLLEVDPAVYMAIKAILQEQDAKSKGTVRRR*
Ga0105090_1009793523300009075Freshwater SedimentVATGISPKDLLEIDPAIYSAIKAILQERHYQSKKATVRRK*
Ga0105103_1085805123300009085Freshwater SedimentVSVATGISPKDLLEVDPAIYSAIKAILQERHYQSKKATVRRK*
Ga0114980_1000084533300009152Freshwater LakeVATGISPKDLLEVDPAIYSAIKAILQERHFNNKKATVRRK*
Ga0114968_10009338103300009155Freshwater LakeVSVRTGISPKDLLEVDPAVYMAIKAILQEQDAKSKGTVRRR*
Ga0114968_1003008443300009155Freshwater LakeVATGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVKRR*
Ga0114977_1068591223300009158Freshwater LakeYEVATVSVATGISPKDLLEVDPAIYSAIKAILQERHFNNKKATVRRK*
Ga0114981_1066144623300009160Freshwater LakeYEVASVSVATGISPKDLLEVDPAIYSAIKAILQERYYNNKKATVRRK*
Ga0114970_1009585533300009163Freshwater LakeVATGISPKDLLEVDPAVYMAIKAILQEQATKTKGTVKRR*
Ga0114970_1043412513300009163Freshwater LakeISPKDLLEVDPAVYMAIKAILQEQDAKSKGTVRRR*
Ga0105104_1037728733300009168Freshwater SedimentVATGISPKDLLEVDPAIYSAIKAILQERHYQSKKATVRRK*
Ga0114969_1045737713300009181Freshwater LakeTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR*
Ga0114974_1014018713300009183Freshwater LakeISPKDLLEVDPEIYLAIKAILQERSQQSKTMRRK*
Ga0114974_1017453213300009183Freshwater LakeHGQIWEVAAISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR*
Ga0114967_1001150113300010160Freshwater LakeKKWIDRHGSIYEVASVSVATGISPKDLLEVDPAIYSAIKAILQERYYNNKKATVRRK*
Ga0114967_1002489643300010160Freshwater LakeVATGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR*
Ga0129333_1012530033300010354Freshwater To Marine Saline GradientVSVRTGISPKDLLEVDPAVYMAIKAILHEQDAKTKGTVRRR*
Ga0133913_1012851493300010885Freshwater LakeISPKDLLEVDPAIYSAIKAILQERHFNNKKATVRRK*
Ga0133913_1082274223300010885Freshwater LakeVSVATGISPKDLLEVDPAIYMAIKAILQEQAAKTKGTVRRR*
Ga0133913_1311929813300010885Freshwater LakeKWIDRHGQIYEIASVAVATGISPKDLLEVDPAIYLAIKAILQERNYNNKKATVRRK*
Ga0151517_1466253300011113FreshwaterVSVATGISPKDLLEVDPAIYSAIKAILQERHYQNKKATVRRK*
Ga0153799_100373363300012012FreshwaterVAVATGISPKDLLEVDPAIYLAIKAILQEKYYNNKKATVRRK*
Ga0157610_109568633300012725FreshwaterMSVSTGISPKDLLEVDPAVYMAIKAILQERAQATKTVRRK*
(restricted) Ga0172367_1008921833300013126FreshwaterVATGISPKDLLEVDPAVYMAIKAILQEKAKQTKTVRRR*
(restricted) Ga0172363_1062757123300013130SedimentGISPKDLLEVDPAVYMAIKAILQERAKQTKTVRRR*
(restricted) Ga0172373_1009308533300013131FreshwaterMSVATGISPKDLLEIDPAIYLAIKAILQERAKETKTMRRR*
(restricted) Ga0172372_10025056113300013132FreshwaterMSVATGISPKDLLEVDPAIYLAIKAILQERAKETKTMRRR*
(restricted) Ga0172362_1018609813300013133SedimentHGQIWELASVSVATGISPKDLLEVDPAVYMAIKAILQEKAKQTKTVRRR*
Ga0177922_1022130013300013372FreshwaterGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR*
Ga0177922_1122167933300013372FreshwaterVATGISPKDLLEVDPAIYMAIKAILQERAQATKTVRRK*
Ga0181362_105130133300017723Freshwater LakeASVSVATGISPKDLLEVDPAIYLAIKAILQERSQQSKTMRRK
Ga0181365_112324023300017736Freshwater LakeSVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR
Ga0181356_124477113300017761Freshwater LakeKKWLDRHGQIWEVAAISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRK
Ga0181356_124692423300017761Freshwater LakeWIDRHGQIYEIASVAVATGISPKDLLEVDPAIYLAIKAILQEKYYNNKKATVRRK
Ga0181358_102604033300017774Freshwater LakeKVAAISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR
Ga0181358_106637213300017774Freshwater LakeKWLDRHGQIWEIASVSVRTGISPKDLLEVDPAIYMAIKAILQEQAAKTKGTVRRR
Ga0181357_106932013300017777Freshwater LakeLDRHGQIWEIASVSVAAGISPKDLLEVDPAIYLAIKAILQERSQQSKTMRRK
Ga0181349_109880033300017778Freshwater LakeKKWLDRHGQIWEIAAVSVRTGISPKDLLEVDPAVYMAIKAILQEQDAKSKGTVRRR
Ga0181349_118259413300017778Freshwater LakeATGISPKDLLEVDPAIYLAIKAILQERSQQSKTMRRK
Ga0181346_105140013300017780Freshwater LakeRHGQIWEIASVSVATGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR
Ga0181348_122562423300017784Freshwater LakeDRHGQIWEVAAISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR
Ga0181348_131883613300017784Freshwater LakeVAVATGISPKDLLEVDPAIYAAIKAILQERYYSNKKATVRRK
Ga0169931_1019978533300017788FreshwaterSVSVATGISPKDLLEVDPAVYMAIKAILQEKAKQTKTVRRR
Ga0169931_1057826223300017788FreshwaterMSVATGISPKDLLEIDPAIYLAIKAILQERAKETKTMRRR
Ga0181563_1057054523300018420Salt MarshVATGISPKDLLEVDPAIYSAIKAILQEKYYQNKKATVRRK
Ga0181359_100021063300019784Freshwater LakeVATGISPKDLLEVDPAIYSAIKAILQERYYNNKKATVRRK
Ga0181359_100309063300019784Freshwater LakeRHGQIYEIASVAVATGISPKDLLEVDPAIYLAIKAILQERQYNNKKATVRRK
Ga0181359_101566743300019784Freshwater LakeDRHGQIYEIASVAVATGISPKDLLEVDPAIYLAIKAILQEKYYNNKKATVRRK
Ga0181359_107996333300019784Freshwater LakeVSVATGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR
Ga0181359_122154513300019784Freshwater LakeEVAAISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR
Ga0207193_117312033300020048Freshwater Lake SedimentVAVATGISPKDLLEVDPAIYLAIKAILQEKYYNNKKATVRRK
Ga0211726_1072740423300020161FreshwaterVAVATGISPKDLLEVDPAIYSAIKAILQERHYNNKKATVRRK
Ga0194115_1012898833300020183Freshwater LakeHKPICRCGSFVRTKKWLDRHGQIWEVASVSVATGISPKDLLEVDPAIYLAIKAILQERAKETKTMRRR
Ga0194115_1018476413300020183Freshwater LakeKPICRCGSFVRTKKWLDRHGQIWEVASMSVATGISPKDLLEVDPAIYLAIKAILQERAKETKTMRRR
Ga0208091_100069453300020506FreshwaterVATGISPKDLLEVDPAVYMAIKAILQERAKQTKTVRRR
Ga0208091_100605433300020506FreshwaterVATGISPKDLLEVDPAIYSAIKAILQERHYQSKKATVRRK
Ga0208091_101403333300020506FreshwaterHGQIWEIASVSVATGISPKDLLEVDPAIYLAIKAILQERSQQSKTMRRK
Ga0207939_102020633300020536FreshwaterTGISPKDLLEVDPAIYSAIKAILQERHYQSKKATVRRK
Ga0207942_100064013300020549FreshwaterVATGISPKDLLEVDPAVYMAIKAILQERAKQTKTVR
Ga0208360_100224553300020551FreshwaterVSVATGISPKDLLEVDPAIYAAIKAILQERQFKNKKATVRRK
Ga0208486_103181423300020556FreshwaterVATGISPKDLLEVDPAIYAAIKAILQERHYNNKKATVRRK
Ga0222713_1014349213300021962Estuarine WaterSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR
Ga0181354_111657023300022190Freshwater LakeKWLDRHGQIWEVAAISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR
Ga0181354_112490313300022190Freshwater LakeAAISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR
Ga0181354_124333213300022190Freshwater LakeKKWLDRHGQIWEVAAISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR
Ga0181351_108378123300022407Freshwater LakeVSVRTGISPKDLLEVDPAVYMAIKAILQEQDAKTKGTVRRR
Ga0181351_122772913300022407Freshwater LakeVAAISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR
Ga0214917_10006121133300022752FreshwaterVSVATGISPKDLLEVDPAIYSAIKAILQEKYYNNKKATVRRK
Ga0214921_10002785383300023174FreshwaterVAVATGISPKDLLEVDPAIYSAIKAILQERHFNNKKATVRRK
Ga0214921_1058667423300023174FreshwaterYEVASVSVATGISPKDLLEVDPAIYSAIKAILQERYYNNKKATVRRK
Ga0214923_1000277013300023179FreshwaterGSIYEVATVSVATGISPKDLLEVDPAIYSAIKAILQEKYYNNKKATVRRK
Ga0208916_1000322653300025896AqueousVSVRTGISPKDLLEVDPAVYMAIKAILHEQDAKTKGTVRRR
Ga0209651_101095223300027581Freshwater LakeVSVRTGISPKDLLEVDPAIYMAIKAILIEQDAKTKGTVRRR
Ga0209769_102236733300027679Freshwater LakeASVAVATGISPKDLLEVDPAIYLAIKAILQERQYNNKKATVRRK
Ga0209551_112374813300027689Freshwater LakeTGISPKDLLEVDPAIYLAIKAILQERQYNNKKATVRRK
(restricted) Ga0247836_119396533300027728FreshwaterVSVRTGISPKDLLEVDPAVYMAIKAILQEQDAKSKGTVRRR
(restricted) Ga0247836_125477123300027728FreshwaterMSVATGISPKDLLEVDPAIYLAIKAILQERAQQSKTMRRK
Ga0209087_103813223300027734Freshwater LakeVATGISPKDLLEVDPAIYSAIKAILQERHFNNKKATVRRK
Ga0209596_102316943300027754Freshwater LakeGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR
Ga0209596_107727023300027754Freshwater LakeVSVATGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVKRR
Ga0209296_106800923300027759Freshwater LakeVATGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR
Ga0209086_1015871233300027770Freshwater LakeTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR
Ga0209246_1007140833300027785Freshwater LakeSVSVATGISPKDLLEVDPAIYLAIKAILQERSQQSKTMRRK
Ga0209246_1017084323300027785Freshwater LakeTKKWLDRHGQIWEIASVSVATGISPKDLLEVDPAIYLAIKAILQERAQQSKTMRRK
Ga0209550_1023517533300027892Freshwater LakeYEIASVAVATGISPKDLLEVDPAIYLAIKAILQEKYYNNKKATVRRK
Ga0209400_103207543300027963Freshwater LakeVATGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVKRR
(restricted) Ga0247837_105318033300027970FreshwaterHGQIWEIASVSVRTGISPKDLLEVDPAIYMAIKAILIEQDAKTKGTVRRR
(restricted) Ga0247835_103226333300028114FreshwaterRTGISPKDLLEVDPAIYMAIKAILIEQDAKTKGTVRRR
Ga0304730_124775613300028394Freshwater LakeSPKDLLEVDPAIYLAIKAILQEKYYNNKKATVRRK
(restricted) Ga0247839_125454413300028553FreshwaterSVRTGISPKDLLEVDPAIYMAIKAILIEQDAKTKGTVRRR
(restricted) Ga0247832_104155233300028557FreshwaterGISPKDLLEVDPAIYMAIKAILIEQDAKTKGTVRRR
(restricted) Ga0247843_103266943300028569FreshwaterVATGISPKDLLEVDPAVYIAIKAILQERAKQTKTVRRR
(restricted) Ga0247843_117049913300028569FreshwaterQIWEIASVSVRTGISPKDLLEVDPAIYMAIKAILIEQDAKTKGTVRRR
(restricted) Ga0247844_103808043300028571FreshwaterASVSVRTGISPKDLLEVDPAIYMAIKAILIEQDAKTKGTVRRR
(restricted) Ga0247844_124155113300028571FreshwaterMAIATGISPKDLLEVDPAIYLAMKAILQERAANNKTVRRK
Ga0119944_102078933300029930AquaticVATGISPKDLLEVDPAIYAAIKAILQEKYYNNKKATVRRK
Ga0315291_1109474033300031707SedimentVSVQTGISPKDLLEVDPNIYMAIKAILQEQAAKTKGTVRRR
Ga0315293_1039702513300031746SedimentISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR
Ga0315907_1025170523300031758FreshwaterVAVSTGISPKDLLEVDPAIYSAIKAILQERHYNNKKATVRRK
Ga0315900_1093222313300031787FreshwaterASVSVATGISPKDLLEVDPAIYSAIKAILQEKYYNNKKATVRRK
Ga0315909_1043960423300031857FreshwaterVSVATGISPKDLLEVDPAIYAAIKAILQERYYNNKKATVRRK
Ga0315909_1054090713300031857FreshwaterISPKDLLEVDPAIYSAIKAILQERSYNNKKATVRRK
Ga0315909_1083496713300031857FreshwaterSIYEVATVSVATGISPKDLLEVDPAIYSAIKAILQERSYNNKKATVRRK
Ga0315904_1010761933300031951FreshwaterVAVSTGISPKDLLEVDPAIYSAIKAILQERSFNNKKATVRRK
Ga0315904_1049590113300031951FreshwaterSIYEVASVSVATGISPKDLLEVDPAIYSAIKAILQEKYYNNKKATVRRK
Ga0315901_1034030633300031963FreshwaterVATGISPKDLLEVDPAIYAAIKAILQERYYNNKKATVRRK
Ga0315902_1032906033300032093FreshwaterWIDRHGSIYEVASVSVATGISPKDLLEVDPAIYSAIKAILQEKYYNNKKATVRRK
Ga0315903_1074467213300032116FreshwaterVATVSVATGISPKDLLEVDPAIYSAIKAILQEKHYQNKKATVRRK
Ga0315295_1075119833300032156SedimentWEVAAISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR
Ga0315295_1164246723300032156SedimentVATGISPKDLLEVDPAIYMAIKAILQEQAAKTKGTVRRR
Ga0315268_1226362413300032173SedimentTKKWLDRHGQIWEVAAISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR
Ga0315286_1088873623300032342SedimentVSVATGISPKDLLEVDPAIYMAIKAILQEQAAKTKGTVRRR
Ga0315275_1073893713300032401SedimentIASVSVATGISPKDLLEVDPAIYLAIKAILQERSQQSKTMRRK
Ga0316616_10059544913300033521SoilRHGQIYEIASVSVATGISPKDLLEVDPAIYQAIKAILQERSFGQKKATTRRK
Ga0334981_0415772_210_3323300033980FreshwaterMSVSTGISPKDLLEVDPAVYMAIKAILQERAQATKTVRRK
Ga0334986_0020163_1616_17413300034012FreshwaterVSVRTGISPKDLLEVDPAVYMAIKAILVEQDAKTKGTVRRK
Ga0334995_0132967_182_3103300034062FreshwaterVSVATGISPKDLLEVDPAIYSAIKAILQEKHYNTKKATVRRK
Ga0335001_0127566_1299_14453300034064FreshwaterIYEIASVAVSTGISPKDLLEVDPAIYSAIKAILQERHYQNKKATVRRK
Ga0335028_0581232_334_4593300034071FreshwaterVAVATGISPKDLLEVDPAVYMAIKAILQEQDAKSKGTVRRR
Ga0335010_0674064_130_2523300034092FreshwaterVATGISPKDLLEVDPAIYSAIKAILQERHYNNKKATVRRK
Ga0335022_0012275_2_1183300034095FreshwaterVATGISPKDLLEVDPAIYMAIKAILQERAQATKTVRRK
Ga0335022_0367342_2_1243300034095FreshwaterVATGISPKDLLEVDPAIYAAIKAILQERTLNNKKATVRRK
Ga0335027_0174501_2_1633300034101FreshwaterDRHGSIYEVATVSVATGISPKDLLEVDPAIYSAIKAILQERHYNSKKATVRRK
Ga0335031_0836413_355_5103300034104FreshwaterRHGQIWEIAAVSVRTGISPKDLLEVDPAVYMAIKAILQEQDAKSKGTVRRR
Ga0335036_0001789_11381_115033300034106FreshwaterVATGISPKDLLEVDPAIYAAIKAILQERTLNSKKATVRRK
Ga0335036_0010181_7237_73653300034106FreshwaterVAVSTGISPKDLLEVDPAIYSAIKAILQEKYYNNKKATVRRK
Ga0335036_0276092_983_11263300034106FreshwaterIWEVAAISVSTGISPKDLLEVDPAVYMAIKAILQEQAAKTKGTVRRR
Ga0335053_0169216_1345_14583300034118FreshwaterTGISPKDLLEVDPAIYMAIKAILVEQDAKTKGTVRRR
Ga0335065_0149292_1_1143300034200FreshwaterMATGISPKDLLEVDPAIYAAIKAILQERTLNSKKATVR
Ga0335007_0003682_4602_47243300034283FreshwaterMAIATGISPKDLLEVDPAIYLAMKAILQERAATNKTVRRK
Ga0335007_0275235_206_3343300034283FreshwaterVAVSTGISPKDLLEVDPAIYSAIKAILQEKYYSNKKATVRRK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.