| Basic Information | |
|---|---|
| Family ID | F026856 |
| Family Type | Metagenome |
| Number of Sequences | 196 |
| Average Sequence Length | 42 residues |
| Representative Sequence | KSTDFVVIWNNLSEWAGTADSALLRHKVIQGYKNALEREKK |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 196 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 4.71 % |
| % of genes near scaffold ends (potentially truncated) | 82.14 % |
| % of genes from short scaffolds (< 2000 bps) | 85.20 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.67 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (64.286 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (31.633 % of family members) |
| Environment Ontology (ENVO) | Unclassified (65.816 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (68.878 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.62% β-sheet: 0.00% Coil/Unstructured: 46.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 196 Family Scaffolds |
|---|---|---|
| PF00959 | Phage_lysozyme | 9.69 |
| PF11351 | GTA_holin_3TM | 1.53 |
| PF16778 | Phage_tail_APC | 1.02 |
| PF13385 | Laminin_G_3 | 1.02 |
| PF03819 | MazG | 1.02 |
| PF09374 | PG_binding_3 | 1.02 |
| PF05838 | Glyco_hydro_108 | 1.02 |
| PF04851 | ResIII | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 196 Family Scaffolds |
|---|---|---|---|
| COG3926 | Lysozyme family protein | General function prediction only [R] | 1.02 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.47 % |
| Unclassified | root | N/A | 26.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000929|NpDRAFT_10249874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 996 | Open in IMG/M |
| 3300003277|JGI25908J49247_10011052 | All Organisms → Viruses → Predicted Viral | 2802 | Open in IMG/M |
| 3300003277|JGI25908J49247_10100865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
| 3300003393|JGI25909J50240_1001670 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5671 | Open in IMG/M |
| 3300003393|JGI25909J50240_1104666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300005581|Ga0049081_10006151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4535 | Open in IMG/M |
| 3300005582|Ga0049080_10066226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1240 | Open in IMG/M |
| 3300005582|Ga0049080_10154813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
| 3300005582|Ga0049080_10256609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| 3300006641|Ga0075471_10235679 | Not Available | 944 | Open in IMG/M |
| 3300006805|Ga0075464_10117402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1543 | Open in IMG/M |
| 3300007559|Ga0102828_1133383 | Not Available | 617 | Open in IMG/M |
| 3300007559|Ga0102828_1207892 | Not Available | 503 | Open in IMG/M |
| 3300007560|Ga0102913_1151832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
| 3300007562|Ga0102915_1269019 | Not Available | 550 | Open in IMG/M |
| 3300007603|Ga0102921_1238572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
| 3300007708|Ga0102859_1265878 | Not Available | 516 | Open in IMG/M |
| 3300007708|Ga0102859_1278624 | Not Available | 504 | Open in IMG/M |
| 3300007973|Ga0105746_1049610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1317 | Open in IMG/M |
| 3300007973|Ga0105746_1226885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
| 3300007974|Ga0105747_1010961 | Not Available | 2364 | Open in IMG/M |
| 3300007974|Ga0105747_1013051 | All Organisms → Viruses → Predicted Viral | 2191 | Open in IMG/M |
| 3300007974|Ga0105747_1068460 | Not Available | 1071 | Open in IMG/M |
| 3300007974|Ga0105747_1249469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300008113|Ga0114346_1193059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
| 3300008116|Ga0114350_1142079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
| 3300008259|Ga0114841_1005702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11312 | Open in IMG/M |
| 3300008266|Ga0114363_1245235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300008450|Ga0114880_1031613 | Not Available | 2360 | Open in IMG/M |
| 3300008450|Ga0114880_1260005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
| 3300009056|Ga0102860_1133550 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
| 3300009058|Ga0102854_1155913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
| 3300009059|Ga0102830_1145212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
| 3300009068|Ga0114973_10324897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 816 | Open in IMG/M |
| 3300009068|Ga0114973_10388772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300009068|Ga0114973_10668589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300009152|Ga0114980_10001160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18885 | Open in IMG/M |
| 3300009155|Ga0114968_10027400 | Not Available | 3853 | Open in IMG/M |
| 3300009155|Ga0114968_10198654 | Not Available | 1163 | Open in IMG/M |
| 3300009155|Ga0114968_10682075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300009155|Ga0114968_10685743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300009158|Ga0114977_10774408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300009159|Ga0114978_10311869 | Not Available | 961 | Open in IMG/M |
| 3300009159|Ga0114978_10519998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
| 3300009160|Ga0114981_10768366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300009161|Ga0114966_10007491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8982 | Open in IMG/M |
| 3300009163|Ga0114970_10022891 | Not Available | 4214 | Open in IMG/M |
| 3300009163|Ga0114970_10104596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1748 | Open in IMG/M |
| 3300009163|Ga0114970_10322446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 874 | Open in IMG/M |
| 3300009163|Ga0114970_10398909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
| 3300009163|Ga0114970_10414040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
| 3300009164|Ga0114975_10613897 | Not Available | 579 | Open in IMG/M |
| 3300009180|Ga0114979_10002671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12009 | Open in IMG/M |
| 3300009180|Ga0114979_10118077 | Not Available | 1633 | Open in IMG/M |
| 3300009180|Ga0114979_10340854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 885 | Open in IMG/M |
| 3300009180|Ga0114979_10491714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 710 | Open in IMG/M |
| 3300009180|Ga0114979_10648727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
| 3300009183|Ga0114974_10005852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9141 | Open in IMG/M |
| 3300009183|Ga0114974_10087487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2021 | Open in IMG/M |
| 3300009183|Ga0114974_10163726 | All Organisms → Viruses → Predicted Viral | 1383 | Open in IMG/M |
| 3300009183|Ga0114974_10742460 | Not Available | 530 | Open in IMG/M |
| 3300009184|Ga0114976_10195480 | All Organisms → Viruses → Predicted Viral | 1117 | Open in IMG/M |
| 3300009184|Ga0114976_10698594 | Not Available | 509 | Open in IMG/M |
| 3300009184|Ga0114976_10716221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300009185|Ga0114971_10628225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
| 3300009185|Ga0114971_10762765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300009819|Ga0105087_1068137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
| 3300010160|Ga0114967_10241199 | Not Available | 951 | Open in IMG/M |
| 3300010885|Ga0133913_10362322 | Not Available | 3834 | Open in IMG/M |
| 3300010885|Ga0133913_10472045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3309 | Open in IMG/M |
| 3300010885|Ga0133913_11857015 | Not Available | 1505 | Open in IMG/M |
| 3300010885|Ga0133913_12137616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1383 | Open in IMG/M |
| 3300010885|Ga0133913_12381544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1296 | Open in IMG/M |
| 3300010885|Ga0133913_13261983 | Not Available | 1069 | Open in IMG/M |
| 3300010885|Ga0133913_13485093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1027 | Open in IMG/M |
| 3300010970|Ga0137575_10035391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
| 3300012348|Ga0157140_10001033 | All Organisms → Viruses → Predicted Viral | 3241 | Open in IMG/M |
| 3300013006|Ga0164294_10208314 | All Organisms → Viruses → Predicted Viral | 1384 | Open in IMG/M |
| 3300013295|Ga0170791_16077729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
| 3300017700|Ga0181339_1017520 | Not Available | 811 | Open in IMG/M |
| 3300017701|Ga0181364_1053889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300017707|Ga0181363_1033943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 954 | Open in IMG/M |
| 3300017716|Ga0181350_1029374 | Not Available | 1518 | Open in IMG/M |
| 3300017716|Ga0181350_1124448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
| 3300017716|Ga0181350_1155175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300017722|Ga0181347_1050321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1259 | Open in IMG/M |
| 3300017722|Ga0181347_1174538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300017723|Ga0181362_1070710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
| 3300017736|Ga0181365_1175402 | Not Available | 502 | Open in IMG/M |
| 3300017747|Ga0181352_1021131 | All Organisms → Viruses → Predicted Viral | 2013 | Open in IMG/M |
| 3300017747|Ga0181352_1183718 | Not Available | 542 | Open in IMG/M |
| 3300017754|Ga0181344_1000663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13437 | Open in IMG/M |
| 3300017761|Ga0181356_1170724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| 3300017761|Ga0181356_1211423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| 3300017761|Ga0181356_1223394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300017761|Ga0181356_1236358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300017766|Ga0181343_1232845 | Not Available | 500 | Open in IMG/M |
| 3300017774|Ga0181358_1163660 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 751 | Open in IMG/M |
| 3300017774|Ga0181358_1260030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300017774|Ga0181358_1263915 | Not Available | 537 | Open in IMG/M |
| 3300017774|Ga0181358_1279535 | Not Available | 515 | Open in IMG/M |
| 3300017777|Ga0181357_1184516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
| 3300017777|Ga0181357_1334467 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300017778|Ga0181349_1044055 | All Organisms → Viruses → Predicted Viral | 1764 | Open in IMG/M |
| 3300017778|Ga0181349_1137120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 890 | Open in IMG/M |
| 3300017780|Ga0181346_1088599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1212 | Open in IMG/M |
| 3300017780|Ga0181346_1209681 | Not Available | 698 | Open in IMG/M |
| 3300017780|Ga0181346_1220695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
| 3300017780|Ga0181346_1272715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300017780|Ga0181346_1332483 | Not Available | 508 | Open in IMG/M |
| 3300017785|Ga0181355_1081630 | Not Available | 1350 | Open in IMG/M |
| 3300017785|Ga0181355_1313594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
| 3300019784|Ga0181359_1017831 | Not Available | 2654 | Open in IMG/M |
| 3300019784|Ga0181359_1225269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300020048|Ga0207193_1660551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
| 3300020162|Ga0211735_10532847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
| 3300020205|Ga0211731_11544779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
| 3300021962|Ga0222713_10785187 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300021963|Ga0222712_10263657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1096 | Open in IMG/M |
| 3300021963|Ga0222712_10391527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
| 3300021963|Ga0222712_10535821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
| 3300021963|Ga0222712_10540517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
| 3300021963|Ga0222712_10748800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300022179|Ga0181353_1002993 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3737 | Open in IMG/M |
| 3300022179|Ga0181353_1162009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300022190|Ga0181354_1056852 | All Organisms → Viruses → Predicted Viral | 1301 | Open in IMG/M |
| 3300022190|Ga0181354_1087352 | Not Available | 1025 | Open in IMG/M |
| 3300022190|Ga0181354_1091594 | Not Available | 996 | Open in IMG/M |
| 3300022190|Ga0181354_1236731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300022407|Ga0181351_1002590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6350 | Open in IMG/M |
| 3300022407|Ga0181351_1095115 | Not Available | 1161 | Open in IMG/M |
| 3300022407|Ga0181351_1151099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 834 | Open in IMG/M |
| 3300022407|Ga0181351_1254955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300022407|Ga0181351_1265690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300023174|Ga0214921_10270097 | Not Available | 977 | Open in IMG/M |
| 3300023184|Ga0214919_10284175 | Not Available | 1155 | Open in IMG/M |
| 3300024346|Ga0244775_11372222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300025872|Ga0208783_10114807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1168 | Open in IMG/M |
| 3300025872|Ga0208783_10291490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
| 3300025896|Ga0208916_10244307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
| 3300025896|Ga0208916_10267349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 743 | Open in IMG/M |
| 3300027142|Ga0255065_1023117 | Not Available | 1206 | Open in IMG/M |
| 3300027488|Ga0255084_1021920 | Not Available | 1236 | Open in IMG/M |
| 3300027608|Ga0208974_1122925 | Not Available | 677 | Open in IMG/M |
| 3300027697|Ga0209033_1034364 | All Organisms → Viruses → Predicted Viral | 1922 | Open in IMG/M |
| 3300027732|Ga0209442_1065230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1534 | Open in IMG/M |
| 3300027733|Ga0209297_1155255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 938 | Open in IMG/M |
| 3300027744|Ga0209355_1086962 | All Organisms → Viruses → Predicted Viral | 1436 | Open in IMG/M |
| 3300027754|Ga0209596_1194936 | Not Available | 868 | Open in IMG/M |
| 3300027754|Ga0209596_1210854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
| 3300027759|Ga0209296_1389436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
| 3300027763|Ga0209088_10002117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12431 | Open in IMG/M |
| 3300027763|Ga0209088_10172319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 942 | Open in IMG/M |
| 3300027763|Ga0209088_10239264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
| 3300027764|Ga0209134_10173178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 743 | Open in IMG/M |
| 3300027772|Ga0209768_10077478 | Not Available | 1680 | Open in IMG/M |
| 3300027772|Ga0209768_10157730 | Not Available | 1055 | Open in IMG/M |
| 3300027798|Ga0209353_10349851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
| 3300027798|Ga0209353_10427103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300027808|Ga0209354_10228643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
| 3300027963|Ga0209400_1232798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
| 3300027963|Ga0209400_1344071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
| 3300028394|Ga0304730_1115690 | Not Available | 1134 | Open in IMG/M |
| 3300031707|Ga0315291_10623409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 973 | Open in IMG/M |
| 3300031707|Ga0315291_11041250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
| 3300031772|Ga0315288_10464182 | All Organisms → Viruses → Predicted Viral | 1261 | Open in IMG/M |
| 3300031834|Ga0315290_11506686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300031873|Ga0315297_10543117 | Not Available | 977 | Open in IMG/M |
| 3300031952|Ga0315294_11266450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
| 3300031952|Ga0315294_11618923 | Not Available | 500 | Open in IMG/M |
| 3300031997|Ga0315278_11121809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300031997|Ga0315278_11895465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
| 3300031999|Ga0315274_10611985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1200 | Open in IMG/M |
| 3300031999|Ga0315274_11093214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 803 | Open in IMG/M |
| 3300031999|Ga0315274_12094060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300032046|Ga0315289_10367988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1447 | Open in IMG/M |
| 3300032046|Ga0315289_11008840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
| 3300032092|Ga0315905_10226625 | All Organisms → Viruses → Predicted Viral | 1826 | Open in IMG/M |
| 3300032116|Ga0315903_10712488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 748 | Open in IMG/M |
| 3300032164|Ga0315283_11383985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 726 | Open in IMG/M |
| 3300032173|Ga0315268_10403540 | Not Available | 1337 | Open in IMG/M |
| 3300033233|Ga0334722_10254478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1289 | Open in IMG/M |
| 3300033233|Ga0334722_10669215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
| 3300033233|Ga0334722_10691349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 725 | Open in IMG/M |
| 3300034022|Ga0335005_0240394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1103 | Open in IMG/M |
| 3300034050|Ga0335023_0021217 | All Organisms → Viruses → Predicted Viral | 3807 | Open in IMG/M |
| 3300034104|Ga0335031_0656959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300034104|Ga0335031_0673743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300034168|Ga0335061_0277414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 879 | Open in IMG/M |
| 3300034200|Ga0335065_0618219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
| 3300034356|Ga0335048_0220121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1033 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 31.63% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 26.53% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 9.69% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.61% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 5.10% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.06% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 3.06% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.06% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.55% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.04% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.53% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.02% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.02% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.02% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.51% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.51% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.51% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.51% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.51% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300009819 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
| 3300012348 | Freshwater microbial communities from Coldwater Creek, Ontario, Canada - S44 | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027142 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027488 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NpDRAFT_102498741 | 3300000929 | Freshwater And Marine | LWNNLAGWEGTADSAETRALIIHGYQEALKREKK* |
| JGI25908J49247_100110522 | 3300003277 | Freshwater Lake | MTMWLTNHQNLCKSSDFVVIWNNLSEWAGTADSALLRHKVIQGYKNALEREKK* |
| JGI25908J49247_101008653 | 3300003277 | Freshwater Lake | KHKSLCKSSDMTVIWNNLSEWAGSADSAELRHKVVIAYKDALSREKK* |
| JGI25909J50240_10016701 | 3300003393 | Freshwater Lake | MTMWLTNHQNLCKSTDFVVIWNNLSEWAGTADSALLRHKVIQGYKNALEREKK* |
| JGI25909J50240_11046661 | 3300003393 | Freshwater Lake | STDFVVIWNNLSEWAGTADSALLRHKVIQGYKNALEREKK* |
| Ga0049081_100061514 | 3300005581 | Freshwater Lentic | MSVWLTNHQNLCKSTDFVVIWNNLSEWAGTADSALLRHKVIQGYKNALEREKK* |
| Ga0049080_100662261 | 3300005582 | Freshwater Lentic | DMTVIWNNLSEWAGSADSAELRHKVVIAYKDAIAREKK* |
| Ga0049080_101548131 | 3300005582 | Freshwater Lentic | KSSDMTVIWNNLSEWAGSADSAELRHKVVQGYKDALKREKK* |
| Ga0049080_102566093 | 3300005582 | Freshwater Lentic | KSSDMTVIWNNLSEWAGSADSAELRHKVVQGYKDALKREK* |
| Ga0075471_102356791 | 3300006641 | Aqueous | VIWNNLSEWAGAADSSELRQKVIYAYKNALNRETK* |
| Ga0075464_101174025 | 3300006805 | Aqueous | KSSDYVVLWNNLSEWAGSADSTWLRNKVVHGYKDALEREKK* |
| Ga0102828_11333831 | 3300007559 | Estuarine | KHKTLCKSSDMTVIWNNLSEWAGAADSAELRHKIVIAYKDALSREKK* |
| Ga0102828_12078921 | 3300007559 | Estuarine | NHQNLCKSTDFVVIWNNLSEWAGTADSALLRHKVIQGYKNALEREKK* |
| Ga0102913_11518321 | 3300007560 | Estuarine | TEYMVIWNNLAEWAGAADSTWLRNKVVHGYKDALEREKK* |
| Ga0102915_12690193 | 3300007562 | Estuarine | CKSTEYMVIWNNLAEWAGAADSTWLRNKVVHGYKDALEREKK* |
| Ga0102921_12385723 | 3300007603 | Estuarine | VIWNNLAEWSGSADSTWLRAKVVHGYKDALEREKK* |
| Ga0102859_12658781 | 3300007708 | Estuarine | YCKSTDYTVIWNNLAEWAGAADSTWLRAKIVHGYKDALEREKK* |
| Ga0102859_12786241 | 3300007708 | Estuarine | DFVVIWNNLSEWAGTADSALLRHKVIQGYKNALEREKK* |
| Ga0105746_10496103 | 3300007973 | Estuary Water | MVVIWNNLSEWAGTADSAELRHKVIIAYKNALEREKK* |
| Ga0105746_12268851 | 3300007973 | Estuary Water | DMVVIWNNLSEWAGAADSAEIRHRVVRAYKIAIEREKK* |
| Ga0105747_10109616 | 3300007974 | Estuary Water | CKTTDYMVIWNNLPDWAGTADTVILRSKIIHGYKDALDREKK* |
| Ga0105747_10130512 | 3300007974 | Estuary Water | MVVIWNNLSEWAGSADSPELRHKVIIAYKNAKAREAQ* |
| Ga0105747_10684601 | 3300007974 | Estuary Water | DLTVIWNNLAEWAGTADSAELRTKVIHGYKDALEREKK* |
| Ga0105747_12494693 | 3300007974 | Estuary Water | SDMTVIWNNLSEWAGSADSAELRHKVVQGYKDALKREKK* |
| Ga0114346_11930592 | 3300008113 | Freshwater, Plankton | MVVIWNNLSEWAGSADSAELRHKVIIAYKNALAREAK* |
| Ga0114350_11420791 | 3300008116 | Freshwater, Plankton | IWNNISEWAGSADSAQIRTLIIHGYKEALEREKK* |
| Ga0114841_100570222 | 3300008259 | Freshwater, Plankton | MTVIWNNLSEWAGSADSAELRHKVVQGYKDALKREKK* |
| Ga0114363_12452351 | 3300008266 | Freshwater, Plankton | STEYMVIWNNLAEWAGTADSTWLRNKVVHGYKDALEREKK* |
| Ga0114880_10316135 | 3300008450 | Freshwater Lake | MVVIWNNLSEWAGAADSAELRHKVIIAYKNALEREKK* |
| Ga0114880_12600053 | 3300008450 | Freshwater Lake | YMVIWNNLAEWAGAADSTWLRNKVVHGYKDALEREKK* |
| Ga0102860_11335501 | 3300009056 | Estuarine | MTMWLTNHQNLCKSSDFIVIWNNLSEWAGTADSALLRHKVIQGYKNALEREKK* |
| Ga0102854_11559133 | 3300009058 | Estuarine | DFRVIWNNLSEWAGNSDSHQLRALVVHGYKEALEREKK* |
| Ga0102830_11452123 | 3300009059 | Estuarine | IWNNLSEWAGAADSTWLRNKVVHGYKDALEREKK* |
| Ga0114973_103248971 | 3300009068 | Freshwater Lake | KLCKSSDFVVIWNNLSEWAGAADGAELRHKVIQGYKTAIEREKK* |
| Ga0114973_103887723 | 3300009068 | Freshwater Lake | NAQYCKSSDYVVIWNNLAEWAGTADSAETRSLIIHGYKDALEREKK* |
| Ga0114973_106685893 | 3300009068 | Freshwater Lake | FVVIWNNLSEWAGAADGAELRHKVIQGYKTALEREKK* |
| Ga0114980_100011604 | 3300009152 | Freshwater Lake | MTVIWNNLSEWAGSADSAELRHKIVIAYKDALEREKK* |
| Ga0114968_100274007 | 3300009155 | Freshwater Lake | MVVIWNNLSEWAGSADSAELRHKVIIAYKNALEREKK* |
| Ga0114968_101986541 | 3300009155 | Freshwater Lake | NHQKLCKSSDFVVIWNNLSEWAGAADGAELRHKVIQGYKTALEREKK* |
| Ga0114968_106820753 | 3300009155 | Freshwater Lake | VVIWNNLSEWAGAADGAELRHKVIQGYKTALEREKK* |
| Ga0114968_106857433 | 3300009155 | Freshwater Lake | DYVVIWNNLAEWAGTADSAETRSLIIHGYKDALEREKK* |
| Ga0114977_107744083 | 3300009158 | Freshwater Lake | SDFVVIWNNLSEWAGAADGAELRHKVIQGYKTALEREKK* |
| Ga0114978_103118694 | 3300009159 | Freshwater Lake | IWLTNHQKLCKSSDFVVIWNNLSEWAGAADGAELRHKVIQGYKIALEREKK* |
| Ga0114978_105199981 | 3300009159 | Freshwater Lake | HQKLCKSSDFVVIWNNLSEWAGAADGAELRHKVIQGYKTALEREKK* |
| Ga0114978_108585051 | 3300009159 | Freshwater Lake | STDFKVIWNNLAEWAGNADSHHLRGMVIQGYKDAFDRESK* |
| Ga0114981_107683661 | 3300009160 | Freshwater Lake | IWNNLSEWAGSADSAELRHKVVIPYKNAVLREKQ* |
| Ga0114966_100074919 | 3300009161 | Freshwater Lake | MVVWLTNHQKLCKSSDFVVIWNNLSEWAGSADGAELRHKVIQGYKNAIEREKK* |
| Ga0114970_1002289112 | 3300009163 | Freshwater Lake | CKSSDFVVIWNNLSEWAGAADGAELRHKVVQGYKTALEREKK* |
| Ga0114970_101045964 | 3300009163 | Freshwater Lake | MTVIWNNLSEWAGTADSAELRHKIVIAYKDALEREKK* |
| Ga0114970_103224461 | 3300009163 | Freshwater Lake | HQHLCKSTDLVVIWNNLAEWAGTADSAELRHKVIIAYKNALEREKK* |
| Ga0114970_103989094 | 3300009163 | Freshwater Lake | VIWNNLSEWAGSADSAELRHKVIIAYKNALEREKK* |
| Ga0114970_104140401 | 3300009163 | Freshwater Lake | CKSSDFVVIWNNLSEWAGAADGAELRHKVIQGYKTALEREKK* |
| Ga0114975_106138973 | 3300009164 | Freshwater Lake | LCKSSDFVVIWNNLSEWAGAADGAELRHKVIQGYKTALEREKK* |
| Ga0114979_1000267115 | 3300009180 | Freshwater Lake | MVVIWNNLSEWAGTADSALLRHKVIQGYKSALEREKK* |
| Ga0114979_101180771 | 3300009180 | Freshwater Lake | SSDFVVIWNNLSEWAGAADGAELRHKVVQGYKNALEREKK* |
| Ga0114979_103408543 | 3300009180 | Freshwater Lake | NAGHCKSTDYIVLWNNLSEWAGSADSTWLRNKVIHGYKDALEREKK* |
| Ga0114979_104917141 | 3300009180 | Freshwater Lake | CKSTDFVVIWNNLSEWAGSADGAELRHKVVQGYKSALEREKK* |
| Ga0114979_106487271 | 3300009180 | Freshwater Lake | MAQWLTKHQVLCKSSDFKVIWNNLSEWAGAADGAELRHKVIQGYKTAL |
| Ga0114974_100058521 | 3300009183 | Freshwater Lake | MSIWLTNHQKLCKSSDFVVIWNNLSEWAGAADGAELRHKVIQGYKTALERE |
| Ga0114974_100874874 | 3300009183 | Freshwater Lake | MVVIWNNLSEWAGSADSAELRHKVIIAYKNAFEREKK* |
| Ga0114974_101637261 | 3300009183 | Freshwater Lake | VIWNNLAEWAGAADSTWLRSKVIHGYKDALEREAK* |
| Ga0114974_107424601 | 3300009183 | Freshwater Lake | KSSDFVVIWNNLSEWAGAADGAELRHKVIQGYKTALEREKK* |
| Ga0114976_101954803 | 3300009184 | Freshwater Lake | CKSTDYVIIWNNLAEWSGAADSHWLRAKVVHGYTDALEREKK* |
| Ga0114976_106985943 | 3300009184 | Freshwater Lake | VIWNNLAEWAGTADSTWLRNKVVHGYKDALEREKK* |
| Ga0114976_107162211 | 3300009184 | Freshwater Lake | KSTEYMVIWNNLAEWAGAADSTWLRNKVVHGYKDALARETK* |
| Ga0114971_106282251 | 3300009185 | Freshwater Lake | APYCKSTEYMVIWNNLAEWAGTADSTWLRNKVVHGYKDALEREKK* |
| Ga0114971_107627651 | 3300009185 | Freshwater Lake | MTVIWNNLSEWAGSADSAELRHKVVIAYKNAIQREKK* |
| Ga0105087_10681371 | 3300009819 | Groundwater Sand | FIVIWNNLSEWAGTADSALLRHKVIQGYKNALEREKK* |
| Ga0114967_102411994 | 3300010160 | Freshwater Lake | KLCKSSDFVVIWNNLSEWAGAADGAELRHKVIQGYKTALEREKK* |
| Ga0133913_103623229 | 3300010885 | Freshwater Lake | QQMSIWLTNHQKLCKSSDFVVIWNNLSEWAGAADGAELRHKVIQGYKTALEREKK* |
| Ga0133913_104720459 | 3300010885 | Freshwater Lake | STDYTVIWNNLAEWAGSADSTFLRAKVVHGYKDALEREKK* |
| Ga0133913_118570155 | 3300010885 | Freshwater Lake | AQHCKASDYLVIWNNLSEWAGSADSTWLRAKVVHGYKDAEQREKK* |
| Ga0133913_121376161 | 3300010885 | Freshwater Lake | IWNNLAEWAGTADSTWLRNKVVHGYKDALEREKK* |
| Ga0133913_123815441 | 3300010885 | Freshwater Lake | NAQYCKASDYIVMWNNLAEWAGSADSTWLRAAVIHGYKDAKEREK* |
| Ga0133913_132619831 | 3300010885 | Freshwater Lake | QDYVVIWNNLAEWAGTADSAETRGLIIHGYKEALEREKK* |
| Ga0133913_134850931 | 3300010885 | Freshwater Lake | AQYCKSSDYVVIWNNLAEWAGTADSAETRSLIIHGYKDALEREKK* |
| Ga0137575_100353911 | 3300010970 | Pond Fresh Water | DMAVIWNNLSEWAGAADSPELRQKVIIAYKNAIAREKLK* |
| Ga0157140_100010335 | 3300012348 | Freshwater | MAVIWNNLSEWAGAADSPELRQKVIIAYKNAGAREKLK* |
| Ga0164294_102083141 | 3300013006 | Freshwater | PYCKSTEYMVIWNNLAEWAGTADSTWLRNKVVHGYKDALEREKK* |
| Ga0170791_160777291 | 3300013295 | Freshwater | KDMVVIWNNLSEWAGAADSAELRHKVVYAYKEALKREKK* |
| Ga0181339_10175201 | 3300017700 | Freshwater Lake | VIWNNLAEWAGTADSAELRTKVIHGYKDALEREKK |
| Ga0181364_10538893 | 3300017701 | Freshwater Lake | TVIWNNLSEWAGSADSAELRHKVVQGYKDALKREK |
| Ga0181363_10339431 | 3300017707 | Freshwater Lake | DFIVIWNNLSEWAGTADSAETRALIIHGYKDALEREKK |
| Ga0181350_10293745 | 3300017716 | Freshwater Lake | KTSDYMVIWNNLPDWAGTADTVILRSKIIHGYKDALDREKK |
| Ga0181350_11060671 | 3300017716 | Freshwater Lake | NDYVMIWNNLPNWAGTSDTAQIRSAVIKGYTDALEREKK |
| Ga0181350_11244482 | 3300017716 | Freshwater Lake | MTVIWNNLSEWAGAADSAELRHKIVIAYKDALEREKK |
| Ga0181350_11551753 | 3300017716 | Freshwater Lake | YCKSTEYMVIWNNLAEWAGAADSTWLRNKVVHGYKDALEREKK |
| Ga0181347_10503214 | 3300017722 | Freshwater Lake | LCKSTDFVVIWNNLSEWAGTADSALLRHKVIQGYKNALEREKK |
| Ga0181347_11745383 | 3300017722 | Freshwater Lake | AGHCKSTEYMVIWNNLSEWAGTADSTWLRAKIVHGYKDALEREKK |
| Ga0181362_10707101 | 3300017723 | Freshwater Lake | DFVVIWNNLSEWAGTADSALLRHKVIQGYKNALEREKK |
| Ga0181365_11754021 | 3300017736 | Freshwater Lake | SSDMTVIWNNLSEWAGSADSAELRHKVVQGYKDALKREK |
| Ga0181352_10211317 | 3300017747 | Freshwater Lake | SDMVVIWNNLSEWAGSADSAELRHKVIIAYKNAKARETK |
| Ga0181352_11837183 | 3300017747 | Freshwater Lake | RCKSTEYMVIWNNLSEWAGTADSTWLRNKVVHGYKDALEREKK |
| Ga0181344_100066313 | 3300017754 | Freshwater Lake | CKSTEYMVIWNNLAEWAGAADSTWLRNKVVHGYKDALEREKK |
| Ga0181356_11707243 | 3300017761 | Freshwater Lake | MVIWNNLAEWAGAADSTWLRNKVVHGYKDALEREKK |
| Ga0181356_12114233 | 3300017761 | Freshwater Lake | CKSTEYMVIWNNLSEWAGTADSTWLRAKIVHGYKDALEREKK |
| Ga0181356_12233941 | 3300017761 | Freshwater Lake | CKSTEYMVIWNNLAEWAGTADSTWLRNKVVHGYKDALEREKK |
| Ga0181356_12363581 | 3300017761 | Freshwater Lake | STDMVVIWNNLSEWAGSADSAELRHKVIIAYKNALEREKK |
| Ga0181343_12328453 | 3300017766 | Freshwater Lake | HCKSTEYMVIWNNLAEWAGAADSTWLRNKVVHGYKDALEREKK |
| Ga0181358_11636604 | 3300017774 | Freshwater Lake | CKSSDMTVIWNNLSEWAGSADSAELRHKVVQGYKDALKREKK |
| Ga0181358_12600301 | 3300017774 | Freshwater Lake | EYMVIWNNLSEWAGTADSTWLRAKIVHGYKDALEREKK |
| Ga0181358_12639151 | 3300017774 | Freshwater Lake | MSAWLTNHQHLCKSTDMVVIWNNLSEWAGSADSALLRHKVIQGYKSALEREKK |
| Ga0181358_12795353 | 3300017774 | Freshwater Lake | CKSSDMTVIWNNLSEWAGSADSAELRHKVVQGYKDALKREK |
| Ga0181357_10478001 | 3300017777 | Freshwater Lake | KKSKSTDFKVIWNNLSEWGGTADSHQLRALVISGYKNALEREKK |
| Ga0181357_11845164 | 3300017777 | Freshwater Lake | HKTLCKSSDMTVIWNNLSEWAGSADSAELRHKVIIAYKNALEREKK |
| Ga0181357_13344671 | 3300017777 | Freshwater Lake | HCKSKDYVVMWNNLPDWAGTADTVTLRAKIIYGYKDALDREKK |
| Ga0181349_10440551 | 3300017778 | Freshwater Lake | VIWNNLSEWAGTADSALLRHKVIQGYKNALEREKK |
| Ga0181349_11371201 | 3300017778 | Freshwater Lake | MTMWLTNHQNLCKSTDFIVIWNNLSEWAGTADSALLRHKVIQGYKNALEREK |
| Ga0181349_12970851 | 3300017778 | Freshwater Lake | RVIWNNLSEWAGNSDSHHLRALVISGYKDALEREKK |
| Ga0181346_10885991 | 3300017780 | Freshwater Lake | MTVIWNNLSEWAGAADSAELRHKIVIAYKDALSREKK |
| Ga0181346_12096813 | 3300017780 | Freshwater Lake | AQYCKSTDMLVIWNNLAEWAGAADSTWLREKIVHGYKDALEREKK |
| Ga0181346_12206952 | 3300017780 | Freshwater Lake | MWLTNHQHLCKSTDFVVIWNNLSEWAGTADSALLRHKVIQGYKNALEREKK |
| Ga0181346_12727153 | 3300017780 | Freshwater Lake | CKSTDFIVIWNNLAEWAGNSDSHELRALVISGYKNAIKREKK |
| Ga0181346_13324831 | 3300017780 | Freshwater Lake | TDMVVIWNNLSEWAGSADSAELRHKVIIAYKNALEREKK |
| Ga0181355_10816305 | 3300017785 | Freshwater Lake | STEYMVIWNNLSEWAGTADSTWLRAKIVHGYKDALEREKK |
| Ga0181355_13135941 | 3300017785 | Freshwater Lake | DMVVIWNNLSEWAGSADSAELRHKVIIVYKNALEREKK |
| Ga0181359_10178316 | 3300019784 | Freshwater Lake | VIWNNLAEWAGASDSTWLRAKIVHGYKDALEREKK |
| Ga0181359_12252693 | 3300019784 | Freshwater Lake | RSTEYMVIWNNLAEWAGTADSTWLRNKVVHGYKDALEREKK |
| Ga0207193_16605512 | 3300020048 | Freshwater Lake Sediment | HQDLCSSKDMVVIWNNLSEWGGSADSAELRHLVVRAYKNALEREKK |
| Ga0211735_105328471 | 3300020162 | Freshwater | NADRCKSTDYIVIWNNLSEWAGSADSTWLRNKVVHGYKDALEREKK |
| Ga0211731_115447793 | 3300020205 | Freshwater | CKSSDMTVIWNNLSEWAGSADSAELRHKVIIAYKDALSREKK |
| Ga0222713_107851872 | 3300021962 | Estuarine Water | MVVIWNNLSEWAGSADSAELRHKVIIAYKNALEREKK |
| Ga0222712_102636571 | 3300021963 | Estuarine Water | KLCKSSDFVVIWNNLSEWAGAADGAELRHKVIQGYKNALEREKK |
| Ga0222712_103915274 | 3300021963 | Estuarine Water | RHQQMSIWLTNHQKLCKSTDFIVIWNNLSEWAGAADGAELRHKVVQGYKTALEREKK |
| Ga0222712_105358212 | 3300021963 | Estuarine Water | MTVIWNNLSEWAGSADSAELRHKVVIAYKDAIAREKK |
| Ga0222712_105405171 | 3300021963 | Estuarine Water | MTVIWNNLSEWAGSADSAELRHKIVIAYKDALSREKK |
| Ga0222712_107488001 | 3300021963 | Estuarine Water | VVIWNNLSEWAGAADGAELRHKVIQGYKNALEREKK |
| Ga0181353_10029932 | 3300022179 | Freshwater Lake | MSIWLTNHQKLCKSSDFVVIWNNLSEWAGAADGAELRHKVIQGYKTALEREKK |
| Ga0181353_11620093 | 3300022179 | Freshwater Lake | IVIWNNLSEWAGTADSAELRHKVIIAYKNALEREKK |
| Ga0181354_10568521 | 3300022190 | Freshwater Lake | EAEYMVIWNNLAEWAGTADSTWLRNKVVHGYKDALEREKK |
| Ga0181354_10873524 | 3300022190 | Freshwater Lake | YMVIWNNLPDWAGTADTVILRSKIIHGYKDALDREKK |
| Ga0181354_10915941 | 3300022190 | Freshwater Lake | NAQYCKSTDMVVIWNNISEWAGTADSTWLRAKIVHGYKDALEREKK |
| Ga0181354_12367311 | 3300022190 | Freshwater Lake | QNLCKSSDFVVIWNNLSEWAGTADSALLRHKVIQGYKNALEREKK |
| Ga0181351_10025907 | 3300022407 | Freshwater Lake | MWLTNHQNLCKSSDFVVIWNNLSEWAGTADSALLRHKVIQGYKNALEREKK |
| Ga0181351_10951154 | 3300022407 | Freshwater Lake | DAGHCKSTEYMVIWNNLAEWAGTADSTWLRNKVVHGYKDALEREKK |
| Ga0181351_11510991 | 3300022407 | Freshwater Lake | KSTDYTVIWNNLAEWSGAADSTWLRNKVVHGYKDALEREKK |
| Ga0181351_12549553 | 3300022407 | Freshwater Lake | KSSDMTVIWNNLSEWAGSADSAELRHKVVQGYKDALKREK |
| Ga0181351_12656903 | 3300022407 | Freshwater Lake | KSSDFVVIWNNLSEWAGAADGAELRHKVIKGYKTALEREKK |
| Ga0214921_102700971 | 3300023174 | Freshwater | LTNHQKLCKSSDFVVIWNNLSEWAGAADGAELRHKVIQGYKSALEREKK |
| Ga0214919_102841751 | 3300023184 | Freshwater | YCKASDYVVIWNNLAEWAGTADSAETRSLIIHGYKDALEREKK |
| Ga0244775_113722221 | 3300024346 | Estuarine | NNARFCRSQDFVVIWNNLSEWAGTADSSEVRSKVIHGYKEALEREKK |
| Ga0208783_101148073 | 3300025872 | Aqueous | NSNLCRSQDFVVIWNNLSEWAGAADSAELRSKVIHGYKEALEREKK |
| Ga0208783_102914901 | 3300025872 | Aqueous | VIWNNLSEWAGAADSSELRQKVIYAYKNALNRETK |
| Ga0208916_102443074 | 3300025896 | Aqueous | KSSDYVVLWNNLSEWAGSADSTWLRNKVVHGYKDALEREKK |
| Ga0208916_102673491 | 3300025896 | Aqueous | VIWNNLSEWAGAADGAELRHKVIQGYKTALEREKK |
| Ga0255065_10231174 | 3300027142 | Freshwater | HCKASDFVVIWNNLSEWAGSADSTWIRAKVIHGYKDALEREKK |
| Ga0255084_10219204 | 3300027488 | Freshwater | NAQHCKASDFVVIWNNLSEWAGSADSTWIRAKVIHGYKDALEREKK |
| Ga0208974_11229253 | 3300027608 | Freshwater Lentic | STEYMVIWNNLAEWAGAADSTWLRNKVVHGYKDALEREKK |
| Ga0209033_10343641 | 3300027697 | Freshwater Lake | MVVIWNNLSEWAGSADSAELRHKVIIAYKNAKAKESK |
| Ga0209442_10652301 | 3300027732 | Freshwater Lake | CKTSDYMVIWNNLPDWAGTADTVILRSKIIHGYKDALDREKK |
| Ga0209297_11552551 | 3300027733 | Freshwater Lake | SDFVVIWNNLSEWAGAADGAELRHKVIQGYKTALEREKK |
| Ga0209355_10869625 | 3300027744 | Freshwater Lake | HQHLCKSTDMVVIWNNLSEWAGSADSAELRHKVIIAYKNALEREKK |
| Ga0209596_11949361 | 3300027754 | Freshwater Lake | NHQKLCKSSDFVVIWNNLSEWAGAADGAELRHKVIQGYKTALEREKK |
| Ga0209596_12108541 | 3300027754 | Freshwater Lake | APFCKSTDYVVIWNNLSEWAGTADSAETRSLIIHGYKDALEREKK |
| Ga0209296_13894363 | 3300027759 | Freshwater Lake | CKSSDFVVIWNNLSEWAGAADGAELRHKVIQGYKTALEREKK |
| Ga0209088_100021173 | 3300027763 | Freshwater Lake | MVVIWNNLSEWAGTADSALLRHKVIQGYKSALEREKK |
| Ga0209088_101723191 | 3300027763 | Freshwater Lake | HCKASEYVVIWNNLAEWAGSADSTWLRNKVVHGYKEALEREAK |
| Ga0209088_102392644 | 3300027763 | Freshwater Lake | NAQYCKSSDYVVIWNNLAEWAGTADSAETRSLIIHGYKDALEREKK |
| Ga0209134_101731781 | 3300027764 | Freshwater Lake | MVVIWNNLSEWAGAADSAELRHKVIIAYKNALEREK |
| Ga0209768_100774785 | 3300027772 | Freshwater Lake | QDYVVIWNNLSEWAGSADSTQLRGLVVHGYKEASAREKK |
| Ga0209768_101577301 | 3300027772 | Freshwater Lake | HLCKSTDMVVIWNNLSEWAGSADSAELRHKVIIAYKNALEREKK |
| Ga0209353_103498513 | 3300027798 | Freshwater Lake | STEYMVIWNNLAEWAGTADSTWLRNKVIHGYKDALEREKK |
| Ga0209353_104271031 | 3300027798 | Freshwater Lake | TNHQHLCKSTDFVVIWNNLSEWAGTADSALLRHKVIQGYKNALEREKK |
| Ga0209354_102286433 | 3300027808 | Freshwater Lake | STDFVVIWNNLSEWAGTADSALLRHKVIQGYKNALEREKK |
| Ga0209400_12327981 | 3300027963 | Freshwater Lake | SIWLTNHQKLCKSSDFVVIWNNLSEWAGAADGAELRHKVIQGYKTALEREKK |
| Ga0209400_13440713 | 3300027963 | Freshwater Lake | TEYMIIWNNLAEWAGTADSTWLRAKIVHGYKDALEREKK |
| Ga0304730_11156901 | 3300028394 | Freshwater Lake | FIVIWNNMSEWAGNSDSHQLRALVISGYKTALEREKK |
| Ga0315291_106234093 | 3300031707 | Sediment | DYVVIWNNLSEWAGTADSAETRSLIIHGYKDALEREKK |
| Ga0315291_110412501 | 3300031707 | Sediment | KHKTLCKSSDMTVIWNNLSEWAGSADSAELRHKVVIAYKDALSREKK |
| Ga0315288_104641821 | 3300031772 | Sediment | HCKSTEYMVIWNNLAEWAGTADSTWLRAKVVHGYKDALEREKK |
| Ga0315290_115066863 | 3300031834 | Sediment | MVIWNNLAEWAGTADSTWLRAKVVHGYKDALEREKK |
| Ga0315297_105431171 | 3300031873 | Sediment | QDLTVIWNNLAEWAGTADSAELRTKVIHGYKDALEREKK |
| Ga0315294_112664502 | 3300031952 | Sediment | VIWNNLSEWAGTADSALLRHKVIQGYKNALEREKKXL |
| Ga0315294_116189233 | 3300031952 | Sediment | TKHKTLCKSSDMTVIWNNLSEWAGSADSAELRHKVIQGYKNALEREKK |
| Ga0315278_111218091 | 3300031997 | Sediment | MTVIWNNLSEWAGSADSAELRHKVVIAYKDALSREKK |
| Ga0315278_118954651 | 3300031997 | Sediment | CKSSDMTVIWNNLSEWAGSADSAELRHKVIQGYKNALEREKK |
| Ga0315274_106119853 | 3300031999 | Sediment | QMSIWLTNHQHLCKSTDFVVIWNNLSEWAGTADSALLRHKVIQGYKNALEREKK |
| Ga0315274_110932141 | 3300031999 | Sediment | KSTDFVVIWNNLSEWAGTADSALLRHKVIQGYKNALEREKK |
| Ga0315274_120940601 | 3300031999 | Sediment | QTLCKSTDMVVIWNNLSEWAGTADSAELRHKVIQGYKNALEREKK |
| Ga0315289_103679884 | 3300032046 | Sediment | HQQMTMWLTNHQNLCKSTDFVVIWNNLSEWAGTADSALLRHKVIQGYKSALEREKK |
| Ga0315289_110088401 | 3300032046 | Sediment | CKSTDFVVIWNNLSEWAGTADSALLRHKVIQGYKNALEREKK |
| Ga0315905_102266251 | 3300032092 | Freshwater | NAPYCKSTEYMVIWNNLPDWAGTADTVILRSKIIHGYKDALDREKK |
| Ga0315903_107124882 | 3300032116 | Freshwater | MTVIWNNLSEWAGSADSAELRHKVIIAYKNAKAREAGK |
| Ga0315283_113839854 | 3300032164 | Sediment | MSVWLTNHQNLCKSTDMVVIWNNLSEWAGTADSAELRHKVIIAYKNAL |
| Ga0315268_104035405 | 3300032173 | Sediment | MTVIWNNLSEWAGSADSAELRHKVVIAFKDALLREKK |
| Ga0334722_102544784 | 3300033233 | Sediment | NLCKSTDFVVIWNNLSEWAGTADSALLRHKVIQGYKNALEREKK |
| Ga0334722_106692151 | 3300033233 | Sediment | DMTVIWNNLSEWAGSADSAELRHKVVIAYKDALSREKK |
| Ga0334722_106913493 | 3300033233 | Sediment | KAHDYVAIWNGLAEWAGTADSAELRAKIVHGYKDAVEREK |
| Ga0335005_0240394_2_130 | 3300034022 | Freshwater | CKSTDFIVIWNNLAEWAGAADSTKLRELVIHGHKDALDREKK |
| Ga0335023_0021217_1050_1166 | 3300034050 | Freshwater | MTVIWNNLAEWAGSADSAELRHKVVIAYKAALEREKNK |
| Ga0335031_0656959_423_536 | 3300034104 | Freshwater | MVVIWNNISGWAGAADSAELRHKIVYAYKEALKREKK |
| Ga0335031_0673743_470_598 | 3300034104 | Freshwater | CKTSDYMVIWNNLPDWAGTADTVILRSKIIHGYKDALDREKQ |
| Ga0335061_0277414_48_161 | 3300034168 | Freshwater | MVVIWNNLSEWAGSADSAELRHLVIRAYKNAVEREKK |
| Ga0335065_0618219_65_226 | 3300034200 | Freshwater | MTMWLTNHQHLCKSTDFVVIWNNLSEWAGTADSALLRHKVIQGYKNALEREKK |
| Ga0335048_0023221_4190_4315 | 3300034356 | Freshwater | KSTDFKVIWNNLAEWAGSADSHHLRALVVHGYKEALEREKK |
| Ga0335048_0220121_909_1031 | 3300034356 | Freshwater | STDYIVIWNNLSEWAGAADSTWLRNKIVHGYKDALEREKK |
| ⦗Top⦘ |