 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F026830 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 196 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MVKGETVMPVPEGNITTSEILVPVVEEVVEVSTTEEAEDDLPELS |
| Number of Associated Samples | 140 |
| Number of Associated Scaffolds | 196 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 48.70 % |
| % of genes near scaffold ends (potentially truncated) | 15.31 % |
| % of genes from short scaffolds (< 2000 bps) | 72.45 % |
| Associated GOLD sequencing projects | 126 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.102 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (60.714 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (53.061 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.48% β-sheet: 0.00% Coil/Unstructured: 94.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 196 Family Scaffolds |
|---|---|---|
| PF01807 | zf-CHC2 | 7.65 |
| PF03796 | DnaB_C | 6.63 |
| PF13481 | AAA_25 | 5.10 |
| PF13362 | Toprim_3 | 4.59 |
| PF02467 | Whib | 3.57 |
| PF07659 | DUF1599 | 3.06 |
| PF00145 | DNA_methylase | 2.55 |
| PF01930 | Cas_Cas4 | 2.04 |
| PF13392 | HNH_3 | 1.02 |
| PF05869 | Dam | 1.02 |
| PF04545 | Sigma70_r4 | 1.02 |
| PF13692 | Glyco_trans_1_4 | 0.51 |
| PF01370 | Epimerase | 0.51 |
| PF02767 | DNA_pol3_beta_2 | 0.51 |
| PF02768 | DNA_pol3_beta_3 | 0.51 |
| PF02945 | Endonuclease_7 | 0.51 |
| PF12705 | PDDEXK_1 | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 196 Family Scaffolds |
|---|---|---|---|
| COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 7.65 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 6.63 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 6.63 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 2.55 |
| COG1468 | CRISPR/Cas system-associated exonuclease Cas4, RecB family | Defense mechanisms [V] | 2.04 |
| COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 1.02 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.10 % |
| All Organisms | root | All Organisms | 44.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 25.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 11.73% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.20% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 8.16% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 7.14% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.10% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.57% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.55% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.55% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.04% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 2.04% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.53% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.53% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.53% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.53% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.02% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.02% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.02% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.02% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.51% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.51% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.51% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.51% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.51% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.51% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.51% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300002202 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2012 | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007625 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 | Environmental | Open in IMG/M |
| 3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
| 3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009450 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011114 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb | Environmental | Open in IMG/M |
| 3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
| 3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
| 3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
| 3300012264 | Freshwater sediment bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - Sed-PBS metaG | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300012707 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013310 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES153 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300029349 | Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Draft_115386033 | 3300000558 | Hydrocarbon Resource Environments | MPVPGGEITTSEILVPEVEVVPEVVPDEDEDDLPELS* |
| B570J14230_100220562 | 3300001282 | Freshwater | MPVPGGEITTSEILVPEVVPVEEVTEEAEDDLPELS* |
| metazooDRAFT_12417502 | 3300002202 | Lake | MPVPEGNITTSEILQPQEVVEVSTTEEEEDDSKPKQG* |
| Ga0068877_104533623 | 3300005525 | Freshwater Lake | MPVPEGNITTSDILVPVVEEVVEVSTTEEENTDGK |
| Ga0068876_1001628210 | 3300005527 | Freshwater Lake | MPVPGGEITTTEILVPVVEEVVEDSTTEEDEDDLPELS* |
| Ga0068876_100386354 | 3300005527 | Freshwater Lake | MPVPEGNITTSDILVPVVEEVVEVSTTEEENTDGKVEE* |
| Ga0068876_101109124 | 3300005527 | Freshwater Lake | MPVPEGNITTSEILVPVVEEVVEVSTTEEDTDGKVEE* |
| Ga0068876_106231992 | 3300005527 | Freshwater Lake | MVKGETVMPVPEGNITTTEILVPVVEEVVEVSTTEEDEDNEDN* |
| Ga0068872_100741482 | 3300005528 | Freshwater Lake | MDKGETIMPVPGGEITTTEILVPVVEEVVEDSTTEEDEDDLPELS* |
| Ga0068872_105375232 | 3300005528 | Freshwater Lake | MPVPEGNITTTEILVPVVEEVVEVSTTEEDEDNEDN* |
| Ga0049081_101198732 | 3300005581 | Freshwater Lentic | MDKGETIMPVPGGEITTSEILIPKVEEVVEVSTTEEDEDDLSELS* |
| Ga0049081_101764972 | 3300005581 | Freshwater Lentic | MDKGETIMPVPGGEITTTEILVPEVVPVEEEADDSKTEQG* |
| Ga0049080_102528112 | 3300005582 | Freshwater Lentic | KGETIMPVPGGEITTTEILVPEVVPVEEVEDDLPELS* |
| Ga0070749_100579943 | 3300006802 | Aqueous | MPVPEGNITTTEILVPEVVPVEEATEEDEDDLPELS* |
| Ga0075467_104282133 | 3300006803 | Aqueous | MAKGETVMPVPQGDITTSEILVPVVEEVVEDSTTEEEEDDLPELS* |
| Ga0075464_107559691 | 3300006805 | Aqueous | MAKGETVMPVPEGNITTTEILVPEVVPEEVVETSTTEEDEDDLPELS* |
| Ga0070748_12127932 | 3300006920 | Aqueous | MPVPEGNITTTEILVPEVVPEEVVETSTTEEDEDDLPELS* |
| Ga0099846_11164541 | 3300007542 | Aqueous | MVKGEKIMPVPGGEITTTEILVPEVVPEVVPVEEEIEDDLPELS* |
| Ga0102828_10748053 | 3300007559 | Estuarine | MVKGETIMPVPGGEITTTEILVPEVVPVEEVEDDLPELS* |
| Ga0102870_11338833 | 3300007625 | Estuarine | MVKGEEIMPVPGGEITTTEILVPVEPVVEEVEDDLPELS* |
| Ga0102856_10681971 | 3300007636 | Estuarine | STMVKGETVMPVPGGEITTTEILVPEVVPVEEVEDDLPELS* |
| Ga0104986_160422 | 3300007734 | Freshwater | MPVPGGEITTTEILVPEVVPVEETKEEEAEDDLPELS* |
| Ga0104986_188635 | 3300007734 | Freshwater | MVRGEEVMPIPEGEITTAEILVPEVVPVEDEVIISWEEAKDDLSKLP* |
| Ga0104988_1076131 | 3300007735 | Freshwater | MAKGETIMPVPEGDITTTEILIPEVVPAVEEVEDDLPELS* |
| Ga0105745_10610011 | 3300007972 | Estuary Water | MVKGETVMPVPGGEITTTEILIPEVVPVEEVEDDLPELS* |
| Ga0105747_10118774 | 3300007974 | Estuary Water | RKVYKMPVPEGDITTTEILVPAVEEVVEVVEEAEDDLPELS* |
| Ga0105748_100491355 | 3300007992 | Estuary Water | MVKGETVMPVPGGEITTTEILVPEVVEEVKEDDV* |
| Ga0114340_10824424 | 3300008107 | Freshwater, Plankton | MVEGETVMPVPEGNITTSEILIPKVEEVVEVIEEETKDES* |
| Ga0114340_11039162 | 3300008107 | Freshwater, Plankton | MVKGETVMPVPGGEITTSEILVPVVEEVAPVEEVKEEDEDN* |
| Ga0114340_11774323 | 3300008107 | Freshwater, Plankton | MVKGETVMPVPEGDITTTEILVPVVEEVVEDSTTEEVEDEA* |
| Ga0114340_12366751 | 3300008107 | Freshwater, Plankton | MVKGETVMPVPEGNITTSEILVPVVEEVVESSTTEEVEDDLPELS* |
| Ga0114340_12491662 | 3300008107 | Freshwater, Plankton | MVKGETIMPVPGGEITTSEILIPKVEEVVEVSTTEEDEDDLPKL* |
| Ga0114341_105326322 | 3300008108 | Freshwater, Plankton | MVKGETIMPVPEGNITTSEILVPVVEEVVETTEEETKDEAETN* |
| Ga0114343_100226326 | 3300008110 | Freshwater, Plankton | MDKGETIMPVPGGEITTTEILVPVVEEVVEEVEDDLPELS* |
| Ga0114343_12214981 | 3300008110 | Freshwater, Plankton | MPVPGGEITTSEILKPVEEVVEVSTTEEDEDDLPELS* |
| Ga0114346_10048032 | 3300008113 | Freshwater, Plankton | MVKGETVMPVPEGNITTSEILVPVVEEVVEVSTTEEVEETDDN* |
| Ga0114346_10233337 | 3300008113 | Freshwater, Plankton | MDKGETIMPVPGGEITTTEILIPKVEEVVEDSTTEEDEDDLPELS* |
| Ga0114347_10681873 | 3300008114 | Freshwater, Plankton | MVKGETVMPVPEGNITTTEILVPIVEEVVETTEEETKDEAETN* |
| Ga0114354_10086333 | 3300008119 | Freshwater, Plankton | MPVPGGEITTTEILVPVVEEVVETSTTEEDEDDLPELS* |
| Ga0114355_11048953 | 3300008120 | Freshwater, Plankton | MVKGETVMPVPEGNITTSEILIPVVEEVVEVSITEEEETDGKVEE* |
| Ga0114355_11817921 | 3300008120 | Freshwater, Plankton | MPVPEGNITTSEILVPVVEEVVEVVEEAEDDLPELS* |
| Ga0114336_10225008 | 3300008261 | Freshwater, Plankton | MVEGETVMPVPGGEITTSEILKPVVEEVVEVSTTEEDEDDLPELS* |
| Ga0114337_11628452 | 3300008262 | Freshwater, Plankton | AKGETIMPVPGGEITTTEILVPVVEEVVEEVEDDLPELS* |
| Ga0114880_10426415 | 3300008450 | Freshwater Lake | MVKGETVMPVPGGEITTTEILVPEVVPVEEVEDDLPELS* |
| Ga0114880_12371402 | 3300008450 | Freshwater Lake | MVKGEKIMAIPLGHITTSEILVPEAVPVVEEVVEEVEAEEE* |
| Ga0104242_10087375 | 3300008962 | Freshwater | MVKGETIMPVPGGEITTTEILVPVVEEVVEEVEDDLPELS* |
| Ga0114973_101086664 | 3300009068 | Freshwater Lake | MDKGETIMPVPEGIITSSEILVPEVVPVEEVIEEAEDDLPELS* |
| Ga0114973_103233942 | 3300009068 | Freshwater Lake | MVKGETVMPVPEGVITTSEILQPVQEEVVEVSTTEEAEETDDN* |
| Ga0105098_106937371 | 3300009081 | Freshwater Sediment | GETIMPVPQGDITTTEILVPEVEVVPEVVPDEDEDDLPELS* |
| Ga0105103_101417021 | 3300009085 | Freshwater Sediment | MVKGETVMPVPEGNITTSDILVPVVEEVVETTEEEAKDEAKTN* |
| Ga0105103_101968932 | 3300009085 | Freshwater Sediment | MPVPQGDITTTEILVPEVEVVPEVVPDEDEDDLPELS* |
| Ga0105091_100788874 | 3300009146 | Freshwater Sediment | MPVPEGNITTSDILVPVEEEVVEVVEEAEDDLPELS* |
| Ga0114962_100692373 | 3300009151 | Freshwater Lake | MPVPEGNITTSEILVPEVVPVEEVIEEVEDDLPELS* |
| Ga0114980_100521386 | 3300009152 | Freshwater Lake | MVKGETIMAIPGGEITTSEILVPEVVPEVPEVEEVDD |
| Ga0114963_103889901 | 3300009154 | Freshwater Lake | MVKGETVMPVPGGEITTTEILVPEVVPVEEVKEDEDN* |
| Ga0114977_103605091 | 3300009158 | Freshwater Lake | MPVPGGEITTSEILVPVVEEVVETSTTEEAEDDLSELS* |
| Ga0114981_104073981 | 3300009160 | Freshwater Lake | YKMPVPGGEITTTEILVPEVVPVEEVEDDLPELS* |
| Ga0114970_1002005910 | 3300009163 | Freshwater Lake | MPVPEGVITTSEILQPVQEEVVEVSTTEEAEETDDN* |
| Ga0105102_105454051 | 3300009165 | Freshwater Sediment | MPVPGGEITTSEILKPVVEEVVEVSTTEEEDTDGKVEE* |
| Ga0105102_106159612 | 3300009165 | Freshwater Sediment | MPVPEGNITTSEILVPVVEEVVEVSTTEEAEDDLPELS* |
| Ga0105102_109153902 | 3300009165 | Freshwater Sediment | MPVPGGEITTSEILVPKVEEVVEVSTTEEDEDDLPKL* |
| Ga0105097_102620121 | 3300009169 | Freshwater Sediment | RPSPMDKGETIMPVPGGEITTSEILVPKVEEVVEVSTTEEDEADMPEL* |
| Ga0105097_106162462 | 3300009169 | Freshwater Sediment | MPVPGGEITTTEILVPVVEEVVEVSTTEEAEDDLPELS* |
| Ga0105096_106364373 | 3300009170 | Freshwater Sediment | MPVPEGNITTSEILVPVEEEVVEVSTTEEAEDDLPE |
| Ga0114979_104137682 | 3300009180 | Freshwater Lake | SLGHSGPSTMVKGETVMPVPGGEITTTEILVPEVVPVEEAEDDLPELS* |
| Ga0114959_100574824 | 3300009182 | Freshwater Lake | MDKGETIMPVPEGNITTSEILVPEEVPVEEVIEEVEDDLPELS* |
| Ga0114974_102050403 | 3300009183 | Freshwater Lake | MGKGEPIMPVPGGEITTTEILVPEVVPEMEEAEDDLPELS* |
| Ga0114982_10366174 | 3300009419 | Deep Subsurface | MPVPGGEITTTEILVPVVEEVVEVSTTEEDEDDLPELS* |
| Ga0115546_12201831 | 3300009435 | Pelagic Marine | MVKGETVMPVPGGEITTTEILVPVVEEVVEETTEEETKDEA* |
| Ga0127391_10150143 | 3300009450 | Meromictic Pond | MTPVPGGEITTSEILVPEVVPVVEDLELIEEEPE* |
| Ga0114964_101232284 | 3300010157 | Freshwater Lake | MVKGETVMPVPGGEITTTEILVPEVVPVEEVKEEDEDN* |
| Ga0129333_107967892 | 3300010354 | Freshwater To Marine Saline Gradient | KGETVMPVPEGNITTTEILVPEVVPVEEATEEDEDDLPELS* |
| Ga0133913_1004803921 | 3300010885 | Freshwater Lake | MVKGETIMAIPGGEITTSEILVPEVVPEVPEVEEVDDSTTEQG* |
| Ga0133913_102974026 | 3300010885 | Freshwater Lake | MGKGETMMPVPEGEITTAEILVQEVVPVEDEDDLPELP* |
| Ga0151515_102054 | 3300011114 | Freshwater | MVKGETVMPVPEGDITTTEILVPEVVPEAEEVEDDLPLVP* |
| Ga0136709_10321322 | 3300011184 | Freshwater | MVKGETVMPVPEGNITTSDILVPVVEEVVEVSTTEEAEDDLPKL* |
| Ga0153698_107155 | 3300011335 | Freshwater | MPVPEGNITTSDILVPEVVPVEEVEEVEDDLPELS* |
| Ga0119955_100124313 | 3300012006 | Freshwater | MVKGETVMPVPEGDITTTEILVPEVVPEAEEVEDDLPELP* |
| Ga0136715_10265293 | 3300012264 | Freshwater Sediment | MVKGETVMPVPQGDITTTEILVPEEVVEVSTTEEDEDDLPELS* |
| Ga0157210_100057719 | 3300012665 | Freshwater | MVKGETIMAIPGGEITTSEILVPVVEEVVEVSTTEEEADDSTPEQG* |
| Ga0157210_100058517 | 3300012665 | Freshwater | MVKGETIMPVPGGEITTSEILVPAVEEVVEVSTTEEAEDDLPEL* |
| Ga0157208_100095764 | 3300012667 | Freshwater | MNGRTKMPVPGGEITTSEILVPKVEEVVEVSTTEEELVQDDLPELP* |
| Ga0157623_11896751 | 3300012707 | Freshwater | MVKGETVMPVPGGEITTSEILKPVEEVVEVSITEEDEDDLPKL* |
| Ga0164293_102563842 | 3300013004 | Freshwater | MVKGETIMPVPGGEITTSEILVPVVEEVVEVSTTEEEAEDDLPELS* |
| Ga0164293_104463363 | 3300013004 | Freshwater | MVKGETVMPVPEGNITTSEILVPVVEEVVEVVEEAEDDLPELS* |
| Ga0164292_106617001 | 3300013005 | Freshwater | MVKGETVMPVPEGNITTSEILVPVVEEVVEVSTTEEEAEDDLPELS* |
| Ga0164292_106924993 | 3300013005 | Freshwater | MPVPGGEITTTEILIPAAQVEAALEAALAAEETEDDLPELS* |
| Ga0157622_12217092 | 3300013310 | Freshwater | SSLGHSGPSPMVKGETVMPVPGGEITTSEILKPVVEEVVEVSTTEEEVIPFERIDTDDLPEL* |
| Ga0181363_10557763 | 3300017707 | Freshwater Lake | MPVPGGEITTSEILKPVEEVVEVSTTEEDEDDLPKL |
| Ga0181344_10075919 | 3300017754 | Freshwater Lake | MPVPGGEITTSEILVPVVEEVVEVSTTEEEAEDDLPELS |
| Ga0181356_11916021 | 3300017761 | Freshwater Lake | KGETVMPVPGGEITTTEILVPEVVPVEEVKEEAEVEE |
| Ga0181343_10439213 | 3300017766 | Freshwater Lake | MAKGETIMPVPGGEITTTEILVPVEPVVEEVEDDLPELS |
| Ga0181349_12945431 | 3300017778 | Freshwater Lake | SLGHSGPSTMVKGETVMPVPGGEITTTEILVPEVVPVEEVEDED |
| Ga0181348_12834412 | 3300017784 | Freshwater Lake | SSLGHSGPSTMVKGETVMPVPGGEITTTEILVPEVVPVEEVEDDLSELS |
| Ga0207193_10816211 | 3300020048 | Freshwater Lake Sediment | VKGETVMPVPEGNITTSDILVPVVEEVVEEVKEETTEDDLPELS |
| Ga0207193_13419261 | 3300020048 | Freshwater Lake Sediment | GETVMPVPEGDITTTEILVPEVEVVPEVVPDEDEDDLPELS |
| Ga0207193_18247661 | 3300020048 | Freshwater Lake Sediment | MPVPEGIITTSEILVPEEVPVEEVIEEAEDDLPELS |
| Ga0211736_108744964 | 3300020151 | Freshwater | MVKGETVMPVPGGEITTTEILVPEVVPVEEVEDDLPELS |
| Ga0211734_101691862 | 3300020159 | Freshwater | MAKGETIMPVPGGEITTTEILVPEVVPVEEVKEETEAEVEE |
| Ga0211735_100851621 | 3300020162 | Freshwater | MVKGETVMPVPGGEITTTEILVPEVVPVEETTEEEASEA |
| Ga0208050_10016793 | 3300020498 | Freshwater | MVKGETVMPVPGGEITTSEILVPEVVPVEEVTEEAEDDLPELS |
| Ga0208232_10245502 | 3300020527 | Freshwater | MPVPGGEITTSEILVPVVEEVVETSTTEEDEDDLPELS |
| Ga0207939_10141674 | 3300020536 | Freshwater | MVKGETVMPVPGGEITTSEILVPVVEPVVEVAEEETKDED |
| Ga0208599_10058341 | 3300020554 | Freshwater | MPVPGGEITTTEILVPVVEEVVETSTTEEDEDDLPELS |
| Ga0222714_100185146 | 3300021961 | Estuarine Water | MPVPEGVITTTEILVPVVEEVVEVSTTEEAKDDLPELS |
| Ga0222712_100290092 | 3300021963 | Estuarine Water | MVKGETVMPVPGGEITTSEILVPEEVPVEEVIEEVEDDLPELS |
| Ga0222712_102697414 | 3300021963 | Estuarine Water | MPVPGGEITTSEILVPEEVPVEEVIEEVEDDLPELS |
| Ga0181354_11182003 | 3300022190 | Freshwater Lake | FHLEHTGEIVMPVPGGEITTTEILVPKVVEEVKEDDV |
| Ga0181351_10049009 | 3300022407 | Freshwater Lake | MVKGETVMPVPGGEITTTEILVPEVVPVEEVEDDLPELP |
| Ga0181351_12075103 | 3300022407 | Freshwater Lake | MVEGETVMPVPGGEITTTEILVPEVVPVEEVEDED |
| Ga0214917_102260704 | 3300022752 | Freshwater | MVKGETIMPVPGGEITTTEILVPEVVPVVEEAEDDLPELS |
| Ga0214917_104503202 | 3300022752 | Freshwater | MVKGETVMPVPGGEITTTEILVPVEPVVEEAEDDLPELS |
| Ga0214921_101407444 | 3300023174 | Freshwater | MDKGETVMPVPEGIVTTSEILVPEEVPVEEVIEEVEDDLPELS |
| Ga0214921_102141164 | 3300023174 | Freshwater | MPVPEGNITTSEILVPVVEEVVEVVEEAEDDLPELS |
| Ga0208160_11748231 | 3300025647 | Aqueous | MVKGEKIMPVPGGEITTTEILVPEVVPEVVPVEEEIEDDLPELS |
| Ga0208644_10363894 | 3300025889 | Aqueous | MPVPEGNITTTEILVPEVVPVEEATEEDEDDLPELS |
| Ga0208974_11546251 | 3300027608 | Freshwater Lentic | IPKGETIMPVPGGEITTTEILVPEVVPVEEVEDDLPELS |
| Ga0208975_10727342 | 3300027659 | Freshwater Lentic | MDKGETIMPVPGGEITTTEILVPEVVPVEEEADDSKTEQG |
| Ga0209392_10604734 | 3300027683 | Freshwater Sediment | MVEGETVMPVPEGNITTSEILVPVVEEVVEVVEEAEDDLPELS |
| Ga0209704_12646361 | 3300027693 | Freshwater Sediment | MVKGETVMPVPEGNITTSEILIPVVEEVVEVVEEPEDDLPELS |
| Ga0209188_13209741 | 3300027708 | Freshwater Lake | MDKGETIMPVPEGNITTSEILVPEEVPVEEVIEEVEDDLPELS |
| Ga0209599_100075367 | 3300027710 | Deep Subsurface | MPVPGGEITTTEILVPVVEEVVEVSTTEEDEDDLPELS |
| Ga0209499_10216985 | 3300027712 | Freshwater Lake | MPVPEGNITTSEILVPEVVPVEEVIEEVEDDLPELS |
| (restricted) Ga0247833_100134422 | 3300027730 | Freshwater | MVKGETVMPVPGGEITTTEILVPEVVPVEETTEEEVNE |
| Ga0209442_12132612 | 3300027732 | Freshwater Lake | MVKGETVMPVPGGEITTTEILVPEVVPVEEPEDDLPELS |
| Ga0209190_100049725 | 3300027736 | Freshwater Lake | MVKGETVMPVPEGVITTSEILQPVQEEVVEVSTTEEAEETDDN |
| Ga0209134_103035911 | 3300027764 | Freshwater Lake | GETVMPVPGGEITTTEILVPVEPVVEEVEDDLPELS |
| Ga0209829_100009877 | 3300027777 | Freshwater Lake | MVKGETVMPVPGGEITTTEILVPEVVPVEEVKEDEDN |
| Ga0209972_101169044 | 3300027793 | Freshwater Lake | MVKGETVMPVPEGNITTTEILVPVVEEVVEVSTTEEDEDNEDN |
| Ga0209107_101377583 | 3300027797 | Freshwater And Sediment | MVKGEEIMPVPGGEITTTEILVPEVVPVEETTEEEVDE |
| Ga0209107_105471381 | 3300027797 | Freshwater And Sediment | MPVPGGEITTTEILVPEVVPVEEEADDSKTEQGXST |
| Ga0209354_103272893 | 3300027808 | Freshwater Lake | SLGNSGPSTMVEGETVMPVPGGEITTTEILVPEVVPVEEVEDED |
| Ga0209668_106196723 | 3300027899 | Freshwater Lake Sediment | MVKGETVMPVPGGEITTTEILVPVEPVVEEVEDDLPELS |
| Ga0209820_10272144 | 3300027956 | Freshwater Sediment | MPVPGGEITTTEILVPVVEEVVEDSTTEEEVIPFERINTDDLPELS |
| Ga0209400_100305425 | 3300027963 | Freshwater Lake | MPVPEGVITTSEILQPVQEEVVEVSTTEEAEETDDN |
| Ga0209401_10700361 | 3300027971 | Freshwater Lake | MDKGETIMPVPEGIITSSEILVPEVVPVEEVIEEAEDDLPELS |
| Ga0209401_12161233 | 3300027971 | Freshwater Lake | MVKGETVMPVPGGEITTTEILVPEVVPVEETVEETDDN |
| Ga0209298_100368947 | 3300027973 | Freshwater Lake | DYKMPVPGGEITTTEILVPEVVPVEEVEDDLPELS |
| Ga0247723_10047339 | 3300028025 | Deep Subsurface Sediment | MPVPGGEITTTEILVPVVEEVVEVSTTEEEDTDGKVEE |
| Ga0247723_10128222 | 3300028025 | Deep Subsurface Sediment | MVKGEAVMPVPGGEITTTEILVPAVEEVVEVSTTEEAEDDLPELS |
| Ga0247723_10552653 | 3300028025 | Deep Subsurface Sediment | MPVPEGVITTTEILQPEEVVEVSTTEEDEDDLPELS |
| Ga0247723_11291083 | 3300028025 | Deep Subsurface Sediment | MVKGETVMPVPQGDITTTEILVPKIEEIVEEVEDEDIKVEE |
| Ga0247723_11544412 | 3300028025 | Deep Subsurface Sediment | SLGHSGPSTMVKGERIMPVPEGVITTTDILQAEVVQEVVPVEEELPEAEADDLPELQE |
| Ga0304728_10331427 | 3300028393 | Freshwater Lake | MPVPEGNITTSEILVPEEVPVEEVIEEVEDDLPELS |
| Ga0238435_1034512 | 3300029349 | Freshwater | MPVPEGNITTSEIFTPAVEEVVEDSTTEEEEDDLPELS |
| Ga0238435_1186052 | 3300029349 | Freshwater | MVKGETVMPVPEGNITTSEILVPVVEEIVEDSTTEETEDDLPELS |
| Ga0315291_109566022 | 3300031707 | Sediment | MVKGETVMPVLGGEITTTEILVPVVAPIEETTEEEANEATN |
| Ga0315907_107240452 | 3300031758 | Freshwater | MPVPEGNITTTEILVPVVEEVVEVSTTEEDEDNEDN |
| Ga0315900_110256651 | 3300031787 | Freshwater | MDKGETIMPVPGGEITTTEILVPVVEEVVEEVEDDLPELS |
| Ga0315909_102561274 | 3300031857 | Freshwater | MVKGETVMPVPEGNITTSEILIPVVEEVVEVSITEEEETDGKVEE |
| Ga0315909_106369551 | 3300031857 | Freshwater | MVKGETVMPVPEGNITTSEILVPVVEEVVETTEEETKDEAETN |
| Ga0315909_109604253 | 3300031857 | Freshwater | MVKGETVMPVPEGDITTTEILVPVVEEVVEDSTTEEVEDEA |
| Ga0315285_101828753 | 3300031885 | Sediment | MVKGETVMPVPGGEITTTEILVPEVVPVEEVEDED |
| Ga0315904_102326442 | 3300031951 | Freshwater | MPVPGGEITTTELWQAPAVEEVVEDSITEEEDEDDLPELS |
| Ga0315904_103898432 | 3300031951 | Freshwater | MVKGETVMPVPGGEITTSEILVPVVEEVAPVEEVKEEDEDN |
| Ga0315904_109889002 | 3300031951 | Freshwater | MVEGETVMPVPEGNITTSEILIPKVEEVVEVIEEETKDES |
| Ga0315904_113760501 | 3300031951 | Freshwater | MAKGETVMPVPEGNITTSEILTPAVEEVVEDSTTEEEEDDLPELS |
| Ga0315905_1001125025 | 3300032092 | Freshwater | MPVPEGNITTSEILVPVVEEVVETSTTEEVEETDDN |
| Ga0334980_0286478_429_545 | 3300033816 | Freshwater | MPVPEGNITTSDILIPVVEEVVEVSTTEEAEDDLPELS |
| Ga0334982_0151905_745_903 | 3300033981 | Freshwater | MVKGETVMPVPGGEITTSEILKPVVEEVVEVSTTEEEVIPFERIDTDDLPEL |
| Ga0334982_0247574_636_767 | 3300033981 | Freshwater | VVKGETIMPVPGGEITTSEILVPEVVPVEEVTEEAEDDLPELS |
| Ga0334982_0327451_314_475 | 3300033981 | Freshwater | MVKGETVMPVPGGEITTSEILVPVVEEVVEVSTTEEEVIPFERIDTDDLPELS |
| Ga0335003_0034117_2066_2203 | 3300033995 | Freshwater | MVKGETVMPVPEGNITTSDILVPVVEEVVEEVKEETTEDDLPELS |
| Ga0335003_0071897_1051_1170 | 3300033995 | Freshwater | MVKGETVMPVPGGEITTTEILVPEVIPVEEVEDDLPELP |
| Ga0335003_0139652_795_914 | 3300033995 | Freshwater | MVKGETVMPVPGGEITTSEILVPEVVPVEEVEDDLPELQ |
| Ga0334979_0172539_142_285 | 3300033996 | Freshwater | MAKGETVMPVPEGNITTTEILVPEVVPEEVVETSTTEEDEDDLSELS |
| Ga0334991_0377345_413_532 | 3300034013 | Freshwater | MVKGETIMPVPGGEITTTEILVPVEAVVEEVEDDLPELP |
| Ga0334985_0416523_203_322 | 3300034018 | Freshwater | MVKGETVMPVPGGEITTTEILVPEVVPVEEDKDDLPELP |
| Ga0335005_0001299_14417_14536 | 3300034022 | Freshwater | MVKGETIMPVPGGEITTTEILVPVEPVVEEVEDDLPELP |
| Ga0335023_0008794_5354_5488 | 3300034050 | Freshwater | MVKGETVMPVPEGNITTSDILVPVVEEVVEVSTTEEAEDDLPKL |
| Ga0334987_0030197_618_749 | 3300034061 | Freshwater | MVKGETVMPVPEGVITTTDILQAEVVQEVVPEDEEDDLPELQE |
| Ga0334987_0269079_754_891 | 3300034061 | Freshwater | MVKGETVMPVPEGNITTSEILVPVVEEVVEVSTIEEDEDDLPELS |
| Ga0334995_0373914_16_147 | 3300034062 | Freshwater | MDKGETVMPVPEGNITTSEILVPVVEEVVEVVEEAEDDLPELS |
| Ga0335019_0031958_79_210 | 3300034066 | Freshwater | MAKGETVMPVPEGNITTSEILVPVVEEVVEVVEEAEDDLPELS |
| Ga0335019_0158387_64_204 | 3300034066 | Freshwater | MVKGETVMPVPGGEITTSEILVPVVEEVVEVSTTEEEAEDDLPELS |
| Ga0335019_0475159_2_118 | 3300034066 | Freshwater | MVKGETVMPVPGGKITTTEILVPEVVPVEEVEDDLPELP |
| Ga0335010_0397144_623_742 | 3300034092 | Freshwater | MVKGETIMPVPGGEITTSEILVPEVVPVEEVKEEAEVEE |
| Ga0335010_0501984_312_443 | 3300034092 | Freshwater | MVKGETVMPVPEGNITTTEILVPVVEEVVEVVEEDEDDLPELS |
| Ga0335027_0027245_1049_1162 | 3300034101 | Freshwater | MPVPQGDITTTEILVPEVEVVPEVVPDEDEDDLPELS |
| Ga0335027_0337727_221_352 | 3300034101 | Freshwater | MVKGETVMPVPEGNITTSEILVPVVEEVVEVSTTEEDEDNEDN |
| Ga0335027_0404012_676_813 | 3300034101 | Freshwater | MVKGETVMPVPEGNITTSEILVPVVEEVVEVSTTEEAEDDLPELS |
| Ga0335027_0594565_2_109 | 3300034101 | Freshwater | MVKGETIMPVPGGEITSTETWDATPEEVIEEAVEEV |
| Ga0335029_0338599_673_792 | 3300034102 | Freshwater | MVKGETVMPVPGGEITTTEILVPVEPVVEEVEDDLPELP |
| Ga0335029_0677674_289_420 | 3300034102 | Freshwater | MVKGETIMPVPGGEITTSEILVPEVVPVEEVTEEAEDDLSELS |
| Ga0335029_0785188_63_182 | 3300034102 | Freshwater | MAKGETVMPVPGGEITTSEILVPEVVPVEEVKEEAEVEE |
| Ga0335031_0265847_175_309 | 3300034104 | Freshwater | MVKGETVMPVPGGEITTTEILVPVVEEVVETSTTEEDEDDLPEL |
| Ga0335035_0635278_424_546 | 3300034105 | Freshwater | MGKGEPIMPVPGGEITTTEILVPEVVPVVEEAEDDLPELS |
| Ga0335036_0583434_351_491 | 3300034106 | Freshwater | MVKGETVMPVPEGNITTSEILIPTVEEVVEVSTTEEEAEDDLPELS |
| Ga0335036_0714378_474_587 | 3300034106 | Freshwater | MPVPGGEITTSEILVPEVEVVPEVVPDEDEDDLPELS |
| Ga0335063_0108362_1225_1356 | 3300034111 | Freshwater | VVEGEAIMPVPGGEITTSEILVPEVVPVEEVTEEAEDDLPELS |
| Ga0335066_0666098_191_328 | 3300034112 | Freshwater | MAKGETVMPVPEGNITTSDILVPVVEEVVEVSTTEEAEDDLPELS |
| Ga0335068_0053051_200_322 | 3300034116 | Freshwater | MVKGETVMPVPEGNITTSEILIPKVEEVVEVIEEETKDES |
| Ga0335054_0272800_512_637 | 3300034119 | Freshwater | MPVPGGEITTTEILIPAAQVEAALEAALAAEETEDDLPELS |
| Ga0335054_0577277_314_454 | 3300034119 | Freshwater | MVKGETVMPVPEGNITTSEILVPVVEEVVEVSTTEEEAEDDLPELS |
| Ga0335056_0501194_428_556 | 3300034120 | Freshwater | MVKGETVMPVPGGEITTTEILVPEEVPVEETTEEEVKDEATN |
| Ga0335007_0633385_271_402 | 3300034283 | Freshwater | MAKGETVMPVPEGNITTTEILVPEVVPVEEATEEDEDDLPELS |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |